2E8JA

Solution structure of dynein light chain 2a
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
96
structure length
96
Chain Sequence
MAEVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDIDPQNDLTFLRIRSKKNEIMVAPDKDYFLIVIQNPTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of dynein light chain 2A
rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Dynein light chain 2A, cytoplasmic
total genus 17
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03259 Robl_LC7 Roadblock/LC7 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 2e8jA00
1VETB 3T12B 2ZL1B 1ACFA 1FILA 4X25A 1SZVA 3CPTB 1D1JA 1J3WA 1VEUB 2ZL1A 3UB5P 1CJFA 1Z09A 2ACGA 1HLUP 2B95A 2V8FA 3LEQA 1FIKA 3NULA 3CPTA 2JKGA 2V8CA 5EV0A 5FDSA 3T1QB 4D60A 5FEGA 1VETA 1A0KA 1PRQA 2JKFA 3L9KA 1CF0A 2VK3A 1VEUA 1CQAA 1PFLA 3MSHA 3LGOA 3NECA 4X1LA 5EVEA 2HZ5A 1K0KA 3KYEA 1PNEA 2PBDP 1SKOA 2E8JA 1AWIA 1YPRA 2PAVP 3CHWP 1SKOB 2PRFA 4X1MA 3T1SA 1G5UA 4QWOA 5EM0A 4FUWA 3D9YA 1Y4OA 4FTXA 5FEFA 3L7HA 4ESPA 3MS6A 3T1RA 3T1XA 5EM1A 3U4LP 3DAVA 2BTFP 1F2KA
chains in the Genus database with same CATH superfamily
1ESUA 4PAUA 4X25A 4FCFA 4Y7PA 1S6RA 2X71A 4LGWA 5FQKA 3BY9A 2Y2LA 2L1MA 2EFUA 4HH2A 4L9GA 4R4SA 2JKRM 1XGIA 1XPBA 5FI7A 5JYOA 3SH7A 1PZPA 4G3WA 1LLBA 3VP0A 3QP4A 1DP8A 3VE4A 4JKTA 3PBQA 2R9XA 4KUKA 5TBMB 3G4PA 4P0MA 4R23A 1SZVA 2VGJA 4MBKA 4D2OA 2Y4AA 4KUOA 3RJUA 1IKGA 3E4QA 4RA7A 3CUEC 2P04A 4IVIA 5F6AA 2ZM0A 2P9VB 3MXQA 3IX8A 3Q82A 1W8QA 4LENA 5F5YA 3N8LA 1MWUA 2NUPC 4MBHA 2WZXA 1RGYA 1FIKA 2PDRA 3KSFA 2ZJ9A 2OWJA 3R7WB 4S2NA 1QMEA 4DDYA 1MZUA 4LCMA 1V9ZA 4MCWA 3PXPA 4BL3A 2QJ5A 4O01A 1XXMA 4WEKA 3MQOA 3OZHA 5I5LA 2Y2NA 1OJGA 3FZCA 3NC8A 3V39A 2QMIA 3VFFA 4PM6A 4DXBA 1OJ5A 3UE6A 5GLDA 1S1YA 3P98A 4I3AA 4JXWA 5GHXA 4R0QA 1DY6A 4ETZA 4X56A 5KSHA 3PYPA 1LHYA 3SS5A 5FAQA 1JVJA 3UB5P 4OOLA 4S2NC 2E8IA 5FQ9A 4YFMA 2WK0A 1VETA 3B33A 4ZJ3A 1YM1A 2X02A 3ZG8B 2QHKA 4XT2A 2ZQ8A 2Y79A 2ZM8A 1K6RA 5E43A 1YMSA 3BFEA 1E3UA 2PD7A 1NY0A 3ZG9B 4H8RA 3S1YA 4LRYC 5CTMA 1M6KA 1GHMA 3LO7A 3NOUC 2XA7M 2D01A 2BG1A 1MWTA 4U0XA 3UO9A 1J9MA 3F1OA 5J3WA 2UV0E 3ZVWA 4PKYG 1ACFA 5F83A 2VLGA 5CTNA 1SDNA 5HD5A 1Z09A 4OVDA 2XF3A 2EX8A 1OTIA 2O9BA 1SKFA 3UPNA 4CQHA 4Y0TA 3E2LA 5FI2A 1GSVA 2FZ0A 4HP4A 2Z2MB 1TDLA 3LYXA 2PYPA 4QB8A 2XFSA 1F9IA 4PKYA 3ZNYA 1XJ2A 2J9OA 5TFQA 1WYBA 3G2YA 2R78A 2A3UA 3KYZA 1FCOA 3OBFA 1T1AA 1YLTA 2GDNA 5EECA 2YKFA 3C5AA 1C3BA 4KQOA 4B93A 3I7JA 3E4OA 3GRJA 1K56D 3S4XA 4DRTA 4NXGA 3VP1A 1VEUB 2OAQ1 3NHQA 3UE1A 4C6YA 4DE1A 2XR0A 3FKWA 3Q7ZA 3FC7A 2ZM2A 4Z9QA 1SDEA 1L0GA 1S66L 3S7OA 4KG6A 4BBTA 2ZOHA 2W0NA 4BQMA 3FG8A 2Z2LB 3MXSA 4KZ5A 4E3MA 4U0TA 1W5DA 2LB9A 1GA0A 4Y2FA 3LIBA 3VOLA 4R3BA 4KQDA 1S4SA 4Y17A 1ES4A 2ZC6B 4X1MA 4R70A 1YLJA 1GHPA 4UAAA 3R4KA 5L10A 1ONHA 4DKIA 4M3KA 1ERMA 1TS6A 4EUZA 4C75A 1H8MA 1AXBA 2WKEA 1V9YA 2WAFA 4Q8IA 2JCHA 4O0PA 4UA7A 2LB5A 5HWTA 4DN0A 4DE3A 3IXBA 1FOFA 4BBVA 2BTFP 3GR2A 4S2KA 4DDSA 4MDZA 1I2SA 3ZGAB 5E2HA 2JKGA 4E3IA 3DWZA 2XH9A 4X68A 1MWSA 5DTTA 4GS9A 3HBRA 4Q0JA 4KQQA 2HV1A 3WS1A 4I39A 4LV0A 5AQ9A 5J7EA 4EERA 1PWCA 5L07A 2PU2A 1ES3A 5CRFA 3NULA 1DJAA 5HL1A 4RX2A 1XP4A 3HCYA 4FOFA 4P6ZM 2ZQAA 5CGXA 1MC0A 2KDKA 3BLMA 3LR5A 3IF6B 1MKMA 4IUKA 4WYYA 3IF6C 3MMHA 3NY4A 2EFXA 3HUMA 3LIAA 4II7A 4X1LA 1LL9A 5GHZA 4NXBA 4L9EA 5GLAA 3A3EA 3M6HA 4OOMA 3VSLA 2JC7A 4K0XA 5LBRA 4E6XA 3D4FA 2K2NA 3M6BA 3ZG7B 1U60A 3ZQ5A 4KZ7A 5KZHA 2W27A 4CLCB 4O7DA 1XJ4A 5AVFA 2PR6A 4I3IA 2Y91A 3LEZA 4YOFA 4RX3A 5HL6A 3FWLA 3O86A 2PRFA 1EWZA 4LV3A 1I5QA 3A3IA 1NWZA 3VE3A 5EE8A 1MWRA 3H82B 2JKTM 2O9CA 2Q0OA 3UMDA 2Y2JA 2EXAA 2EX6A 3QP6A 3MFDA 1ZKJA 2A49A 3OPLA 5A93A 2EXBA 3ZHHA 3UN7A 2VV8A 5CHUA 4JF4A 3HLGA 2J3TC 3AGFA 3EWKA 3FPVA 4Y5FA 4I5SA 2K7SA 3D72A 1D1JA 3WRTA 2Y2IA 4ARZA 2VGKA 4UHUA 5F68A 3T1QB 4XXRA 4UA9A 3LGOA 2VV7A 2WGWB 5HPFA 2VV6A 4EW7A 4B4ZA 2QWSA 4QD4A 2ZQDA 5AQ7A 4MBFA 4JLFA 1BTLA 3G2ZA 1CEFA 4S2IA 1YLYA 4L9FA 1BYWA 2OOLA 5JYPA 5FQQA 3EEHA 2W1TB 5F69A 3MFXA 1XA7A 2H0TA 1LL8A 2GZAA 3IBJA 3HJIA 3UE3A 1ERQA 4H6JB 4EXOA 2V1ZA 1L0DA 3M2JA 3E98A 3BFCA 4ZRRA 2OWHA 4N9KA 3Q81A 1EW0A 2P08A 4U3TA 4JGQA 4BBUA 1LSXA 3IXGA 1ZC2A 3T4SA 1PI4A 5AQAA 3Q7VB 1GA9A 3C2WA 3QP2A 4L0LA 3S7PA 5DFYA 3LR0A 1N4OA 4MNRA 4OQGA 5HX9A 3G6OA 1S4RA 2WADA 1PI5A 3BQAA 2B95A 3CLOA 4OLDA 4KZ8A 3L9KA 4E04A 4WEJA 4EESA 3UB7A 2EX2A 4OQ0A 2ZQ7A 3IF5A 1NZUA 2XGNA 4MLLA 3A3JA 1BZAA 1ONGA 4NXFA 2MJ6A 4OP5A 3RXXA 1Q2PA 1XGJA 3H7WB 5G18A 3E0YA 1XJ3A 3S7QA 5TJJA 1G6AA 3NOPC 4JXSA 1OT6A 1PYYA 3IS2B 1RGZA 3CJMA 3CWFA 1JNUA 3Q07A 1FILA 4RQ9A 3HLDA 1KVMA 1OTEA 3OPRA 4E3NA 5EUAA 2V1BA 2WAEA 3RXWA 1YT4A 1L0EA 2Q9MA 5HSQA 4N1XA 2DRWA 1K57C 2XFTA 4GN2A 1DRMA 4FTXA 3ITAA 5K5BA 1FR1A 4H6JA 3TW8A 2G7UA 3P09A 4HOIA 3MZDA 4JXVA 4QHCA 3G34A 3C7UA 2QZ6A 4YINA 4FSFA 3IWIA 1PNEA 2QPNA 5GL9A 5J4EA 4GKUA 5CGSA 4LRXC 3F1NB 4X6TA 2J80A 5I94A 2ACGA 3BRMA 2FFFB 2L0WA 2OLVA 3T4QA 3KO6A 1BSGA 3HVFA 5EFWA 4E3OA 1HZOA 4WM9A 5D3OA 3DTMA 4OPRA 4CLCE 4CJNA 2P74A 1JWZA 5FEFA 3BY8A 3U4LP 3BM6A 4GB7A 3OCLA 3T12B 4OH0A 1K4FA 3EQVA 1FCNA 5HDCA 4BLMA 3ZVTA 4F3LA 1W79A 2XD5A 3F1PB 2W3DA 2JN7A 4JGPA 1HD8A 2W3FA 3WS0A 4K0WA 2W3GA 2UWXA 1W63Q 1GSXA 1KE0A 3O3VA 4KZAA 3DBAA 3GV9A 2V8FA 4EUVA 1D06A 4WELA 2Y2OA 3BFFA 1Z6FA 1CI9A 4GD8A 4KZ3A 2RCXA 4HIAA 1K54C 3KYEA 4R1GA 3OC2A 1HVBA 2A24A 2HDQA 4E6WA 1O07A 2XEPA 4JXGA 5CX7A 1H3QA 4ZBEA 4GDNA 4Y3IA 3DAVA 3V3SA 3C4OA 3SOIA 3V5MA 4ARZB 4HJ4A 2DMWA 2OSUA 1FSYA 4IUHA 2O0YA 5DTSA 2V0UA 3PR6A 3B42A 1GHIA 4HBUA 2WZZA 2Y55A 5FL3A 3K3CA 1X0OA 5BOHA 4DJ2A 2JBFA 3FV7A 4EETB 4OPYA 2B02A 4F3LB 2ZC7A 3LEQA 3MZFA 3UPPA 3IWOA 3A0RA 3VOYA 1RP5A 1T1CA 3CITA 2KX6A 3TJZC 4ID4A 3KSIA 4EBPA 2L4RA 3EQUA 1TS8A 3DTEA 4CPKA 5FQIA 2P7JA 1XX2A 4BL2A 4QY6A 4HJ3A 1KE4A 3WWXA 4DMZA 4ZTKA 1N9LA 4UEYA 3S22A 4WF0A 4BMWA 4ESPA 2XSSA 2NUTC 3MS6A 5HZHA 4I38A 1H8YA 3B3XA 1UWNX 1NLYA 5CHMA 3V50A 5CGWA 5EV0A 4WMCD 4EBLA 3VP4A 4X69A 3A0VA 5FAPA 3PBNA 5TR7A 4Y0OA 3UDIA 4GHIA 4X55A 4CLCD 5M18A 3MQQA 5DF8A 4DE2A 1T19A 1QMFA 5DKKA 1J3WA 5MC7A 5HWWA 4S2PA 5GHYA 5EOEA 1CEGA 4OPQA 1K0KA 2DNSA 5M19A 2HP9A 1YPRA 1PIOA 3T1SA 4N9LA 3E2KA 2PT7A 2WUQA 1KDWA 2PHYA 1KVLA 5L8MA 1D7EA 3LR4A 2WKIA 2VEAA 1A0KA 3JYIA 1VM1A 2J3WA 1DJBA 5IU1A 2W3HA 4GZBA 4Z1WA 1LI9A 1VB6A 1BLCA 1BLHA 3GQZA 3PAGA 5E2EA 1PWDA 1IELA 3NBLA 4KZ6A 3IX3A 1IYOA 3GSGA 3N6IA 3RH8B 3MKEA 1K57A 1FCMA 3HLBA 4YNRA 5CEBA 2XDMA 4K08A 3LIDA 5HARA 2QKPA 3KSHA 4EWFA 2M7UA 3LCEA 3IF6A 2ZC5B 2VZWA 3JVVA 5HDSA 2ZLYA 2PR5A 5HD3A 3D9YA 1KGEA 3TE8A 5GLBA 3W2ZA 4E3LA 4BENA 3O88A 2J7VA 3RFBA 2HP5A 2EWVA 1LL5A 5E2FA 3F1OB 3C4PA 2V0WA 1CF0A 3NOTC 3A0SA 4OQIA 3D3OA 4GS9B 3IXHA 5EVIB 3IX4A 3OPHA 2R9WA 4RVAA 3S7NA 1EI5A 4GJ4A 4PM7A 2H10A 4N1HA 4CLCA 1GCEA 1NJ4A 4PM5A 3ZG5A 3AGEA 3H9WA 1YAXA 1H8ZA 3EGDC 3CPTB 1F5MA 3UDFA 3CUEA 1K54A 1MXOA 3DTKA 1YMXA 3Q1FA 1KE3A 5U47A 3CAXA 4EQ1A 4UQIS 5FQJA 3F1PA 3HLEA 3LFVA 3PHYA 1AWIA 1KGGA 4JPMA 1Q2QA 4IVKA 2PYRA 4DJ3A 3TG9A 2GJ3A 1TS0A 1LT0A 5TBMA 4KG5A 3JVUA 3LUQA 3BQ8A 3ITBA 1EROA 4GW9A 1FQGA 2K31A 5AVEA 5L2FA 4OOYA 3OPPA 4R6LA 4AFIA 4NEED 1NRJA 4NG2A 2A24B 1RCJA 3LY3A 4HHDA 4KZ4A 3ZYTA 2H5SA 4GCZA 1XFQA 3LY4A 2X01A 3B47A 1PW1A 2WKHA 3IT9A 2V1AA 3K3DA 2HP6A 1KDSA 1E25A 3E4PA 1TEMA 2Z6CA 2XA7S 3DTIA 4PPRA 3UPOA 4IBXA 1TD5A 1VHMA 1M40A 3AGDA 4BJPA 3N4IA 3T4LA 4QPRA 1OT9A 4LRZE 4N92A 5G4ZA 3ZNTA 1TS7A 1SHVA 3NIAA 1Y4OA 3C30A 4LV1A 4S2JA 3T1XA 3LI8A 2Y2HA 1NZOA 3WS5A 1TDGA 2CMNA 2WKPA 4WZ5A 3P01A 1P9RA 1IYQA 5HWVA 2ZQCA 3SW1A 4HJ6A 1WE4A 3VSKA 4ETXA 2J8YA 1MKIA 2VGLM 2Y59A 1CI8A 4XT2B 2HF6A 2XK1A 1IYPA 1YLZA 5EM1A 3JPUA 1MY8A 1L0FA 1CJFA 3A3DA 3LI9A 5AQBA 1OPXA 2VKSA 4UQIM 2CC1A 3CPTA 3A3FA 3UE0A 5IHVA 4NETA 3T4TA 4YWZA 5HPIA 3UNWA 4MMNA 2G2WA 1NYMA 1JWVA 1UWPX 4PMAA 1XA1A 3HREA 5HAPA 2VX8A 2IWCA 3PBTA 4R3AA 3ZG0A 4OONA 2D02A 1FSWA 4P85A 5FATA 1NLZA 3ICYA 1W7FA 1NYYA 5FEGA 4GDBA 1CQAA 3HLWA 3CI6A 3NCKA 3IQAA 3TOIA 3WS2A 3DW0A 2IWDA 5J8XA 4WN5A 4ZJ2A 2WGVA 5HW3A 2M7VA 4G3VA 2HJEA 4IJGA 2Y2GA 4OP8A 5FDHA 1ODVA 4ME4A 2JKFA 2XLNA 2ZQ9A 4QY5A 3O5YA 3PBOA 1SKOA 2W3EA 1I2WA 1L3LA 1IKIA 4O8GA 1W8YA 1BULA 1W63M 3TSGA 3MBZA 5EVIC 5AJGA 5EOOA 4R4RA 3BEBA 5FDSA 1ZTUA 3BYDA 2V20A 1IFQA 1P9WA 3SH8A 1YSQA 5G4YA 4EBNA 1XKZA 2PBDP 2PBYA 2ZMAA 3N8RA 3EEAA 3IS2A 1IOUA 4Q0HA 4E3JA 2EWWA 5DJUA 1Y54A 4WBGA 1CK3A 2ZC3B 3IBRA 4B9OA 3MKFA 5EVIA 3CHWP 4KG2A 2VA0A 3UY6A 2I72A 4HBTA 4C3QA 3FYZA 1P97A 4S2OA 3QP8A 1PZOA 3W4QA 1BUEA 3UB6A 4E3KA 2ZMVA 1ES2A 2V8CA 1KOUA 2GNXA 3V67A 3K2NA 1ZG4A 4G3KA 3KSGA 2E8JA 3T4OA 2PAVP 5CXWA 4B88A 3IH9A 4JF5A 3N8SA 4WZ4A 4HH3A 5EVLA 2HDSA 1K6SA 4GLQA 1F2KA 1ZHHB 1E4DA 3MR0A 2C5WB 3BLSA 2O9AA 2RL3A 2ZOIA 3BWLA 4I3JA 5KMWA 3N7WA 2HDUA 1DJCA 2QJ7A 1G5UA 1SCWA 1LSWA 3BW6A 3LR3A 3IXDA 3HL9A 2INWA 3NI9A 4BWIA 2Y2MA 3SS4A 3UMEA 2FH5A 3IH8A 3BFDA 5EVEA 2JKTI 4EEPA 4LFUA 4EEUA 5F1GA 3MXRA 2JHEA 4HP9A 4CLCC 4F94A 1XJ6A 3DWKA 4KZBA 2M1CA 4QU3A 3CG5A 3PAEA 5DF7A 1HLUP 3T4KA 2ZMFA 4HNBA 2W1TA 2G2UA 5DF9A 3SH9A 4KZ9A 5CHJA 3OCNA 2FFYA 4OLGA 4B4XA 4MN6A 3WRZA 1WYCA 4IHQA 4A5RA 3G35A 4JGRA 2BLSA 4WLAA 2V9AA 1G68A 2OLUA 1YSPA 1G6OA 3G32A 3V3RA 2A2LA 5IS1A 5A90A 3EOIA 5FI6A 4MN5A 1ESIA 3MF0A 4OKPA 4JF6A 3ZFZA 1DP9A 2Z6DA 3CMZA 2WKQA 2Y2PA 3C38A 1VEUA 4LPZA 2O99A 5A91A 3RTYA 4Y0UA 5DVAA 1H5XA 4GOGA 3GVBA 3T1RA 2ZBBA 4HESA 4FH4A 2BASA 3U2AA 3NDGA 5A92A 4WL9A 1K55C 4QJGA 3FKVA 1PFLA 5CEDA 2WKRA 3LIFA 4PM9A 5EPHA 3VOZA 3UB9A 3QNCA 4WMCA 3FPWA 1VETB 5FAOA 2HJ9C 2P9VA 3BJNA 1FR6A 3LIEA 1P0ZA 4IEDA 2QYBA 5HDDA 3HJKA 3VMAA 5HAQA 4RYEA 1YQSA 4GHIB 3IHAA 1SKOB 4QWOA 3VP3A 1K56A 3C8CA 4HQAA 5FASA 1MBLA 4EV4A 1N9NA 1N9OA 4Q0IA 4LV2A 2W1RA 1K25A 4OQHA 3IWQA 3H82A 4EU0A 5DFXA 5L09A 1Y28A 5DKLA 3GTCA 3CZDA 2J9PA 3NDEA 4ZDXA 2I9VA 3KX0X 2PU4A 5FQMA 3LICA 1ALQA 1OTBA 1BLPA 4EQIA 3PBRA 5GLCA 1JTDA 3O87A 1HTZA 2IWBA 2ZC4B 1DP6A 2JKRI 3OLOA 4GNUA 5KSCA 2H0YA 4NK3A 1YLWA 4P6BA 4R38A 4MN7A 5DJTA 2PD8A 1LI0A 4HY8A 4HEFA 2XD1A 4X53A 1JWPA 3QP5A 2B18A 2VGLS 3MZEA 5DTKA 1TF1A 2ZD8A 5E2GA 2XRNA 3SS3A 4GD6A 1GSWA 2HGVA 2Q9NA 2B5RA 1OTDA 5EVID 2EX9A 3GDIA 4LLOB 1K4EA 2Y8HA 1PW8A 5C5KA 3W4OA 2KOIA 3P7NA 5CERA 1UGUA 5CECA 4JGOA 4ZAMA 2WGIA 1STZA 1IYSA 1S0WA 3HUNA 4P6ZS 4S2MA 4DF6A 3G30A 3PBSA 3GECA 4P87A 4UA6A 2H28A 1OTAA 2JE5A 1PWGA 1E3UD 4M4XA 3MQ0A 1PRQA 2VK3A 3UDXA 5FA7A 3VV4A 2Y2QA 4ZJ1A 5TGFA 4FH2A 2ZL1B 4WUJA 1YLPA 4R3JA 3T4JA 3MSHA 4DXCA 3W4PA 3G31A 4LCLA 3H7WA 5EM0A 3F1NA 1BT5A 3UB8A 2WGWA 2C6WB 4Y13A 4XUXA 1ZG6A 2DCFA 5F82A 2OV5A 2HPBA 4D60A 2XROA 1L2SA 3QNBA 1NXYA 1TVFA 3ULFA 3GMWA 4WZ5C 1LSVA 1IEMA 3M2KA 3PTEA 4NXEA 1T1BA 2XQZA 5HAIA 3KYQA 1K38A 1T18A 3QHYA 2ZL1A 3T50A 2EA9A 1K55A 4Y15A 4S2LA 3HUOA 3TRCA 5KIZA 1H0MA 1JTGA 1G28A 3QP1A 4FUWA 3VP2A 1XFNA 1OMEA 3HLCA 1N9BA 4BD1A 4PM8A 2HDRA 4DE0A 4BD0A 2V2FF 1KGFA 1O7EA 5IT5A 1VQQA 4OPZA 2OAP1 3ISGA 1YKDA 5A8BA 2J3TD 3L7HA 3IHBA 4IBRA 4KQRA 1S1ZA 1BLSA 5M1AA 2Y2KA 3ZCZA 4FD8A 2IA2A 3BFGA 4HI4A 2HZ5A 2AVXA 4PHTA 4NKPA 3SZTA 1ES5A 1MPLA 3ZDJA 2VJWA 1WA9A 3EGXC 4XUZA 5HFOA 1NRFA 2YKHA 2WYXA 3R7WA 2GX5A 3WS4A 1F98A 5FSRA 3NECA 3HLFA 3NJAA 5F1FA 1S67L 3VFHA 4K91A 3OOVA 4JBFA 3Q7VA 3C7VA 3BECA 2KLIA 3W8KA 3MJQA 4KENB 4MEZA
chains in the Genus database with same CATH topology
1VETB 3T12B 2ZL1B 1ACFA 1FILA 4X25A 1SZVA 3CPTB 1D1JA 1J3WA 1VEUB 2ZL1A 3UB5P 1CJFA 1Z09A 2ACGA 1HLUP 2B95A 2V8FA 3LEQA 1FIKA 3NULA 3CPTA 2JKGA 2V8CA 5EV0A 5FDSA 3T1QB 4D60A 5FEGA 1VETA 1A0KA 1PRQA 2JKFA 3L9KA 1CF0A 2VK3A 1VEUA 1CQAA 1PFLA 3MSHA 3LGOA 3NECA 4X1LA 5EVEA 2HZ5A 1K0KA 3KYEA 1PNEA 2PBDP 1SKOA 2E8JA 1AWIA 1YPRA 2PAVP 3CHWP 1SKOB 2PRFA 4X1MA 3T1SA 1G5UA 4QWOA 5EM0A 4FUWA 3D9YA 1Y4OA 4FTXA 5FEFA 3L7HA 4ESPA 3MS6A 3T1RA 3T1XA 5EM1A 3U4LP 3DAVA 2BTFP 1F2KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VET B;  3T12 B;  2ZL1 B;  1ACF A;  1FIL A;  4X25 A;  1SZV A;  3CPT B;  1D1J A;  1J3W A;  1VEU B;  2ZL1 A;  3UB5 P;  1CJF A;  1Z09 A;  2ACG A;  1HLU P;  2B95 A;  2V8F A;  3LEQ A;  1FIK A;  3NUL A;  3CPT A;  2JKG A;  2V8C A;  5EV0 A;  5FDS A;  3T1Q B;  4D60 A;  5FEG A;  1VET A;  1A0K A;  1PRQ A;  2JKF A;  3L9K A;  1CF0 A;  2VK3 A;  1VEU A;  1CQA A;  1PFL A;  3MSH A;  3LGO A;  3NEC A;  4X1L A;  5EVE A;  2HZ5 A;  1K0K A;  3KYE A;  1PNE A;  2PBD P;  1SKO A;  2E8J A;  1AWI A;  1YPR A;  2PAV P;  3CHW P;  1SKO B;  2PRF A;  4X1M A;  3T1S A;  1G5U A;  4QWO A;  5EM0 A;  4FUW A;  3D9Y A;  1Y4O A;  4FTX A;  5FEF A;  3L7H A;  4ESP A;  3MS6 A;  3T1R A;  3T1X A;  5EM1 A;  3U4L P;  3DAV A;  2BTF P;  1F2K A; 
#chains in the Genus database with same CATH topology
 1ESU A;  4PAU A;  4X25 A;  4FCF A;  4Y7P A;  1S6R A;  2X71 A;  4LGW A;  5FQK A;  3BY9 A;  2Y2L A;  2L1M A;  2EFU A;  4HH2 A;  4L9G A;  4R4S A;  2JKR M;  1XGI A;  1XPB A;  5FI7 A;  5JYO A;  3SH7 A;  1PZP A;  4G3W A;  1LLB A;  3VP0 A;  3QP4 A;  1DP8 A;  3VE4 A;  4JKT A;  3PBQ A;  2R9X A;  4KUK A;  5TBM B;  3G4P A;  4P0M A;  4R23 A;  1SZV A;  2VGJ A;  4MBK A;  4D2O A;  2Y4A A;  4KUO A;  3RJU A;  1IKG A;  3E4Q A;  4RA7 A;  3CUE C;  2P04 A;  4IVI A;  5F6A A;  2ZM0 A;  2P9V B;  3MXQ A;  3IX8 A;  3Q82 A;  1W8Q A;  4LEN A;  5F5Y A;  3N8L A;  1MWU A;  2NUP C;  4MBH A;  2WZX A;  1RGY A;  1FIK A;  2PDR A;  3KSF A;  2ZJ9 A;  2OWJ A;  3R7W B;  4S2N A;  1QME A;  4DDY A;  1MZU A;  4LCM A;  1V9Z A;  4MCW A;  3PXP A;  4BL3 A;  2QJ5 A;  4O01 A;  1XXM A;  4WEK A;  3MQO A;  3OZH A;  5I5L A;  2Y2N A;  1OJG A;  3FZC A;  3NC8 A;  3V39 A;  2QMI A;  3VFF A;  4PM6 A;  4DXB A;  1OJ5 A;  3UE6 A;  5GLD A;  1S1Y A;  3P98 A;  4I3A A;  4JXW A;  5GHX A;  4R0Q A;  1DY6 A;  4ETZ A;  4X56 A;  5KSH A;  3PYP A;  1LHY A;  3SS5 A;  5FAQ A;  1JVJ A;  3UB5 P;  4OOL A;  4S2N C;  2E8I A;  5FQ9 A;  4YFM A;  2WK0 A;  1VET A;  3B33 A;  4ZJ3 A;  1YM1 A;  2X02 A;  3ZG8 B;  2QHK A;  4XT2 A;  2ZQ8 A;  2Y79 A;  2ZM8 A;  1K6R A;  5E43 A;  1YMS A;  3BFE A;  1E3U A;  2PD7 A;  1NY0 A;  3ZG9 B;  4H8R A;  3S1Y A;  4LRY C;  5CTM A;  1M6K A;  1GHM A;  3LO7 A;  3NOU C;  2XA7 M;  2D01 A;  2BG1 A;  1MWT A;  4U0X A;  3UO9 A;  1J9M A;  3F1O A;  5J3W A;  2UV0 E;  3ZVW A;  4PKY G;  1ACF A;  5F83 A;  2VLG A;  5CTN A;  1SDN A;  5HD5 A;  1Z09 A;  4OVD A;  2XF3 A;  2EX8 A;  1OTI A;  2O9B A;  1SKF A;  3UPN A;  4CQH A;  4Y0T A;  3E2L A;  5FI2 A;  1GSV A;  2FZ0 A;  4HP4 A;  2Z2M B;  1TDL A;  3LYX A;  2PYP A;  4QB8 A;  2XFS A;  1F9I A;  4PKY A;  3ZNY A;  1XJ2 A;  2J9O A;  5TFQ A;  1WYB A;  3G2Y A;  2R78 A;  2A3U A;  3KYZ A;  1FCO A;  3OBF A;  1T1A A;  1YLT A;  2GDN A;  5EEC A;  2YKF A;  3C5A A;  1C3B A;  4KQO A;  4B93 A;  3I7J A;  3E4O A;  3GRJ A;  1K56 D;  3S4X A;  4DRT A;  4NXG A;  3VP1 A;  1VEU B;  2OAQ 1;  3NHQ A;  3UE1 A;  4C6Y A;  4DE1 A;  2XR0 A;  3FKW A;  3Q7Z A;  3FC7 A;  2ZM2 A;  4Z9Q A;  1SDE A;  1L0G A;  1S66 L;  3S7O A;  4KG6 A;  4BBT A;  2ZOH A;  2W0N A;  4BQM A;  3FG8 A;  2Z2L B;  3MXS A;  4KZ5 A;  4E3M A;  4U0T A;  1W5D A;  2LB9 A;  1GA0 A;  4Y2F A;  3LIB A;  3VOL A;  4R3B A;  4KQD A;  1S4S A;  4Y17 A;  1ES4 A;  2ZC6 B;  4X1M A;  4R70 A;  1YLJ A;  1GHP A;  4UAA A;  3R4K A;  5L10 A;  1ONH A;  4DKI A;  4M3K A;  1ERM A;  1TS6 A;  4EUZ A;  4C75 A;  1H8M A;  1AXB A;  2WKE A;  1V9Y A;  2WAF A;  4Q8I A;  2JCH A;  4O0P A;  4UA7 A;  2LB5 A;  5HWT A;  4DN0 A;  4DE3 A;  3IXB A;  1FOF A;  4BBV A;  2BTF P;  3GR2 A;  4S2K A;  4DDS A;  4MDZ A;  1I2S A;  3ZGA B;  5E2H A;  2JKG A;  4E3I A;  3DWZ A;  2XH9 A;  4X68 A;  1MWS A;  5DTT A;  4GS9 A;  3HBR A;  4Q0J A;  4KQQ A;  2HV1 A;  3WS1 A;  4I39 A;  4LV0 A;  5AQ9 A;  5J7E A;  4EER A;  1PWC A;  5L07 A;  2PU2 A;  1ES3 A;  5CRF A;  3NUL A;  1DJA A;  5HL1 A;  4RX2 A;  1XP4 A;  3HCY A;  4FOF A;  4P6Z M;  2ZQA A;  5CGX A;  1MC0 A;  2KDK A;  3BLM A;  3LR5 A;  3IF6 B;  1MKM A;  4IUK A;  4WYY A;  3IF6 C;  3MMH A;  3NY4 A;  2EFX A;  3HUM A;  3LIA A;  4II7 A;  4X1L A;  1LL9 A;  5GHZ A;  4NXB A;  4L9E A;  5GLA A;  3A3E A;  3M6H A;  4OOM A;  3VSL A;  2JC7 A;  4K0X A;  5LBR A;  4E6X A;  3D4F A;  2K2N A;  3M6B A;  3ZG7 B;  1U60 A;  3ZQ5 A;  4KZ7 A;  5KZH A;  2W27 A;  4CLC B;  4O7D A;  1XJ4 A;  5AVF A;  2PR6 A;  4I3I A;  2Y91 A;  3LEZ A;  4YOF A;  4RX3 A;  5HL6 A;  3FWL A;  3O86 A;  2PRF A;  1EWZ A;  4LV3 A;  1I5Q A;  3A3I A;  1NWZ A;  3VE3 A;  5EE8 A;  1MWR A;  3H82 B;  2JKT M;  2O9C A;  2Q0O A;  3UMD A;  2Y2J A;  2EXA A;  2EX6 A;  3QP6 A;  3MFD A;  1ZKJ A;  2A49 A;  3OPL A;  5A93 A;  2EXB A;  3ZHH A;  3UN7 A;  2VV8 A;  5CHU A;  4JF4 A;  3HLG A;  2J3T C;  3AGF A;  3EWK A;  3FPV A;  4Y5F A;  4I5S A;  2K7S A;  3D72 A;  1D1J A;  3WRT A;  2Y2I A;  4ARZ A;  2VGK A;  4UHU A;  5F68 A;  3T1Q B;  4XXR A;  4UA9 A;  3LGO A;  2VV7 A;  2WGW B;  5HPF A;  2VV6 A;  4EW7 A;  4B4Z A;  2QWS A;  4QD4 A;  2ZQD A;  5AQ7 A;  4MBF A;  4JLF A;  1BTL A;  3G2Z A;  1CEF A;  4S2I A;  1YLY A;  4L9F A;  1BYW A;  2OOL A;  5JYP A;  5FQQ A;  3EEH A;  2W1T B;  5F69 A;  3MFX A;  1XA7 A;  2H0T A;  1LL8 A;  2GZA A;  3IBJ A;  3HJI A;  3UE3 A;  1ERQ A;  4H6J B;  4EXO A;  2V1Z A;  1L0D A;  3M2J A;  3E98 A;  3BFC A;  4ZRR A;  2OWH A;  4N9K A;  3Q81 A;  1EW0 A;  2P08 A;  4U3T A;  4JGQ A;  4BBU A;  1LSX A;  3IXG A;  1ZC2 A;  3T4S A;  1PI4 A;  5AQA A;  3Q7V B;  1GA9 A;  3C2W A;  3QP2 A;  4L0L A;  3S7P A;  5DFY A;  3LR0 A;  1N4O A;  4MNR A;  4OQG A;  5HX9 A;  3G6O A;  1S4R A;  2WAD A;  1PI5 A;  3BQA A;  2B95 A;  3CLO A;  4OLD A;  4KZ8 A;  3L9K A;  4E04 A;  4WEJ A;  4EES A;  3UB7 A;  2EX2 A;  4OQ0 A;  2ZQ7 A;  3IF5 A;  1NZU A;  2XGN A;  4MLL A;  3A3J A;  1BZA A;  1ONG A;  4NXF A;  2MJ6 A;  4OP5 A;  3RXX A;  1Q2P A;  1XGJ A;  3H7W B;  5G18 A;  3E0Y A;  1XJ3 A;  3S7Q A;  5TJJ A;  1G6A A;  3NOP C;  4JXS A;  1OT6 A;  1PYY A;  3IS2 B;  1RGZ A;  3CJM A;  3CWF A;  1JNU A;  3Q07 A;  1FIL A;  4RQ9 A;  3HLD A;  1KVM A;  1OTE A;  3OPR A;  4E3N A;  5EUA A;  2V1B A;  2WAE A;  3RXW A;  1YT4 A;  1L0E A;  2Q9M A;  5HSQ A;  4N1X A;  2DRW A;  1K57 C;  2XFT A;  4GN2 A;  1DRM A;  4FTX A;  3ITA A;  5K5B A;  1FR1 A;  4H6J A;  3TW8 A;  2G7U A;  3P09 A;  4HOI A;  3MZD A;  4JXV A;  4QHC A;  3G34 A;  3C7U A;  2QZ6 A;  4YIN A;  4FSF A;  3IWI A;  1PNE A;  2QPN A;  5GL9 A;  5J4E A;  4GKU A;  5CGS A;  4LRX C;  3F1N B;  4X6T A;  2J80 A;  5I94 A;  2ACG A;  3BRM A;  2FFF B;  2L0W A;  2OLV A;  3T4Q A;  3KO6 A;  1BSG A;  3HVF A;  5EFW A;  4E3O A;  1HZO A;  4WM9 A;  5D3O A;  3DTM A;  4OPR A;  4CLC E;  4CJN A;  2P74 A;  1JWZ A;  5FEF A;  3BY8 A;  3U4L P;  3BM6 A;  4GB7 A;  3OCL A;  3T12 B;  4OH0 A;  1K4F A;  3EQV A;  1FCN A;  5HDC A;  4BLM A;  3ZVT A;  4F3L A;  1W79 A;  2XD5 A;  3F1P B;  2W3D A;  2JN7 A;  4JGP A;  1HD8 A;  2W3F A;  3WS0 A;  4K0W A;  2W3G A;  2UWX A;  1W63 Q;  1GSX A;  1KE0 A;  3O3V A;  4KZA A;  3DBA A;  3GV9 A;  2V8F A;  4EUV A;  1D06 A;  4WEL A;  2Y2O A;  3BFF A;  1Z6F A;  1CI9 A;  4GD8 A;  4KZ3 A;  2RCX A;  4HIA A;  1K54 C;  3KYE A;  4R1G A;  3OC2 A;  1HVB A;  2A24 A;  2HDQ A;  4E6W A;  1O07 A;  2XEP A;  4JXG A;  5CX7 A;  1H3Q A;  4ZBE A;  4GDN A;  4Y3I A;  3DAV A;  3V3S A;  3C4O A;  3SOI A;  3V5M A;  4ARZ B;  4HJ4 A;  2DMW A;  2OSU A;  1FSY A;  4IUH A;  2O0Y A;  5DTS A;  2V0U A;  3PR6 A;  3B42 A;  1GHI A;  4HBU A;  2WZZ A;  2Y55 A;  5FL3 A;  3K3C A;  1X0O A;  5BOH A;  4DJ2 A;  2JBF A;  3FV7 A;  4EET B;  4OPY A;  2B02 A;  4F3L B;  2ZC7 A;  3LEQ A;  3MZF A;  3UPP A;  3IWO A;  3A0R A;  3VOY A;  1RP5 A;  1T1C A;  3CIT A;  2KX6 A;  3TJZ C;  4ID4 A;  3KSI A;  4EBP A;  2L4R A;  3EQU A;  1TS8 A;  3DTE A;  4CPK A;  5FQI A;  2P7J A;  1XX2 A;  4BL2 A;  4QY6 A;  4HJ3 A;  1KE4 A;  3WWX A;  4DMZ A;  4ZTK A;  1N9L A;  4UEY A;  3S22 A;  4WF0 A;  4BMW A;  4ESP A;  2XSS A;  2NUT C;  3MS6 A;  5HZH A;  4I38 A;  1H8Y A;  3B3X A;  1UWN X;  1NLY A;  5CHM A;  3V50 A;  5CGW A;  5EV0 A;  4WMC D;  4EBL A;  3VP4 A;  4X69 A;  3A0V A;  5FAP A;  3PBN A;  5TR7 A;  4Y0O A;  3UDI A;  4GHI A;  4X55 A;  4CLC D;  5M18 A;  3MQQ A;  5DF8 A;  4DE2 A;  1T19 A;  1QMF A;  5DKK A;  1J3W A;  5MC7 A;  5HWW A;  4S2P A;  5GHY A;  5EOE A;  1CEG A;  4OPQ A;  1K0K A;  2DNS A;  5M19 A;  2HP9 A;  1YPR A;  1PIO A;  3T1S A;  4N9L A;  3E2K A;  2PT7 A;  2WUQ A;  1KDW A;  2PHY A;  1KVL A;  5L8M A;  1D7E A;  3LR4 A;  2WKI A;  2VEA A;  1A0K A;  3JYI A;  1VM1 A;  2J3W A;  1DJB A;  5IU1 A;  2W3H A;  4GZB A;  4Z1W A;  1LI9 A;  1VB6 A;  1BLC A;  1BLH A;  3GQZ A;  3PAG A;  5E2E A;  1PWD A;  1IEL A;  3NBL A;  4KZ6 A;  3IX3 A;  1IYO A;  3GSG A;  3N6I A;  3RH8 B;  3MKE A;  1K57 A;  1FCM A;  3HLB A;  4YNR A;  5CEB A;  2XDM A;  4K08 A;  3LID A;  5HAR A;  2QKP A;  3KSH A;  4EWF A;  2M7U A;  3LCE A;  3IF6 A;  2ZC5 B;  2VZW A;  3JVV A;  5HDS A;  2ZLY A;  2PR5 A;  5HD3 A;  3D9Y A;  1KGE A;  3TE8 A;  5GLB A;  3W2Z A;  4E3L A;  4BEN A;  3O88 A;  2J7V A;  3RFB A;  2HP5 A;  2EWV A;  1LL5 A;  5E2F A;  3F1O B;  3C4P A;  2V0W A;  1CF0 A;  3NOT C;  3A0S A;  4OQI A;  3D3O A;  4GS9 B;  3IXH A;  5EVI B;  3IX4 A;  3OPH A;  2R9W A;  4RVA A;  3S7N A;  1EI5 A;  4GJ4 A;  4PM7 A;  2H10 A;  4N1H A;  4CLC A;  1GCE A;  1NJ4 A;  4PM5 A;  3ZG5 A;  3AGE A;  3H9W A;  1YAX A;  1H8Z A;  3EGD C;  3CPT B;  1F5M A;  3UDF A;  3CUE A;  1K54 A;  1MXO A;  3DTK A;  1YMX A;  3Q1F A;  1KE3 A;  5U47 A;  3CAX A;  4EQ1 A;  4UQI S;  5FQJ A;  3F1P A;  3HLE A;  3LFV A;  3PHY A;  1AWI A;  1KGG A;  4JPM A;  1Q2Q A;  4IVK A;  2PYR A;  4DJ3 A;  3TG9 A;  2GJ3 A;  1TS0 A;  1LT0 A;  5TBM A;  4KG5 A;  3JVU A;  3LUQ A;  3BQ8 A;  3ITB A;  1ERO A;  4GW9 A;  1FQG A;  2K31 A;  5AVE A;  5L2F A;  4OOY A;  3OPP A;  4R6L A;  4AFI A;  4NEE D;  1NRJ A;  4NG2 A;  2A24 B;  1RCJ A;  3LY3 A;  4HHD A;  4KZ4 A;  3ZYT A;  2H5S A;  4GCZ A;  1XFQ A;  3LY4 A;  2X01 A;  3B47 A;  1PW1 A;  2WKH A;  3IT9 A;  2V1A A;  3K3D A;  2HP6 A;  1KDS A;  1E25 A;  3E4P A;  1TEM A;  2Z6C A;  2XA7 S;  3DTI A;  4PPR A;  3UPO A;  4IBX A;  1TD5 A;  1VHM A;  1M40 A;  3AGD A;  4BJP A;  3N4I A;  3T4L A;  4QPR A;  1OT9 A;  4LRZ E;  4N92 A;  5G4Z A;  3ZNT A;  1TS7 A;  1SHV A;  3NIA A;  1Y4O A;  3C30 A;  4LV1 A;  4S2J A;  3T1X A;  3LI8 A;  2Y2H A;  1NZO A;  3WS5 A;  1TDG A;  2CMN A;  2WKP A;  4WZ5 A;  3P01 A;  1P9R A;  1IYQ A;  5HWV A;  2ZQC A;  3SW1 A;  4HJ6 A;  1WE4 A;  3VSK A;  4ETX A;  2J8Y A;  1MKI A;  2VGL M;  2Y59 A;  1CI8 A;  4XT2 B;  2HF6 A;  2XK1 A;  1IYP A;  1YLZ A;  5EM1 A;  3JPU A;  1MY8 A;  1L0F A;  1CJF A;  3A3D A;  3LI9 A;  5AQB A;  1OPX A;  2VKS A;  4UQI M;  2CC1 A;  3CPT A;  3A3F A;  3UE0 A;  5IHV A;  4NET A;  3T4T A;  4YWZ A;  5HPI A;  3UNW A;  4MMN A;  2G2W A;  1NYM A;  1JWV A;  1UWP X;  4PMA A;  1XA1 A;  3HRE A;  5HAP A;  2VX8 A;  2IWC A;  3PBT A;  4R3A A;  3ZG0 A;  4OON A;  2D02 A;  1FSW A;  4P85 A;  5FAT A;  1NLZ A;  3ICY A;  1W7F A;  1NYY A;  5FEG A;  4GDB A;  1CQA A;  3HLW A;  3CI6 A;  3NCK A;  3IQA A;  3TOI A;  3WS2 A;  3DW0 A;  2IWD A;  5J8X A;  4WN5 A;  4ZJ2 A;  2WGV A;  5HW3 A;  2M7V A;  4G3V A;  2HJE A;  4IJG A;  2Y2G A;  4OP8 A;  5FDH A;  1ODV A;  4ME4 A;  2JKF A;  2XLN A;  2ZQ9 A;  4QY5 A;  3O5Y A;  3PBO A;  1SKO A;  2W3E A;  1I2W A;  1L3L A;  1IKI A;  4O8G A;  1W8Y A;  1BUL A;  1W63 M;  3TSG A;  3MBZ A;  5EVI C;  5AJG A;  5EOO A;  4R4R A;  3BEB A;  5FDS A;  1ZTU A;  3BYD A;  2V20 A;  1IFQ A;  1P9W A;  3SH8 A;  1YSQ A;  5G4Y A;  4EBN A;  1XKZ A;  2PBD P;  2PBY A;  2ZMA A;  3N8R A;  3EEA A;  3IS2 A;  1IOU A;  4Q0H A;  4E3J A;  2EWW A;  5DJU A;  1Y54 A;  4WBG A;  1CK3 A;  2ZC3 B;  3IBR A;  4B9O A;  3MKF A;  5EVI A;  3CHW P;  4KG2 A;  2VA0 A;  3UY6 A;  2I72 A;  4HBT A;  4C3Q A;  3FYZ A;  1P97 A;  4S2O A;  3QP8 A;  1PZO A;  3W4Q A;  1BUE A;  3UB6 A;  4E3K A;  2ZMV A;  1ES2 A;  2V8C A;  1KOU A;  2GNX A;  3V67 A;  3K2N A;  1ZG4 A;  4G3K A;  3KSG A;  2E8J A;  3T4O A;  2PAV P;  5CXW A;  4B88 A;  3IH9 A;  4JF5 A;  3N8S A;  4WZ4 A;  4HH3 A;  5EVL A;  2HDS A;  1K6S A;  4GLQ A;  1F2K A;  1ZHH B;  1E4D A;  3MR0 A;  2C5W B;  3BLS A;  2O9A A;  2RL3 A;  2ZOI A;  3BWL A;  4I3J A;  5KMW A;  3N7W A;  2HDU A;  1DJC A;  2QJ7 A;  1G5U A;  1SCW A;  1LSW A;  3BW6 A;  3LR3 A;  3IXD A;  3HL9 A;  2INW A;  3NI9 A;  4BWI A;  2Y2M A;  3SS4 A;  3UME A;  2FH5 A;  3IH8 A;  3BFD A;  5EVE A;  2JKT I;  4EEP A;  4LFU A;  4EEU A;  5F1G A;  3MXR A;  2JHE A;  4HP9 A;  4CLC C;  4F94 A;  1XJ6 A;  3DWK A;  4KZB A;  2M1C A;  4QU3 A;  3CG5 A;  3PAE A;  5DF7 A;  1HLU P;  3T4K A;  2ZMF A;  4HNB A;  2W1T A;  2G2U A;  5DF9 A;  3SH9 A;  4KZ9 A;  5CHJ A;  3OCN A;  2FFY A;  4OLG A;  4B4X A;  4MN6 A;  3WRZ A;  1WYC A;  4IHQ A;  4A5R A;  3G35 A;  4JGR A;  2BLS A;  4WLA A;  2V9A A;  1G68 A;  2OLU A;  1YSP A;  1G6O A;  3G32 A;  3V3R A;  2A2L A;  5IS1 A;  5A90 A;  3EOI A;  5FI6 A;  4MN5 A;  1ESI A;  3MF0 A;  4OKP A;  4JF6 A;  3ZFZ A;  1DP9 A;  2Z6D A;  3CMZ A;  2WKQ A;  2Y2P A;  3C38 A;  1VEU A;  4LPZ A;  2O99 A;  5A91 A;  3RTY A;  4Y0U A;  5DVA A;  1H5X A;  4GOG A;  3GVB A;  3T1R A;  2ZBB A;  4HES A;  4FH4 A;  2BAS A;  3U2A A;  3NDG A;  5A92 A;  4WL9 A;  1K55 C;  4QJG A;  3FKV A;  1PFL A;  5CED A;  2WKR A;  3LIF A;  4PM9 A;  5EPH A;  3VOZ A;  3UB9 A;  3QNC A;  4WMC A;  3FPW A;  1VET B;  5FAO A;  2HJ9 C;  2P9V A;  3BJN A;  1FR6 A;  3LIE A;  1P0Z A;  4IED A;  2QYB A;  5HDD A;  3HJK A;  3VMA A;  5HAQ A;  4RYE A;  1YQS A;  4GHI B;  3IHA A;  1SKO B;  4QWO A;  3VP3 A;  1K56 A;  3C8C A;  4HQA A;  5FAS A;  1MBL A;  4EV4 A;  1N9N A;  1N9O A;  4Q0I A;  4LV2 A;  2W1R A;  1K25 A;  4OQH A;  3IWQ A;  3H82 A;  4EU0 A;  5DFX A;  5L09 A;  1Y28 A;  5DKL A;  3GTC A;  3CZD A;  2J9P A;  3NDE A;  4ZDX A;  2I9V A;  3KX0 X;  2PU4 A;  5FQM A;  3LIC A;  1ALQ A;  1OTB A;  1BLP A;  4EQI A;  3PBR A;  5GLC A;  1JTD A;  3O87 A;  1HTZ A;  2IWB A;  2ZC4 B;  1DP6 A;  2JKR I;  3OLO A;  4GNU A;  5KSC A;  2H0Y A;  4NK3 A;  1YLW A;  4P6B A;  4R38 A;  4MN7 A;  5DJT A;  2PD8 A;  1LI0 A;  4HY8 A;  4HEF A;  2XD1 A;  4X53 A;  1JWP A;  3QP5 A;  2B18 A;  2VGL S;  3MZE A;  5DTK A;  1TF1 A;  2ZD8 A;  5E2G A;  2XRN A;  3SS3 A;  4GD6 A;  1GSW A;  2HGV A;  2Q9N A;  2B5R A;  1OTD A;  5EVI D;  2EX9 A;  3GDI A;  4LLO B;  1K4E A;  2Y8H A;  1PW8 A;  5C5K A;  3W4O A;  2KOI A;  3P7N A;  5CER A;  1UGU A;  5CEC A;  4JGO A;  4ZAM A;  2WGI A;  1STZ A;  1IYS A;  1S0W A;  3HUN A;  4P6Z S;  4S2M A;  4DF6 A;  3G30 A;  3PBS A;  3GEC A;  4P87 A;  4UA6 A;  2H28 A;  1OTA A;  2JE5 A;  1PWG A;  1E3U D;  4M4X A;  3MQ0 A;  1PRQ A;  2VK3 A;  3UDX A;  5FA7 A;  3VV4 A;  2Y2Q A;  4ZJ1 A;  5TGF A;  4FH2 A;  2ZL1 B;  4WUJ A;  1YLP A;  4R3J A;  3T4J A;  3MSH A;  4DXC A;  3W4P A;  3G31 A;  4LCL A;  3H7W A;  5EM0 A;  3F1N A;  1BT5 A;  3UB8 A;  2WGW A;  2C6W B;  4Y13 A;  4XUX A;  1ZG6 A;  2DCF A;  5F82 A;  2OV5 A;  2HPB A;  4D60 A;  2XRO A;  1L2S A;  3QNB A;  1NXY A;  1TVF A;  3ULF A;  3GMW A;  4WZ5 C;  1LSV A;  1IEM A;  3M2K A;  3PTE A;  4NXE A;  1T1B A;  2XQZ A;  5HAI A;  3KYQ A;  1K38 A;  1T18 A;  3QHY A;  2ZL1 A;  3T50 A;  2EA9 A;  1K55 A;  4Y15 A;  4S2L A;  3HUO A;  3TRC A;  5KIZ A;  1H0M A;  1JTG A;  1G28 A;  3QP1 A;  4FUW A;  3VP2 A;  1XFN A;  1OME A;  3HLC A;  1N9B A;  4BD1 A;  4PM8 A;  2HDR A;  4DE0 A;  4BD0 A;  2V2F F;  1KGF A;  1O7E A;  5IT5 A;  1VQQ A;  4OPZ A;  2OAP 1;  3ISG A;  1YKD A;  5A8B A;  2J3T D;  3L7H A;  3IHB A;  4IBR A;  4KQR A;  1S1Z A;  1BLS A;  5M1A A;  2Y2K A;  3ZCZ A;  4FD8 A;  2IA2 A;  3BFG A;  4HI4 A;  2HZ5 A;  2AVX A;  4PHT A;  4NKP A;  3SZT A;  1ES5 A;  1MPL A;  3ZDJ A;  2VJW A;  1WA9 A;  3EGX C;  4XUZ A;  5HFO A;  1NRF A;  2YKH A;  2WYX A;  3R7W A;  2GX5 A;  3WS4 A;  1F98 A;  5FSR A;  3NEC A;  3HLF A;  3NJA A;  5F1F A;  1S67 L;  3VFH A;  4K91 A;  3OOV A;  4JBF A;  3Q7V A;  3C7V A;  3BEC A;  2KLI A;  3W8K A;  3MJQ A;  4KEN B;  4MEZ A; 
#chains in the Genus database with same CATH homology
 1VET B;  3T12 B;  2ZL1 B;  1ACF A;  1FIL A;  4X25 A;  1SZV A;  3CPT B;  1D1J A;  1J3W A;  1VEU B;  2ZL1 A;  3UB5 P;  1CJF A;  1Z09 A;  2ACG A;  1HLU P;  2B95 A;  2V8F A;  3LEQ A;  1FIK A;  3NUL A;  3CPT A;  2JKG A;  2V8C A;  5EV0 A;  5FDS A;  3T1Q B;  4D60 A;  5FEG A;  1VET A;  1A0K A;  1PRQ A;  2JKF A;  3L9K A;  1CF0 A;  2VK3 A;  1VEU A;  1CQA A;  1PFL A;  3MSH A;  3LGO A;  3NEC A;  4X1L A;  5EVE A;  2HZ5 A;  1K0K A;  3KYE A;  1PNE A;  2PBD P;  1SKO A;  2E8J A;  1AWI A;  1YPR A;  2PAV P;  3CHW P;  1SKO B;  2PRF A;  4X1M A;  3T1S A;  1G5U A;  4QWO A;  5EM0 A;  4FUW A;  3D9Y A;  1Y4O A;  4FTX A;  5FEF A;  3L7H A;  4ESP A;  3MS6 A;  3T1R A;  3T1X A;  5EM1 A;  3U4L P;  3DAV A;  2BTF P;  1F2K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...