2E8JA

Solution structure of dynein light chain 2a
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
96
structure length
96
Chain Sequence
b'MAEVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDIDPQNDLTFLRIRSKKNEIMVAPDKDYFLIVIQNPTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dynein light chain 2A, cytoplasmic
molecule tags Transport protein
source organism Homo sapiens
publication title Solution structure of dynein light chain 2A
rcsb
total genus 17
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03259 Robl_LC7 Roadblock/LC7 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 2e8jA00
1VEUA 1A0KA 3D9YA 1FIKA 2ACGA 4X25A 3CPTB 1AWIA 1PNEA 4FTXA 5EM0A 4X1MA 1K0KA 1CF0A 2PAVP 3L9KA 1Z09A 1VETB 1Y4OA 2PRFA 2V8CA 3NULA 1CQAA 5FEGA 2JKFA 5FEFA 1G5UA 1SZVA 2B95A 3NECA 3T1RA 3T1XA 1YPRA 3DAVA 1SKOB 1ACFA 1J3WA 2PBDP 3T12B 2JKGA 2HZ5A 5EM1A 4D60A 1PFLA 5EV0A 1D1JA 4ESPA 1VETA 3CPTA 3T1SA 3U4LP 1SKOA 1CJFA 3L7HA 1PRQA 1FILA 3LGOA 3MSHA 1F2KA 2V8FA 2VK3A 2ZL1A 3CHWP 3LEQA 5EVEA 5FDSA 3T1QB 3UB5P 4FUWA 4QWOA 1VEUB 2BTFP 2ZL1B 3KYEA 1HLUP 2E8JA 3MS6A 4X1LA
chains in the Genus database with same CATH superfamily
4LV0A 1Y4OA 4N92A 4Y0UA 2ZMVA 3IX4A 2XGNA 4FH4A 4KZ4A 5F1GA 4FSFA 3ZG5A 1ES2A 4Y2FA 2ZC6B 1YT4A 4IBXA 1L2SA 3LY4A 3OC2A 3NY4A 4RA7A 4E3MA 3P09A 4ZBEA 4EUZA 3O5YA 1PI4A 1K4FA 1T1CA 3GDIA 1KDWA 1FILA 2JHEA 3EGXC 3VP1A 4K0WA 2V0WA 1ZHHB 3B47A 3MXQA 1I5QA 2M7UA 1Z6FA 2PAVP 4MDZA 1E25A 3C2WA 4R23A 2PDRA 3QP4A 2QJ7A 4L0LA 1MPLA 3RH8B 4WZ5C 5DJTA 1XJ6A 5FDSA 4KZAA 4GN2A 4LCLA 1LI9A 4L9FA 4QY5A 5FAQA 2KX6A 4WUJA 4DE2A 3G30A 5CERA 4KZ6A 3KSIA 1WA9A 4DDSA 2VGLM 1KE4A 3S7OA 1K4EA 4HBTA 5JYPA 3MSHA 1I2WA 4YOFA 1K38A 3T4LA 3ZG9B 4RX3A 3KYEA 4X55A 3OPHA 4ETZA 2GZAA 3V50A 4BD1A 4UA9A 5HX9A 1TEMA 5EUAA 3G34A 4KZ3A 3PBSA 4OONA 1SKFA 1JVJA 4QB8A 5HD3A 5J4EA 4GKUA 3MQ0A 2A49A 3IHAA 3WS4A 1BZAA 4ARZB 2PBYA 1HD8A 1Y28A 2W3DA 1RGZA 3ISGA 2ZD8A 1MBLA 3VE3A 3PHYA 3U2AA 1CJFA 1YLJA 3BEBA 2XROA 4OH0A 4R3JA 4R6LA 2W1TA 3F1OB 1T1BA 4S2NC 3EQUA 1GA9A 5FQ9A 1WE4A 4P87A 5FAPA 5EVIA 1NRJA 2OLUA 4G3KA 5G18A 4E3OA 1UGUA 3LI9A 3T1SA 4S2PA 5HARA 4X6TA 4CLCC 1N4OA 3MFDA 1VB6A 1PYYA 3VSKA 3CJMA 4PMAA 4GLQA 3N8LA 4EXOA 2K7SA 3C8CA 1YKDA 5GLBA 2PYRA 3T12B 2M1CA 4NXBA 3V39A 4OQHA 4Y7PA 3LCEA 3UB8A 3HREA 1PWCA 1FCNA 2WKHA 4G3WA 4HH3A 5AQ7A 5DTKA 3IH9A 3ITAA 3O88A 3R4KA 4LGWA 4B4XA 3W4PA 2V0UA 1W63Q 3KO6A 1YAXA 5HPIA 1U60A 3VOYA 1GCEA 3E2KA 1OTEA 1KGEA 2J7VA 4EV4A 4QY6A 3RXWA 4DE3A 2PU2A 2MJ6A 4DE1A 2JKFA 1OTAA 3T4JA 3E4QA 3T1XA 4JF4A 2R78A 2HDQA 3IXHA 3Q7ZA 1PWDA 4GB7A 3P98A 3D3OA 3FC7A 3MF0A 3NDGA 2EA9A 2VLGA 3EGDC 2O0YA 2VEAA 1NZOA 4IJGA 5HDCA 1HVBA 3UDXA 1ESIA 1K57C 2R9WA 1FSYA 5F68A 2FFFB 5FQJA 4ESPA 4C75A 2WKRA 3IWOA 1CEGA 3SOIA 3Q82A 1Q2QA 4XXRA 3UNWA 2JKTM 4IVIA 1L0EA 3S22A 3N8RA 2JN7A 2PYPA 2A24B 1LSXA 2XA7M 5GLCA 2D01A 2HDRA 2R9XA 3SZTA 4QJGA 3QNCA 2Y2OA 1SKOB 3V67A 3GRJA 5G4YA 4LFUA 1F9IA 3RXXA 1F2KA 4OLDA 2O99A 4EWFA 3IX8A 4WYYA 4YINA 3TOIA 4RYEA 5CGWA 3IF5A 2W3GA 2P08A 2A3UA 5DF8A 3CI6A 3WS0A 1DP9A 2WGVA 2PBDP 1TVFA 3DBAA 4AFIA 4EBPA 4Q8IA 1H8ZA 2VKSA 2OV5A 2XLNA 4M4XA 3OCNA 4WMCD 3F1PA 2UV0E 3V3RA 5J7EA 1E3UA 1S4RA 3JYIA 1ONGA 4KQOA 1YPRA 3F1NA 1ALQA 5I94A 1S67L 2H5SA 3BFGA 2XRNA 3IXDA 3RTYA 3OZHA 4FD8A 5CXWA 5AVEA 3W4QA 1BTLA 3PXPA 3T1RA 1SZVA 2B95A 2Y2MA 3BQAA 4FH2A 3LIAA 3S7NA 1LL8A 3MFXA 2Y79A 3MKFA 3LIEA 1H0MA 3T4SA 1JWPA 5GHZA 5J3WA 5DTTA 4NXGA 4Z9QA 2KDKA 1NZUA 5L2FA 2G2UA 5GLDA 4DKIA 1LSVA 4CLCB 4DF6A 4I3IA 4OP5A 5EVID 1XJ3A 4KQRA 1X0OA 1BUEA 3IXBA 1PRQA 1GSXA 2Y2KA 4M3KA 2GDNA 3PBQA 1DJBA 3GV9A 3CUEC 2K2NA 1BULA 3OOVA 2JC7A 5GHYA 1Z09A 4KG2A 5KSHA 2QWSA 2J9PA 3S7QA 1ES5A 3DW0A 2B02A 1XFNA 3BFEA 3OBFA 1PZOA 3UE3A 4WLAA 3JPUA 1XKZA 3MZDA 1FQGA 2HDUA 4G3VA 3N7WA 5KSCA 2IWCA 3D9YA 2HJ9C 2ACGA 1S6RA 1LSWA 4KZBA 4R3BA 3VE4A 5HSQA 3T4TA 5AJGA 3IWIA 4UEYA 4DE0A 1H8YA 5EVLA 4RVAA 1GHMA 1DJCA 2Y91A 3HUOA 4KQQA 3HLEA 1OTDA 3Q81A 4GJ4A 4NK3A 1WYBA 4HNBA 1MY8A 3TSGA 4GDNA 2WYXA 2W3EA 4N9KA 1O07A 4JGRA 2Y2GA 3D4FA 1NXYA 4Y3IA 2V9AA 5A92A 2WAFA 4WZ5A 3M2JA 3ZQ5A 4X68A 2OAQ1 1YQSA 5FI6A 4HJ6A 5EOEA 5FQKA 3ZG0A 2PD7A 5TR7A 3Q7VB 3QP1A 4BMWA 1IELA 3IF6B 5D3OA 5A8BA 1VETB 2J9OA 2QPNA 4R70A 3MXSA 4IUKA 3ZCZA 1SKOA 3OPLA 2EWWA 3PBRA 5FSRA 3R7WA 3SS5A 1L0FA 2LB9A 5CX7A 1V9YA 5FEGA 3ZNTA 2ZLYA 1VETA 3QP6A 3U4LP 3SH7A 1PZPA 3GTCA 1K57A 1VM1A 1IYPA 2GNXA 1FCOA 5M1AA 1VEUB 1IEMA 3UMDA 3IXGA 2ZMAA 3EEAA 2ZQ8A 4S2OA 2HP5A 3NULA 3UDIA 1BYWA 4HI4A 1RCJA 5E2HA 4CPKA 3LR3A 5DF7A 3UB9A 3PTEA 3UY6A 3UPPA 2Z2LB 3O86A 1LI0A 1UWNX 4IVKA 4OPRA 4CLCD 1K25A 4QHCA 3BW6A 1T1AA 4IEDA 5FI7A 4PM6A 4D2OA 1K56D 4NEED 3VFHA 3SW1A 1UWPX 4BQMA 2EX8A 1GSVA 3LR4A 3BY8A 1YLYA 3BFFA 2Z6DA 2V8FA 2ZM0A 3AGFA 4LCMA 1S66L 4H6JB 5HL1A 3LIBA 4BENA 4EBLA 2BG1A 4R4RA 4QPRA 3BFDA 2P7JA 3UN7A 3SH9A 5FDHA 5HAQA 4WMCA 1S1ZA 5CHMA 1CF0A 5A90A 4JXSA 4I3JA 3NECA 2ZMFA 4GD8A 3K2NA 4MLLA 2VV6A 4Z1WA 1KVMA 2GX5A 1ESUA 3PYPA 3UB7A 4Y15A 2JBFA 5L10A 3DTMA 5HPFA 3BLSA 5TBMB 4GCZA 3VP0A 2HGVA 4OOLA 2ZC5B 2XD1A 4KZ8A 2XFSA 1K55A 4MMNA 3UDFA 4OPZA 3CHWP 1PW1A 2ZC7A 3FV7A 2XA7S 2A2LA 2JKTI 3GR2A 2YKHA 3LO7A 3A3DA 4B4ZA 3EOIA 5IHVA 1HZOA 5F82A 4GNUA 1SDNA 1ES3A 5CECA 4WF0A 4CLCA 3VMAA 4IUHA 4YFMA 3UE1A 2PU4A 3M2KA 2XFTA 4GW9A 1BLSA 3G6OA 1K54C 4IBRA 4HP9A 4JGOA 4PKYG 1IKIA 1TS7A 4HIAA 1MXOA 4B9OA 1S0WA 3CAXA 1BT5A 4KUKA 3C7VA 1GSWA 3G2YA 5I5LA 2Y2HA 4XUZA 5BOHA 4OQIA 1K56A 3ZNYA 3A3IA 1DY6A 4MBKA 2W3HA 5HFOA 5A93A 1G5UA 1IKGA 3UE0A 4A5RA 4YWZA 3S4XA 1XFQA 2JKGA 2OSUA 1W63M 1M6KA 1ODVA 1Y54A 2O9BA 1K54A 3V3SA 2WZZA 4X1LA 2ZQDA 2H10A 3N4IA 1ES4A 3KSGA 4LRYC 2NUTC 5E2EA 4ME4A 4P6BA 4X69A 3BQ8A 4CJNA 5DKLA 3F1NB 3NI9A 4WN5A 1IFQA 3BFCA 1XJ4A 4EETB 4HQAA 1DP8A 3TW8A 2P74A 1CI9A 1XGIA 1YMXA 1FSWA 3NJAA 4L9EA 1N9BA 3FKWA 3PBTA 1NWZA 1FR1A 4HBUA 3DAVA 1L3LA 4ZJ3A 1C3BA 2XR0A 4GDBA 2V1ZA 3C4OA 3ZFZA 4MNRA 1RP5A 2VGJA 4UA7A 2HDSA 1TF1A 4GS9B 1FIKA 4NKPA 1SCWA 4EESA 1GHIA 3NHQA 3ZVWA 3M6HA 4HH2A 3KX0X 5HZHA 2W1TB 4I5SA 3A3JA 3QP8A 1IYSA 1MWUA 1YMSA 1PIOA 3VOZA 4JXGA 2I9VA 1EW0A 3P7NA 1S1YA 1YLZA 4WL9A 1A0KA 2JKRI 3FYZA 4Y0OA 2FFYA 5AQ9A 4BBVA 4E6XA 4FTXA 1IOUA 4OP8A 4UHUA 4HESA 2FH5A 4L9GA 2VJWA 3CPTA 1JWVA 3LYXA 1IYQA 3ZG7B 5F5YA 3LEQA 2CMNA 1P9RA 4UQIM 1L0GA 1LL9A 5EFWA 2JCHA 3E4PA 2GJ3A 2CC1A 4ID4A 4O8GA 5U47A 2OAP1 5TBMA 5F6AA 3OPPA 4E04A 4GHIA 1TDGA 2VGLS 4OOYA 1W7FA 1QMEA 3S7PA 2ZBBA 3HVFA 5DTSA 1MKMA 3ICYA 4NETA 4JGPA 4E3IA 2Y4AA 2K31A 4HEFA 3HLBA 1P0ZA 3FG8A 4S2MA 2XD5A 2A24A 3I7JA 4BL3A 3B3XA 4KUOA 1O7EA 1MZUA 2KOIA 2ZC3B 2X01A 4MCWA 3FKVA 1XPBA 3F1PB 2Q9NA 3A3FA 4N1HA 5E43A 1ZG4A 3DWKA 3H82B 2B5RA 4WEJA 2KLIA 4EU0A 3CZDA 3QP2A 5KZHA 3BWLA 4P0MA 3UPOA 3F1OA 4JXVA 1JNUA 2L0WA 1W79A 2DNSA 1G28A 3LGOA 2LB5A 3VP3A 1YLWA 4OKPA 1PI5A 4OPQA 2QYBA 4JGQA 2ZJ9A 1XGJA 5HD5A 2IA2A 3A0SA 2IWBA 1K6RA 5FEFA 3BECA 4B93A 1OJ5A 1N9LA 2RL3A 3JVVA 3HL9A 4U0XA 2JE5A 3IX3A 3HUNA 1SHVA 2FZ0A 3HLWA 4S2NA 4UA6A 1TD5A 5GL9A 1N9NA 4XT2A 2QHKA 4PM7A 5DFXA 3AGEA 3IS2B 5L8MA 2HPBA 3LFVA 2XQZA 1KGGA 2UWXA 2PR6A 3MQOA 4MN5A 3CMZA 4HHDA 3DTEA 1WYCA 1E4DA 4Q0JA 4WELA 2QJ5A 2W1RA 3WS5A 5EOOA 3HBRA 1NY0A 5F83A 2XDMA 3DTKA 4P6ZS 3A0RA 3ZGAB 4O0PA 3TE8A 1XXMA 3KSFA 3LICA 1DP6A 4S2IA 3IBJA 1STZA 3W8KA 2P9VB 3T4OA 5EVIB 4JPMA 3IF6C 2HJEA 5GLAA 4MEZA 1VEUA 3G4PA 1G6AA 2QKPA 3VFFA 5IS1A 2L4RA 4UQIS 1H8MA 5LBRA 1F98A 1TDLA 4HOIA 3MR0A 5TGFA 1XX2A 3GMWA 4D60A 4ARZA 3K3DA 1P9WA 3G31A 2ZQ7A 5HWTA 4U3TA 5EVEA 3ZHHA 4R1GA 1NYMA 3R7WB 1NLZA 1HLUP 2WGWB 2VV7A 4PPRA 2EXAA 5DF9A 2H0YA 5GHXA 4U0TA 2V1BA 1PW8A 4EEPA 1PFLA 1XJ2A 1LT0A 3UPNA 4E3LA 4DJ2A 2VK3A 3H7WB 4C6YA 5TJJA 1NYYA 5G4ZA 2Z6CA 3WWXA 4ZTKA 2VV8A 3LUQA 5JYOA 3L9KA 3CUEA 4UAAA 3HUMA 3PAGA 1YM1A 3O87A 3D72A 1YLPA 2J80A 4PM5A 3EWKA 2DCFA 3SH8A 5HAPA 4Y17A 4GHIB 1CI8A 3MS6A 4MBHA 2ZQCA 2EXBA 2VA0A 2V1AA 2V8CA 5F69A 3WS2A 3AGDA 1GHPA 3HCYA 3Q07A 4LRXC 4KZ9A 4DN0A 1QMFA 4LV3A 3LR5A 3T4QA 1MWTA 4HJ3A 2PR5A 2ZL1A 3WRZA 3IH8A 3QHYA 1MC0A 3B33A 1EROA 3TJZC 4HY8A 3MZEA 4IHQA 4E3KA 2DRWA 4LV2A 3HLGA 5FASA 1D7EA 4XT2B 3UE6A 3HJIA 1PWGA 2OLVA 3W2ZA 1NLYA 3K3CA 4EQ1A 3A0VA 4Y0TA 4HP4A 5M18A 3KSHA 1KDSA 1KOUA 4DXCA 1V9ZA 5KMWA 4NG2A 5AVFA 2Y2LA 2WKPA 1YLTA 2L1MA 1T19A 2BLSA 4KQDA 4R4SA 4NXFA 1JTGA 3IWQA 1P97A 1XA7A 1OMEA 1DJAA 1Q2PA 2V20A 3HLCA 2Y8HA 4DXBA 5DKKA 1XA1A 4GD6A 4JF6A 1TS0A 1KE0A 2QZ6A 4OQ0A 3ZDJA 2WK0A 3G32A 2DMWA 4F3LA 4F94A 4N9LA 5HDSA 3UB6A 2XSSA 1IYOA 2OWJA 4Y13A 4ZDXA 3ITBA 2V2FF 2EFUA 5CTNA 2VX8A 2XK1A 1ERQA 4N1XA 2PHYA 4I38A 2D02A 3OLOA 5EM1A 1JTDA 3E0YA 3ZG8B 2Y2QA 1LLBA 3L7HA 1KVLA 4BL2A 3BRMA 3MXRA 4R38A 4K91A 4ZAMA 5EVIC 3NC8A 4S2JA 3MQQA 1CEFA 2WKQA 1VHMA 1GA0A 4ZJ1A 4PM8A 3VSLA 1MWSA 4DJ3A 4E6WA 3ZVTA 3Q1FA 1YSQA 2QMIA 1ZTUA 4BD0A 2O9AA 2G7UA 1MKIA 4E3NA 2VGKA 3SS4A 5C5KA 3PAEA 1YSPA 5HDDA 2H0TA 3C7UA 1ZKJA 3LR0A 3FPWA 4PAUA 2Z2MB 3GECA 3RFBA 3MMHA 4DRTA 2B18A 3B42A 4K08A 4ZRRA 1E3UD 1KE3A 3V5MA 2W3FA 3C5AA 5FQQA 1LL5A 4BJPA 3IHBA 3NOTC 2WADA 1OT9A 3CITA 5FQIA 4LLOB 4DDYA 2HF6A 1KGFA 2PD8A 1MWRA 4DMZA 4H8RA 3UB5P 2W0NA 3NOUC 1FCMA 3ULFA 5M19A 5E2GA 2Q0OA 3IQAA 4PM9A 3C30A 2WGWA 3VP2A 2NUPC 3E4OA 5IT5A 3ZYTA 4S2LA 2BASA 3NBLA 5IU1A 1H3QA 3OCLA 3UMEA 3BY9A 2J3WA 1ZC2A 1OT6A 3HLDA 4I3AA 3FZCA 4EUVA 3DWZA 3NIAA 5J8XA 2EFXA 3C4PA 3QNBA 4FOFA 4JLFA 2WZXA 3GVBA 1T18A 2X71A 1S4SA 3Q7VA 4LV1A 2OOLA 3CWFA 4EQIA 4B88A 4WM9A 5E2FA 4RQ9A 4I39A 2Y2IA 1K0KA 5CEBA 1I2SA 4MN7A 2J3TC 3KYQA 2HP6A 3UO9A 2YKFA 3HLFA 2HZ5A 4BWIA 2ZQAA 2IWDA 3NDEA 2RCXA 1CK3A 1TS8A 5FA7A 1ACFA 4OLGA 4CQHA 3BYDA 3BJNA 4BBTA 5EPHA 2PRFA 4II7A 1W8YA 5K5BA 3LY3A 2EX9A 4O01A 4OQGA 3E2LA 5EECA 1W5DA 3T50A 4EERA 4H6JA 4OOMA 5HW3A 4Q0IA 4EEUA 3MZFA 1FR6A 3KYZA 3LIFA 4X53A 2Y59A 4MN6A 2EX6A 3VOLA 5A91A 5KIZA 4R0QA 2M7VA 2ZOIA 2XF3A 1NRFA 1BLPA 2Y2PA 3EEHA 3LIDA 4BBUA 1OTIA 2ZM8A 4WZ4A 2HV1A 3T1QB 4GZBA 5DJUA 3N6IA 4P85A 1AXBA 5CHJA 4KG6A 1BSGA 3BM6A 2WAEA 5HL6A 1BLHA 1PNEA 4R3AA 2P9VA 2ZQ9A 4EW7A 3FPVA 1J3WA 5CTMA 4PKYA 4BLMA 5AQAA 4JXWA 4ETXA 2ZC4B 3LI8A 1ONHA 3TRCA 1EI5A 1EWZA 2Q9MA 4WBGA 3RJUA 1FOFA 3VP4A 1OPXA 4QD4A 3WS1A 4LENA 5CRFA 3VV4A 2INWA 3BLMA 5TFQA 4Q0HA 2WGIA 4FUWA 4QWOA 3GQZA 3P01A 5FI2A 3E98A 1VQQA 4P6ZM 2ZM2A 5DVAA 1G6OA 1K55C 3IF6A 5EV0A 2XH9A 2C5WB 2WUQA 4K0XA 3H7WA 1BLCA 4HJ4A 2Y55A 4JBFA 3HJKA 5HAIA 4X1MA 2Y2JA 3PBNA 4MBFA 5L07A 3S1YA 1G68A 1LHYA 5MC7A 3PR6A 2J8YA 1JWZA 1OJGA 4KENB 3JVUA 1XP4A 2X02A 4QU3A 2XEPA 2ZOHA 3M6BA 2H28A 3IS2A 3SS3A 2G2WA 3NCKA 3N8SA 2WKIA 5AQBA 3CG5A 1ZG6A 3TG9A 3WRTA 2W27A 3OPRA 4LPZA 4JKTA 3H82A 3G2ZA 5CHUA 1N9OA 5CGSA 3IBRA 2AVXA 4X56A 2ZL1B 4GOGA 4NXEA 1L0DA 4GS9A 3MBZA 5FQMA 2I72A 4ZJ2A 4JF5A 5CEDA 5FATA 5HWVA 1SDEA 2EWVA 3DTIA 4PHTA 1NJ4A 5FL3A 3IT9A 2J3TD 2HP9A 1RGYA 4XUXA 5F1FA 3FWLA 4WEKA 4CLCE 2JKRM 3CPTB 5EM0A 3A3EA 3GSGA 5FAOA 1D06A 1ERMA 1F5MA 2C6WB 5L09A 5DFYA 4E3JA 3PBOA 1M40A 1W8QA 1K6SA 2PT7A 3EQVA 3CLOA 4KZ5A 1DRMA 2E8JA 5HWWA 4X25A 1AWIA 3QP5A 3H9WA 1CQAA 2WKEA 4O7DA 1HTZA 4C3QA 3W4OA 4KG5A 4EBNA 1D1JA 1TS6A 2Y2NA 2BTFP 3T4KA 2O9CA 3NOPC 4F3LB 3G35A 4RX2A 5CGXA 5EE8A 2P04A 4KZ7A 1J9MA 4FCFA 2VZWA 1H5XA 3MJQA 2EX2A 3LEZA 3MKEA 3C38A 2E8IA 2OWHA 4S2KA 4YNRA 4Y5FA 4LRZE 4OPYA 1OTBA 4OVDA 3O3VA
chains in the Genus database with same CATH topology
1VEUA 1A0KA 3D9YA 1FIKA 2ACGA 4X25A 3CPTB 1AWIA 1PNEA 4FTXA 5EM0A 4X1MA 1K0KA 1CF0A 2PAVP 3L9KA 1Z09A 1VETB 1Y4OA 2PRFA 2V8CA 3NULA 1CQAA 5FEGA 2JKFA 5FEFA 1G5UA 1SZVA 2B95A 3NECA 3T1RA 3T1XA 1YPRA 3DAVA 1SKOB 1ACFA 1J3WA 2PBDP 3T12B 2JKGA 2HZ5A 5EM1A 4D60A 1PFLA 5EV0A 1D1JA 4ESPA 1VETA 3CPTA 3T1SA 3U4LP 1SKOA 1CJFA 3L7HA 1PRQA 1FILA 3LGOA 3MSHA 1F2KA 2V8FA 2VK3A 2ZL1A 3CHWP 3LEQA 5EVEA 5FDSA 3T1QB 3UB5P 4FUWA 4QWOA 1VEUB 2BTFP 2ZL1B 3KYEA 1HLUP 2E8JA 3MS6A 4X1LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VEU A;  1A0K A;  3D9Y A;  1FIK A;  2ACG A;  4X25 A;  3CPT B;  1AWI A;  1PNE A;  4FTX A;  5EM0 A;  4X1M A;  1K0K A;  1CF0 A;  2PAV P;  3L9K A;  1Z09 A;  1VET B;  1Y4O A;  2PRF A;  2V8C A;  3NUL A;  1CQA A;  5FEG A;  2JKF A;  5FEF A;  1G5U A;  1SZV A;  2B95 A;  3NEC A;  3T1R A;  3T1X A;  1YPR A;  3DAV A;  1SKO B;  1ACF A;  1J3W A;  2PBD P;  3T12 B;  2JKG A;  2HZ5 A;  5EM1 A;  4D60 A;  1PFL A;  5EV0 A;  1D1J A;  4ESP A;  1VET A;  3CPT A;  3T1S A;  3U4L P;  1SKO A;  1CJF A;  3L7H A;  1PRQ A;  1FIL A;  3LGO A;  3MSH A;  1F2K A;  2V8F A;  2VK3 A;  2ZL1 A;  3CHW P;  3LEQ A;  5EVE A;  5FDS A;  3T1Q B;  3UB5 P;  4FUW A;  4QWO A;  1VEU B;  2BTF P;  2ZL1 B;  3KYE A;  1HLU P;  2E8J A;  3MS6 A;  4X1L A; 
#chains in the Genus database with same CATH topology
 4LV0 A;  1Y4O A;  4N92 A;  4Y0U A;  2ZMV A;  3IX4 A;  2XGN A;  4FH4 A;  4KZ4 A;  5F1G A;  4FSF A;  3ZG5 A;  1ES2 A;  4Y2F A;  2ZC6 B;  1YT4 A;  4IBX A;  1L2S A;  3LY4 A;  3OC2 A;  3NY4 A;  4RA7 A;  4E3M A;  3P09 A;  4ZBE A;  4EUZ A;  3O5Y A;  1PI4 A;  1K4F A;  1T1C A;  3GDI A;  1KDW A;  1FIL A;  2JHE A;  3EGX C;  3VP1 A;  4K0W A;  2V0W A;  1ZHH B;  3B47 A;  3MXQ A;  1I5Q A;  2M7U A;  1Z6F A;  2PAV P;  4MDZ A;  1E25 A;  3C2W A;  4R23 A;  2PDR A;  3QP4 A;  2QJ7 A;  4L0L A;  1MPL A;  3RH8 B;  4WZ5 C;  5DJT A;  1XJ6 A;  5FDS A;  4KZA A;  4GN2 A;  4LCL A;  1LI9 A;  4L9F A;  4QY5 A;  5FAQ A;  2KX6 A;  4WUJ A;  4DE2 A;  3G30 A;  5CER A;  4KZ6 A;  3KSI A;  1WA9 A;  4DDS A;  2VGL M;  1KE4 A;  3S7O A;  1K4E A;  4HBT A;  5JYP A;  3MSH A;  1I2W A;  4YOF A;  1K38 A;  3T4L A;  3ZG9 B;  4RX3 A;  3KYE A;  4X55 A;  3OPH A;  4ETZ A;  2GZA A;  3V50 A;  4BD1 A;  4UA9 A;  5HX9 A;  1TEM A;  5EUA A;  3G34 A;  4KZ3 A;  3PBS A;  4OON A;  1SKF A;  1JVJ A;  4QB8 A;  5HD3 A;  5J4E A;  4GKU A;  3MQ0 A;  2A49 A;  3IHA A;  3WS4 A;  1BZA A;  4ARZ B;  2PBY A;  1HD8 A;  1Y28 A;  2W3D A;  1RGZ A;  3ISG A;  2ZD8 A;  1MBL A;  3VE3 A;  3PHY A;  3U2A A;  1CJF A;  1YLJ A;  3BEB A;  2XRO A;  4OH0 A;  4R3J A;  4R6L A;  2W1T A;  3F1O B;  1T1B A;  4S2N C;  3EQU A;  1GA9 A;  5FQ9 A;  1WE4 A;  4P87 A;  5FAP A;  5EVI A;  1NRJ A;  2OLU A;  4G3K A;  5G18 A;  4E3O A;  1UGU A;  3LI9 A;  3T1S A;  4S2P A;  5HAR A;  4X6T A;  4CLC C;  1N4O A;  3MFD A;  1VB6 A;  1PYY A;  3VSK A;  3CJM A;  4PMA A;  4GLQ A;  3N8L A;  4EXO A;  2K7S A;  3C8C A;  1YKD A;  5GLB A;  2PYR A;  3T12 B;  2M1C A;  4NXB A;  3V39 A;  4OQH A;  4Y7P A;  3LCE A;  3UB8 A;  3HRE A;  1PWC A;  1FCN A;  2WKH A;  4G3W A;  4HH3 A;  5AQ7 A;  5DTK A;  3IH9 A;  3ITA A;  3O88 A;  3R4K A;  4LGW A;  4B4X A;  3W4P A;  2V0U A;  1W63 Q;  3KO6 A;  1YAX A;  5HPI A;  1U60 A;  3VOY A;  1GCE A;  3E2K A;  1OTE A;  1KGE A;  2J7V A;  4EV4 A;  4QY6 A;  3RXW A;  4DE3 A;  2PU2 A;  2MJ6 A;  4DE1 A;  2JKF A;  1OTA A;  3T4J A;  3E4Q A;  3T1X A;  4JF4 A;  2R78 A;  2HDQ A;  3IXH A;  3Q7Z A;  1PWD A;  4GB7 A;  3P98 A;  3D3O A;  3FC7 A;  3MF0 A;  3NDG A;  2EA9 A;  2VLG A;  3EGD C;  2O0Y A;  2VEA A;  1NZO A;  4IJG A;  5HDC A;  1HVB A;  3UDX A;  1ESI A;  1K57 C;  2R9W A;  1FSY A;  5F68 A;  2FFF B;  5FQJ A;  4ESP A;  4C75 A;  2WKR A;  3IWO A;  1CEG A;  3SOI A;  3Q82 A;  1Q2Q A;  4XXR A;  3UNW A;  2JKT M;  4IVI A;  1L0E A;  3S22 A;  3N8R A;  2JN7 A;  2PYP A;  2A24 B;  1LSX A;  2XA7 M;  5GLC A;  2D01 A;  2HDR A;  2R9X A;  3SZT A;  4QJG A;  3QNC A;  2Y2O A;  1SKO B;  3V67 A;  3GRJ A;  5G4Y A;  4LFU A;  1F9I A;  3RXX A;  1F2K A;  4OLD A;  2O99 A;  4EWF A;  3IX8 A;  4WYY A;  4YIN A;  3TOI A;  4RYE A;  5CGW A;  3IF5 A;  2W3G A;  2P08 A;  2A3U A;  5DF8 A;  3CI6 A;  3WS0 A;  1DP9 A;  2WGV A;  2PBD P;  1TVF A;  3DBA A;  4AFI A;  4EBP A;  4Q8I A;  1H8Z A;  2VKS A;  2OV5 A;  2XLN A;  4M4X A;  3OCN A;  4WMC D;  3F1P A;  2UV0 E;  3V3R A;  5J7E A;  1E3U A;  1S4R A;  3JYI A;  1ONG A;  4KQO A;  1YPR A;  3F1N A;  1ALQ A;  5I94 A;  1S67 L;  2H5S A;  3BFG A;  2XRN A;  3IXD A;  3RTY A;  3OZH A;  4FD8 A;  5CXW A;  5AVE A;  3W4Q A;  1BTL A;  3PXP A;  3T1R A;  1SZV A;  2B95 A;  2Y2M A;  3BQA A;  4FH2 A;  3LIA A;  3S7N A;  1LL8 A;  3MFX A;  2Y79 A;  3MKF A;  3LIE A;  1H0M A;  3T4S A;  1JWP A;  5GHZ A;  5J3W A;  5DTT A;  4NXG A;  4Z9Q A;  2KDK A;  1NZU A;  5L2F A;  2G2U A;  5GLD A;  4DKI A;  1LSV A;  4CLC B;  4DF6 A;  4I3I A;  4OP5 A;  5EVI D;  1XJ3 A;  4KQR A;  1X0O A;  1BUE A;  3IXB A;  1PRQ A;  1GSX A;  2Y2K A;  4M3K A;  2GDN A;  3PBQ A;  1DJB A;  3GV9 A;  3CUE C;  2K2N A;  1BUL A;  3OOV A;  2JC7 A;  5GHY A;  1Z09 A;  4KG2 A;  5KSH A;  2QWS A;  2J9P A;  3S7Q A;  1ES5 A;  3DW0 A;  2B02 A;  1XFN A;  3BFE A;  3OBF A;  1PZO A;  3UE3 A;  4WLA A;  3JPU A;  1XKZ A;  3MZD A;  1FQG A;  2HDU A;  4G3V A;  3N7W A;  5KSC A;  2IWC A;  3D9Y A;  2HJ9 C;  2ACG A;  1S6R A;  1LSW A;  4KZB A;  4R3B A;  3VE4 A;  5HSQ A;  3T4T A;  5AJG A;  3IWI A;  4UEY A;  4DE0 A;  1H8Y A;  5EVL A;  4RVA A;  1GHM A;  1DJC A;  2Y91 A;  3HUO A;  4KQQ A;  3HLE A;  1OTD A;  3Q81 A;  4GJ4 A;  4NK3 A;  1WYB A;  4HNB A;  1MY8 A;  3TSG A;  4GDN A;  2WYX A;  2W3E A;  4N9K A;  1O07 A;  4JGR A;  2Y2G A;  3D4F A;  1NXY A;  4Y3I A;  2V9A A;  5A92 A;  2WAF A;  4WZ5 A;  3M2J A;  3ZQ5 A;  4X68 A;  2OAQ 1;  1YQS A;  5FI6 A;  4HJ6 A;  5EOE A;  5FQK A;  3ZG0 A;  2PD7 A;  5TR7 A;  3Q7V B;  3QP1 A;  4BMW A;  1IEL A;  3IF6 B;  5D3O A;  5A8B A;  1VET B;  2J9O A;  2QPN A;  4R70 A;  3MXS A;  4IUK A;  3ZCZ A;  1SKO A;  3OPL A;  2EWW A;  3PBR A;  5FSR A;  3R7W A;  3SS5 A;  1L0F A;  2LB9 A;  5CX7 A;  1V9Y A;  5FEG A;  3ZNT A;  2ZLY A;  1VET A;  3QP6 A;  3U4L P;  3SH7 A;  1PZP A;  3GTC A;  1K57 A;  1VM1 A;  1IYP A;  2GNX A;  1FCO A;  5M1A A;  1VEU B;  1IEM A;  3UMD A;  3IXG A;  2ZMA A;  3EEA A;  2ZQ8 A;  4S2O A;  2HP5 A;  3NUL A;  3UDI A;  1BYW A;  4HI4 A;  1RCJ A;  5E2H A;  4CPK A;  3LR3 A;  5DF7 A;  3UB9 A;  3PTE A;  3UY6 A;  3UPP A;  2Z2L B;  3O86 A;  1LI0 A;  1UWN X;  4IVK A;  4OPR A;  4CLC D;  1K25 A;  4QHC A;  3BW6 A;  1T1A A;  4IED A;  5FI7 A;  4PM6 A;  4D2O A;  1K56 D;  4NEE D;  3VFH A;  3SW1 A;  1UWP X;  4BQM A;  2EX8 A;  1GSV A;  3LR4 A;  3BY8 A;  1YLY A;  3BFF A;  2Z6D A;  2V8F A;  2ZM0 A;  3AGF A;  4LCM A;  1S66 L;  4H6J B;  5HL1 A;  3LIB A;  4BEN A;  4EBL A;  2BG1 A;  4R4R A;  4QPR A;  3BFD A;  2P7J A;  3UN7 A;  3SH9 A;  5FDH A;  5HAQ A;  4WMC A;  1S1Z A;  5CHM A;  1CF0 A;  5A90 A;  4JXS A;  4I3J A;  3NEC A;  2ZMF A;  4GD8 A;  3K2N A;  4MLL A;  2VV6 A;  4Z1W A;  1KVM A;  2GX5 A;  1ESU A;  3PYP A;  3UB7 A;  4Y15 A;  2JBF A;  5L10 A;  3DTM A;  5HPF A;  3BLS A;  5TBM B;  4GCZ A;  3VP0 A;  2HGV A;  4OOL A;  2ZC5 B;  2XD1 A;  4KZ8 A;  2XFS A;  1K55 A;  4MMN A;  3UDF A;  4OPZ A;  3CHW P;  1PW1 A;  2ZC7 A;  3FV7 A;  2XA7 S;  2A2L A;  2JKT I;  3GR2 A;  2YKH A;  3LO7 A;  3A3D A;  4B4Z A;  3EOI A;  5IHV A;  1HZO A;  5F82 A;  4GNU A;  1SDN A;  1ES3 A;  5CEC A;  4WF0 A;  4CLC A;  3VMA A;  4IUH A;  4YFM A;  3UE1 A;  2PU4 A;  3M2K A;  2XFT A;  4GW9 A;  1BLS A;  3G6O A;  1K54 C;  4IBR A;  4HP9 A;  4JGO A;  4PKY G;  1IKI A;  1TS7 A;  4HIA A;  1MXO A;  4B9O A;  1S0W A;  3CAX A;  1BT5 A;  4KUK A;  3C7V A;  1GSW A;  3G2Y A;  5I5L A;  2Y2H A;  4XUZ A;  5BOH A;  4OQI A;  1K56 A;  3ZNY A;  3A3I A;  1DY6 A;  4MBK A;  2W3H A;  5HFO A;  5A93 A;  1G5U A;  1IKG A;  3UE0 A;  4A5R A;  4YWZ A;  3S4X A;  1XFQ A;  2JKG A;  2OSU A;  1W63 M;  1M6K A;  1ODV A;  1Y54 A;  2O9B A;  1K54 A;  3V3S A;  2WZZ A;  4X1L A;  2ZQD A;  2H10 A;  3N4I A;  1ES4 A;  3KSG A;  4LRY C;  2NUT C;  5E2E A;  4ME4 A;  4P6B A;  4X69 A;  3BQ8 A;  4CJN A;  5DKL A;  3F1N B;  3NI9 A;  4WN5 A;  1IFQ A;  3BFC A;  1XJ4 A;  4EET B;  4HQA A;  1DP8 A;  3TW8 A;  2P74 A;  1CI9 A;  1XGI A;  1YMX A;  1FSW A;  3NJA A;  4L9E A;  1N9B A;  3FKW A;  3PBT A;  1NWZ A;  1FR1 A;  4HBU A;  3DAV A;  1L3L A;  4ZJ3 A;  1C3B A;  2XR0 A;  4GDB A;  2V1Z A;  3C4O A;  3ZFZ A;  4MNR A;  1RP5 A;  2VGJ A;  4UA7 A;  2HDS A;  1TF1 A;  4GS9 B;  1FIK A;  4NKP A;  1SCW A;  4EES A;  1GHI A;  3NHQ A;  3ZVW A;  3M6H A;  4HH2 A;  3KX0 X;  5HZH A;  2W1T B;  4I5S A;  3A3J A;  3QP8 A;  1IYS A;  1MWU A;  1YMS A;  1PIO A;  3VOZ A;  4JXG A;  2I9V A;  1EW0 A;  3P7N A;  1S1Y A;  1YLZ A;  4WL9 A;  1A0K A;  2JKR I;  3FYZ A;  4Y0O A;  2FFY A;  5AQ9 A;  4BBV A;  4E6X A;  4FTX A;  1IOU A;  4OP8 A;  4UHU A;  4HES A;  2FH5 A;  4L9G A;  2VJW A;  3CPT A;  1JWV A;  3LYX A;  1IYQ A;  3ZG7 B;  5F5Y A;  3LEQ A;  2CMN A;  1P9R A;  4UQI M;  1L0G A;  1LL9 A;  5EFW A;  2JCH A;  3E4P A;  2GJ3 A;  2CC1 A;  4ID4 A;  4O8G A;  5U47 A;  2OAP 1;  5TBM A;  5F6A A;  3OPP A;  4E04 A;  4GHI A;  1TDG A;  2VGL S;  4OOY A;  1W7F A;  1QME A;  3S7P A;  2ZBB A;  3HVF A;  5DTS A;  1MKM A;  3ICY A;  4NET A;  4JGP A;  4E3I A;  2Y4A A;  2K31 A;  4HEF A;  3HLB A;  1P0Z A;  3FG8 A;  4S2M A;  2XD5 A;  2A24 A;  3I7J A;  4BL3 A;  3B3X A;  4KUO A;  1O7E A;  1MZU A;  2KOI A;  2ZC3 B;  2X01 A;  4MCW A;  3FKV A;  1XPB A;  3F1P B;  2Q9N A;  3A3F A;  4N1H A;  5E43 A;  1ZG4 A;  3DWK A;  3H82 B;  2B5R A;  4WEJ A;  2KLI A;  4EU0 A;  3CZD A;  3QP2 A;  5KZH A;  3BWL A;  4P0M A;  3UPO A;  3F1O A;  4JXV A;  1JNU A;  2L0W A;  1W79 A;  2DNS A;  1G28 A;  3LGO A;  2LB5 A;  3VP3 A;  1YLW A;  4OKP A;  1PI5 A;  4OPQ A;  2QYB A;  4JGQ A;  2ZJ9 A;  1XGJ A;  5HD5 A;  2IA2 A;  3A0S A;  2IWB A;  1K6R A;  5FEF A;  3BEC A;  4B93 A;  1OJ5 A;  1N9L A;  2RL3 A;  3JVV A;  3HL9 A;  4U0X A;  2JE5 A;  3IX3 A;  3HUN A;  1SHV A;  2FZ0 A;  3HLW A;  4S2N A;  4UA6 A;  1TD5 A;  5GL9 A;  1N9N A;  4XT2 A;  2QHK A;  4PM7 A;  5DFX A;  3AGE A;  3IS2 B;  5L8M A;  2HPB A;  3LFV A;  2XQZ A;  1KGG A;  2UWX A;  2PR6 A;  3MQO A;  4MN5 A;  3CMZ A;  4HHD A;  3DTE A;  1WYC A;  1E4D A;  4Q0J A;  4WEL A;  2QJ5 A;  2W1R A;  3WS5 A;  5EOO A;  3HBR A;  1NY0 A;  5F83 A;  2XDM A;  3DTK A;  4P6Z S;  3A0R A;  3ZGA B;  4O0P A;  3TE8 A;  1XXM A;  3KSF A;  3LIC A;  1DP6 A;  4S2I A;  3IBJ A;  1STZ A;  3W8K A;  2P9V B;  3T4O A;  5EVI B;  4JPM A;  3IF6 C;  2HJE A;  5GLA A;  4MEZ A;  1VEU A;  3G4P A;  1G6A A;  2QKP A;  3VFF A;  5IS1 A;  2L4R A;  4UQI S;  1H8M A;  5LBR A;  1F98 A;  1TDL A;  4HOI A;  3MR0 A;  5TGF A;  1XX2 A;  3GMW A;  4D60 A;  4ARZ A;  3K3D A;  1P9W A;  3G31 A;  2ZQ7 A;  5HWT A;  4U3T A;  5EVE A;  3ZHH A;  4R1G A;  1NYM A;  3R7W B;  1NLZ A;  1HLU P;  2WGW B;  2VV7 A;  4PPR A;  2EXA A;  5DF9 A;  2H0Y A;  5GHX A;  4U0T A;  2V1B A;  1PW8 A;  4EEP A;  1PFL A;  1XJ2 A;  1LT0 A;  3UPN A;  4E3L A;  4DJ2 A;  2VK3 A;  3H7W B;  4C6Y A;  5TJJ A;  1NYY A;  5G4Z A;  2Z6C A;  3WWX A;  4ZTK A;  2VV8 A;  3LUQ A;  5JYO A;  3L9K A;  3CUE A;  4UAA A;  3HUM A;  3PAG A;  1YM1 A;  3O87 A;  3D72 A;  1YLP A;  2J80 A;  4PM5 A;  3EWK A;  2DCF A;  3SH8 A;  5HAP A;  4Y17 A;  4GHI B;  1CI8 A;  3MS6 A;  4MBH A;  2ZQC A;  2EXB A;  2VA0 A;  2V1A A;  2V8C A;  5F69 A;  3WS2 A;  3AGD A;  1GHP A;  3HCY A;  3Q07 A;  4LRX C;  4KZ9 A;  4DN0 A;  1QMF A;  4LV3 A;  3LR5 A;  3T4Q A;  1MWT A;  4HJ3 A;  2PR5 A;  2ZL1 A;  3WRZ A;  3IH8 A;  3QHY A;  1MC0 A;  3B33 A;  1ERO A;  3TJZ C;  4HY8 A;  3MZE A;  4IHQ A;  4E3K A;  2DRW A;  4LV2 A;  3HLG A;  5FAS A;  1D7E A;  4XT2 B;  3UE6 A;  3HJI A;  1PWG A;  2OLV A;  3W2Z A;  1NLY A;  3K3C A;  4EQ1 A;  3A0V A;  4Y0T A;  4HP4 A;  5M18 A;  3KSH A;  1KDS A;  1KOU A;  4DXC A;  1V9Z A;  5KMW A;  4NG2 A;  5AVF A;  2Y2L A;  2WKP A;  1YLT A;  2L1M A;  1T19 A;  2BLS A;  4KQD A;  4R4S A;  4NXF A;  1JTG A;  3IWQ A;  1P97 A;  1XA7 A;  1OME A;  1DJA A;  1Q2P A;  2V20 A;  3HLC A;  2Y8H A;  4DXB A;  5DKK A;  1XA1 A;  4GD6 A;  4JF6 A;  1TS0 A;  1KE0 A;  2QZ6 A;  4OQ0 A;  3ZDJ A;  2WK0 A;  3G32 A;  2DMW A;  4F3L A;  4F94 A;  4N9L A;  5HDS A;  3UB6 A;  2XSS A;  1IYO A;  2OWJ A;  4Y13 A;  4ZDX A;  3ITB A;  2V2F F;  2EFU A;  5CTN A;  2VX8 A;  2XK1 A;  1ERQ A;  4N1X A;  2PHY A;  4I38 A;  2D02 A;  3OLO A;  5EM1 A;  1JTD A;  3E0Y A;  3ZG8 B;  2Y2Q A;  1LLB A;  3L7H A;  1KVL A;  4BL2 A;  3BRM A;  3MXR A;  4R38 A;  4K91 A;  4ZAM A;  5EVI C;  3NC8 A;  4S2J A;  3MQQ A;  1CEF A;  2WKQ A;  1VHM A;  1GA0 A;  4ZJ1 A;  4PM8 A;  3VSL A;  1MWS A;  4DJ3 A;  4E6W A;  3ZVT A;  3Q1F A;  1YSQ A;  2QMI A;  1ZTU A;  4BD0 A;  2O9A A;  2G7U A;  1MKI A;  4E3N A;  2VGK A;  3SS4 A;  5C5K A;  3PAE A;  1YSP A;  5HDD A;  2H0T A;  3C7U A;  1ZKJ A;  3LR0 A;  3FPW A;  4PAU A;  2Z2M B;  3GEC A;  3RFB A;  3MMH A;  4DRT A;  2B18 A;  3B42 A;  4K08 A;  4ZRR A;  1E3U D;  1KE3 A;  3V5M A;  2W3F A;  3C5A A;  5FQQ A;  1LL5 A;  4BJP A;  3IHB A;  3NOT C;  2WAD A;  1OT9 A;  3CIT A;  5FQI A;  4LLO B;  4DDY A;  2HF6 A;  1KGF A;  2PD8 A;  1MWR A;  4DMZ A;  4H8R A;  3UB5 P;  2W0N A;  3NOU C;  1FCM A;  3ULF A;  5M19 A;  5E2G A;  2Q0O A;  3IQA A;  4PM9 A;  3C30 A;  2WGW A;  3VP2 A;  2NUP C;  3E4O A;  5IT5 A;  3ZYT A;  4S2L A;  2BAS A;  3NBL A;  5IU1 A;  1H3Q A;  3OCL A;  3UME A;  3BY9 A;  2J3W A;  1ZC2 A;  1OT6 A;  3HLD A;  4I3A A;  3FZC A;  4EUV A;  3DWZ A;  3NIA A;  5J8X A;  2EFX A;  3C4P A;  3QNB A;  4FOF A;  4JLF A;  2WZX A;  3GVB A;  1T18 A;  2X71 A;  1S4S A;  3Q7V A;  4LV1 A;  2OOL A;  3CWF A;  4EQI A;  4B88 A;  4WM9 A;  5E2F A;  4RQ9 A;  4I39 A;  2Y2I A;  1K0K A;  5CEB A;  1I2S A;  4MN7 A;  2J3T C;  3KYQ A;  2HP6 A;  3UO9 A;  2YKF A;  3HLF A;  2HZ5 A;  4BWI A;  2ZQA A;  2IWD A;  3NDE A;  2RCX A;  1CK3 A;  1TS8 A;  5FA7 A;  1ACF A;  4OLG A;  4CQH A;  3BYD A;  3BJN A;  4BBT A;  5EPH A;  2PRF A;  4II7 A;  1W8Y A;  5K5B A;  3LY3 A;  2EX9 A;  4O01 A;  4OQG A;  3E2L A;  5EEC A;  1W5D A;  3T50 A;  4EER A;  4H6J A;  4OOM A;  5HW3 A;  4Q0I A;  4EEU A;  3MZF A;  1FR6 A;  3KYZ A;  3LIF A;  4X53 A;  2Y59 A;  4MN6 A;  2EX6 A;  3VOL A;  5A91 A;  5KIZ A;  4R0Q A;  2M7V A;  2ZOI A;  2XF3 A;  1NRF A;  1BLP A;  2Y2P A;  3EEH A;  3LID A;  4BBU A;  1OTI A;  2ZM8 A;  4WZ4 A;  2HV1 A;  3T1Q B;  4GZB A;  5DJU A;  3N6I A;  4P85 A;  1AXB A;  5CHJ A;  4KG6 A;  1BSG A;  3BM6 A;  2WAE A;  5HL6 A;  1BLH A;  1PNE A;  4R3A A;  2P9V A;  2ZQ9 A;  4EW7 A;  3FPV A;  1J3W A;  5CTM A;  4PKY A;  4BLM A;  5AQA A;  4JXW A;  4ETX A;  2ZC4 B;  3LI8 A;  1ONH A;  3TRC A;  1EI5 A;  1EWZ A;  2Q9M A;  4WBG A;  3RJU A;  1FOF A;  3VP4 A;  1OPX A;  4QD4 A;  3WS1 A;  4LEN A;  5CRF A;  3VV4 A;  2INW A;  3BLM A;  5TFQ A;  4Q0H A;  2WGI A;  4FUW A;  4QWO A;  3GQZ A;  3P01 A;  5FI2 A;  3E98 A;  1VQQ A;  4P6Z M;  2ZM2 A;  5DVA A;  1G6O A;  1K55 C;  3IF6 A;  5EV0 A;  2XH9 A;  2C5W B;  2WUQ A;  4K0X A;  3H7W A;  1BLC A;  4HJ4 A;  2Y55 A;  4JBF A;  3HJK A;  5HAI A;  4X1M A;  2Y2J A;  3PBN A;  4MBF A;  5L07 A;  3S1Y A;  1G68 A;  1LHY A;  5MC7 A;  3PR6 A;  2J8Y A;  1JWZ A;  1OJG A;  4KEN B;  3JVU A;  1XP4 A;  2X02 A;  4QU3 A;  2XEP A;  2ZOH A;  3M6B A;  2H28 A;  3IS2 A;  3SS3 A;  2G2W A;  3NCK A;  3N8S A;  2WKI A;  5AQB A;  3CG5 A;  1ZG6 A;  3TG9 A;  3WRT A;  2W27 A;  3OPR A;  4LPZ A;  4JKT A;  3H82 A;  3G2Z A;  5CHU A;  1N9O A;  5CGS A;  3IBR A;  2AVX A;  4X56 A;  2ZL1 B;  4GOG A;  4NXE A;  1L0D A;  4GS9 A;  3MBZ A;  5FQM A;  2I72 A;  4ZJ2 A;  4JF5 A;  5CED A;  5FAT A;  5HWV A;  1SDE A;  2EWV A;  3DTI A;  4PHT A;  1NJ4 A;  5FL3 A;  3IT9 A;  2J3T D;  2HP9 A;  1RGY A;  4XUX A;  5F1F A;  3FWL A;  4WEK A;  4CLC E;  2JKR M;  3CPT B;  5EM0 A;  3A3E A;  3GSG A;  5FAO A;  1D06 A;  1ERM A;  1F5M A;  2C6W B;  5L09 A;  5DFY A;  4E3J A;  3PBO A;  1M40 A;  1W8Q A;  1K6S A;  2PT7 A;  3EQV A;  3CLO A;  4KZ5 A;  1DRM A;  2E8J A;  5HWW A;  4X25 A;  1AWI A;  3QP5 A;  3H9W A;  1CQA A;  2WKE A;  4O7D A;  1HTZ A;  4C3Q A;  3W4O A;  4KG5 A;  4EBN A;  1D1J A;  1TS6 A;  2Y2N A;  2BTF P;  3T4K A;  2O9C A;  3NOP C;  4F3L B;  3G35 A;  4RX2 A;  5CGX A;  5EE8 A;  2P04 A;  4KZ7 A;  1J9M A;  4FCF A;  2VZW A;  1H5X A;  3MJQ A;  2EX2 A;  3LEZ A;  3MKE A;  3C38 A;  2E8I A;  2OWH A;  4S2K A;  4YNR A;  4Y5F A;  4LRZ E;  4OPY A;  1OTB A;  4OVD A;  3O3V A; 
#chains in the Genus database with same CATH homology
 1VEU A;  1A0K A;  3D9Y A;  1FIK A;  2ACG A;  4X25 A;  3CPT B;  1AWI A;  1PNE A;  4FTX A;  5EM0 A;  4X1M A;  1K0K A;  1CF0 A;  2PAV P;  3L9K A;  1Z09 A;  1VET B;  1Y4O A;  2PRF A;  2V8C A;  3NUL A;  1CQA A;  5FEG A;  2JKF A;  5FEF A;  1G5U A;  1SZV A;  2B95 A;  3NEC A;  3T1R A;  3T1X A;  1YPR A;  3DAV A;  1SKO B;  1ACF A;  1J3W A;  2PBD P;  3T12 B;  2JKG A;  2HZ5 A;  5EM1 A;  4D60 A;  1PFL A;  5EV0 A;  1D1J A;  4ESP A;  1VET A;  3CPT A;  3T1S A;  3U4L P;  1SKO A;  1CJF A;  3L7H A;  1PRQ A;  1FIL A;  3LGO A;  3MSH A;  1F2K A;  2V8F A;  2VK3 A;  2ZL1 A;  3CHW P;  3LEQ A;  5EVE A;  5FDS A;  3T1Q B;  3UB5 P;  4FUW A;  4QWO A;  1VEU B;  2BTF P;  2ZL1 B;  3KYE A;  1HLU P;  2E8J A;  3MS6 A;  4X1L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...