2E8JA

Solution structure of dynein light chain 2a
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
96
structure length
96
Chain Sequence
MAEVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDIDPQNDLTFLRIRSKKNEIMVAPDKDYFLIVIQNPTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Dynein light chain 2A, cytoplasmic
publication title Solution structure of dynein light chain 2A
rcsb
source organism Homo sapiens
total genus 17
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03259 Robl_LC7 Roadblock/LC7 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 2e8jA00
4QWOA 1FILA 2ZL1B 3LEQA 5EM0A 3MS6A 3T1XA 1FIKA 2VK3A 3MSHA 2V8FA 2HZ5A 3T1RA 1Y4OA 4ESPA 3CPTB 3NECA 3T1SA 5EM1A 5EV0A 3T12B 1Z09A 1PNEA 1ACFA 1A0KA 2PRFA 3T1QB 1PRQA 1SZVA 1VETA 1VEUA 1F2KA 2JKGA 2ACGA 1SKOA 2B95A 2ZL1A 1D1JA 2BTFP 3NULA 2V8CA 3U4LP 4X1LA 1YPRA 4X25A 4FTXA 5FDSA 1AWIA 1VETB 1VEUB 3L7HA 4FUWA 3D9YA 1G5UA 4D60A 1CF0A 1PFLA 1SKOB 3UB5P 1CJFA 1CQAA 4X1MA 1K0KA 5FEFA 5EVEA 2PBDP 3KYEA 2E8JA 5FEGA 3DAVA 1HLUP 2JKFA 3CHWP 3LGOA 1J3WA 3L9KA 2PAVP 3CPTA
chains in the Genus database with same CATH superfamily
3FKVA 1LT0A 2L1MA 5FAQA 4F3LB 5F1GA 3IXDA 3MQQA 4BENA 2WGIA 4X55A 2HP6A 4PKYG 1W79A 2PDRA 3PBSA 3Q07A 1XJ2A 3WRTA 2I9VA 4MEZA 2Y8HA 1Y28A 3CWFA 3F1NB 4OLDA 5FSRA 5EE8A 5CX7A 1FCMA 2J9PA 4DKIA 1JVJA 2D02A 3T4QA 1PNEA 4JLFA 2C6WB 1H0MA 3ZQ5A 1NYYA 5LBRA 4N1HA 1L2SA 4NKPA 2XK1A 4PMAA 2ZM2A 3HUNA 4GOGA 1F2KA 4S2IA 1BUEA 1FR6A 3BY9A 5HPIA 1LI0A 1XJ4A 3S7NA 4K0WA 1NRFA 4GKUA 2V9AA 2VV8A 2NUPC 2B5RA 4LGWA 3N8SA 2QKPA 1E3UA 3C38A 3P09A 3EEHA 5J8XA 5EVIC 4NXFA 1MZUA 4S2OA 1XJ3A 2W0NA 2W1RA 1YLWA 4MCWA 3W4OA 4DXBA 1OTDA 2M1CA 2J3WA 4MBFA 3UMDA 1TDLA 1G6OA 3F1PA 3HLDA 1N9NA 5AQ7A 1GSVA 1DJAA 4MBKA 3LUQA 2X71A 1TS6A 2OSUA 1PWDA 3KSIA 5HARA 3G4PA 2E8IA 3LEQA 1LSWA 4P6BA 4KZBA 4L9EA 4LV0A 3UN7A 1KDWA 4JXGA 4EV4A 2Y2QA 3VFFA 4LCMA 1M40A 2K2NA 4GZBA 1KE3A 4OPQA 3HVFA 1VQQA 1L0FA 4G3KA 1J9MA 2Y2GA 3LYXA 3S4XA 3UB9A 4OP5A 1KVMA 1PZOA 3LR3A 3JYIA 4KG5A 3GVBA 1YSPA 4BJPA 1PI5A 2EWWA 4P6ZM 1JWPA 1GCEA 2R78A 5CHJA 3VP3A 3T4OA 3LO7A 5KMWA 3TRCA 3EWKA 4HIAA 1H5XA 4WM9A 4HNBA 2INWA 3IWIA 1N9BA 1ZTUA 2XA7M 4WMCA 5E2HA 1O7EA 2HDQA 4X1LA 1CI9A 5HD3A 2O9AA 4XT2A 4X25A 5L2FA 4O0PA 3BM6A 5F1FA 3L7HA 4OP8A 2PT7A 1TF1A 1K56D 1G5UA 1CF0A 2EX8A 2JKTM 1BYWA 3BFCA 2XDMA 3HUMA 3LFVA 3OPPA 3T4LA 3BFGA 4XT2B 1T1BA 1LL9A 1HLUP 3NOTC 4KQRA 3QP2A 3TJZC 1KGGA 3VP0A 1OT9A 2J3TD 3B3XA 2VV7A 1K38A 4Y2FA 4I5SA 2HZ5A 4E6XA 4P87A 1P0ZA 2PYPA 4HP9A 4UEYA 3G6OA 3B33A 3G2ZA 2O9BA 1OJGA 4QJGA 1MWTA 3UE6A 3LIDA 5DJTA 5J7EA 1NLZA 5DTTA 1SZVA 4NXEA 5HD5A 3T50A 1QMFA 1VEUA 1WA9A 5CGWA 4EWFA 4O8GA 2IWCA 2R9XA 2V8CA 2WZXA 4S2MA 1L0EA 3WS0A 3V3RA 5HW3A 3EQUA 3LEZA 4X68A 4WUJA 3A3DA 1VEUB 2VLGA 3H9WA 2HP9A 2Q0OA 5AQBA 2JKRM 4LPZA 2K31A 4S2KA 4BBVA 4E3NA 2HV1A 3BWLA 3UB5P 4ZJ3A 3NOPC 3ZDJA 4KG6A 1EWZA 5HFOA 2KDKA 2V2FF 2JHEA 4P85A 4A5RA 1YSQA 3CLOA 4EEUA 1BTLA 3I7JA 4QWOA 1E25A 4WZ5C 3MFDA 3ZFZA 4R4SA 1HZOA 4CLCE 2VV6A 3GMWA 2V1BA 3RXWA 1RGYA 1K54C 2K7SA 3A3IA 5HZHA 1MY8A 4X53A 3UNWA 4Y0UA 3HBRA 5HL1A 3IF6A 5TJJA 5HPFA 3RFBA 3ZGAB 2B02A 4UA7A 3TE8A 3A0RA 3MXQA 3PBNA 1LI9A 2OV5A 1PRQA 3VOLA 4HJ6A 4CLCB 1HD8A 5GLDA 1XA7A 3WS1A 4EU0A 2EX2A 1S4SA 5HAPA 1D1JA 2VJWA 3IF5A 2P04A 1NJ4A 2W1TA 5F6AA 5KIZA 3NDEA 3IS2A 4QY5A 3OPHA 1YPRA 4S2NC 3KX0X 4DMZA 3BLMA 2QWSA 1ALQA 4B4XA 4KQQA 3IXBA 4H8RA 4LFUA 2PD7A 4E3OA 4YOFA 5A90A 4OPZA 4Y17A 1LSXA 4I3JA 2W1TB 3IS2B 4H6JA 4EW7A 3IWQA 3SH7A 3Q82A 4EBNA 2BASA 2CMNA 2HP5A 4MDZA 3FZCA 3VFHA 1XP4A 3LIFA 4UAAA 3EGXC 2Y2JA 2Y2LA 3ITBA 2EWVA 5EOEA 3BFFA 4BL3A 2W3EA 5EOOA 3CZDA 3KO6A 4XXRA 5EVIA 4LV3A 3S7QA 4FD8A 2QJ7A 4HY8A 4NG2A 4U3TA 2ZM0A 3BQAA 4CQHA 2QJ5A 3K3CA 1EW0A 3ZCZA 3SOIA 1OT6A 3K2NA 4GHIA 1NXYA 2M7UA 1XKZA 4N9LA 5EVIB 3SS3A 2FZ0A 4NXGA 2Y2HA 1S1YA 1H3QA 2QPNA 3G32A 2Y59A 3T4JA 4IVIA 1XGIA 1L0GA 5KSCA 3U4LP 1BSGA 3T4TA 3ZG5A 1P97A 3MR0A 3O3VA 1NLYA 4OQ0A 1TVFA 1W7FA 2HGVA 2EA9A 1IYPA 3N8LA 4KZ7A 4S2PA 5DFXA 3R4KA 1ZG4A 4LRZE 4X69A 1JWZA 1S6RA 4GS9B 3OPRA 3D9YA 1OTAA 3LR5A 4KQOA 4Y5FA 4JGOA 1PI4A 4OOYA 4HJ4A 4DDSA 2HF6A 1S4RA 1CQAA 1Q2PA 5F69A 1UGUA 3C2WA 4BLMA 5C5KA 5EUAA 4E3IA 3AGEA 5BOHA 3RJUA 1UWPX 2WKHA 1LLBA 3LGOA 2LB5A 5DF8A 1ES3A 4RA7A 3PBOA 2XF3A 2YKFA 1TS8A 4L0LA 1NZUA 4MLLA 3D72A 4BBUA 4ZDXA 4U0XA 1JNUA 4L9FA 1E3UD 3V50A 1OPXA 4KZ9A 4DE2A 3ZG9B 1IELA 3MJQA 1FSYA 1IYQA 3SW1A 2V20A 2VKSA 2JKRI 3ZG0A 2ZM8A 3HLCA 2ZOIA 1FR1A 5EV0A 2P74A 1Z09A 4OQGA 4LV1A 4EUVA 1SDEA 3WRZA 5TR7A 1BLCA 2WZZA 1YMXA 1HVBA 2WGVA 4C6YA 5KSHA 4LCLA 4YFMA 2OAQ1 2GZAA 1V9ZA 5HWTA 2R9WA 3FPVA 4XUXA 2ZL1A 4KZ3A 2QHKA 2V0WA 2ZMFA 3HUOA 1PWCA 2UV0E 4UA9A 1NY0A 5CHMA 2WKRA 3BJNA 2EXAA 4FUWA 3UDFA 3BFDA 4I3IA 5M18A 4K91A 3NJAA 3FPWA 1MPLA 2W3GA 3BECA 5TBMA 3PTEA 3LI8A 2DRWA 2ZC6B 5E2EA 4ZJ2A 3S7OA 3CHWP 2Y2OA 3S7PA 3CPTA 1MXOA 3IQAA 3Q7ZA 4PM7A 3UMEA 4IBXA 1IYOA 3MS6A 5TBMB 3NBLA 2XFSA 3BFEA 1XFQA 4JPMA 3PBTA 1K57C 3V67A 1DP6A 1M6KA 2XGNA 3B47A 4Q8IA 4R3BA 3CPTB 3O87A 4IUKA 1ONHA 3HJIA 3ZG8B 2Y2IA 3H82A 4WL9A 1F98A 3V5MA 3F1OA 3ZNYA 3ITAA 3VP1A 2EFXA 2KX6A 5CERA 4ZTKA 3F1PB 3IX8A 2P9VA 4NEED 3S22A 2WYXA 3C7UA 3MKEA 1CK3A 4BBTA 1D7EA 4KZAA 4OONA 2BLSA 1XA1A 3AGFA 1KE0A 2X01A 2BTFP 3C4PA 3F1OB 4WZ5A 2V1ZA 4DE3A 4HP4A 2H0YA 4NXBA 2P9VB 1E4DA 3JVUA 3T4SA 5AJGA 3EGDC 1YLJA 5JYPA 5DF9A 1DP9A 1ZHHB 2G2UA 1K54A 1WYCA 2ZC7A 3C8CA 4EQIA 1GHPA 1T18A 2JE5A 3VSLA 5CGSA 1WE4A 5TFQA 2WKIA 4DRTA 4O7DA 1JTDA 3PAEA 2OLVA 4KQDA 1VB6A 5EVEA 1BULA 3FG8A 3KYZA 1CI8A 2GNXA 3CI6A 1Y54A 4MN7A 3N7WA 4PPRA 5GLAA 3CUEC 3LCEA 1YQSA 3UB8A 2OLUA 4RX2A 1W8YA 3ZVWA 3IX4A 4CJNA 3QNCA 2PD8A 1I2SA 3W2ZA 5EFWA 2C5WB 1I2WA 3Q7VA 4S2NA 4JXSA 1OTIA 5U47A 3E2KA 4B93A 5HDDA 4UQIM 2UWXA 1GA0A 4L9GA 3T1SA 1H8YA 3GQZA 3DBAA 3P7NA 1YAXA 5L09A 1KGEA 5CHUA 5FAOA 3BQ8A 4KZ5A 3ICYA 2XRNA 3G30A 1SKFA 3Q7VB 2GX5A 2JKGA 3DTKA 5AVFA 4IJGA 5DF7A 5CEDA 4N1XA 2HJEA 3P01A 1STZA 4LLOB 3UPPA 4KUOA 4ZJ1A 5HWWA 3IWOA 1ERMA 2VGKA 5AVEA 1HTZA 1U60A 4UHUA 3NDGA 4O01A 4X56A 2P08A 3CG5A 2W3DA 3A3JA 3LY3A 5FQMA 2VGJA 4OOLA 2V0UA 3T4KA 4BWIA 4CLCD 4N9KA 2PR6A 5IT5A 2Z6CA 3MQOA 5FEFA 4LRXC 3P98A 2HDUA 3L9KA 3LICA 4R4RA 4GN2A 1W8QA 2EFUA 3JPUA 3BW6A 4N92A 5CGXA 1O07A 4HH3A 1IOUA 2ZMVA 3MZFA 2G7UA 3FYZA 4Q0JA 1WYBA 1XFNA 3BEBA 5FATA 1DJBA 3UPOA 1KE4A 2GJ3A 5L07A 4DJ3A 4PAUA 3DWZA 5E43A 4RX3A 4EEPA 4QD4A 3MF0A 5GLCA 2EX9A 5KZHA 2DCFA 3HLEA 3EQVA 3V3SA 2PU2A 1XGJA 3PXPA 3GSGA 4P0MA 2B18A 4UA6A 3CJMA 5A93A 3C30A 4BD0A 5HX9A 3SH8A 3NY4A 1DJCA 3PHYA 1FOFA 3OZHA 5DKKA 4YNRA 4NETA 2XROA 1LHYA 2IWBA 1Q2QA 1S1ZA 2MJ6A 5FDSA 3VOYA 1G28A 1AWIA 1BLHA 5F68A 1K55C 2BG1A 1FCNA 5EVID 4RQ9A 1K6RA 2VA0A 5F83A 3IXGA 4EQ1A 4PKYA 3B42A 3IF6B 3IH8A 4X1MA 3ULFA 3N4IA 5DJUA 3KYEA 3RXXA 4M4XA 3DAVA 5MC7A 3HLWA 2A3UA 4YWZA 3MMHA 1NYMA 4MMNA 1KGFA 5FI6A 3QHYA 5EM0A 1TS0A 4YINA 1TD5A 1PWGA 2EXBA 2XFTA 4KZ4A 4FOFA 3EEAA 4FSFA 4BL2A 2RCXA 4JGRA 4B88A 1ZKJA 4WN5A 5DVAA 4JGPA 4IBRA 1VHMA 1PZPA 2ZQDA 4EXOA 2L0WA 3DW0A 4OPRA 3E2LA 2ZQCA 3QP6A 5L10A 5TGFA 5IHVA 2DNSA 2I72A 3TW8A 4H6JB 4WELA 1NZOA 4HHDA 4WBGA 2H5SA 5FL3A 1BLPA 2QZ6A 1IKGA 3VOZA 3DTMA 5HAIA 3A3EA 4MN5A 4QU3A 1KVLA 1SCWA 1K4FA 1PIOA 1K57A 3NOUC 4E3LA 1K25A 3H7WA 3OBFA 4GB7A 4RVAA 1PFLA 4P6ZS 2ZQ9A 2PBYA 2ZQ8A 3CITA 4E04A 4E3JA 4EUZA 4GHIB 3VMAA 1ES4A 2VZWA 1OTBA 5FEGA 1G6AA 2XA7S 2J3TC 1XX2A 5G4ZA 3UE1A 1OTEA 1GHIA 1ESUA 4E6WA 3N8RA 2Q9MA 3IT9A 1H8ZA 4IVKA 3K3DA 5E2FA 1V9YA 2M7VA 3PBQA 3OPLA 1CEGA 4GD6A 2VK3A 3QP5A 4IHQA 3VE4A 3QP4A 1DY6A 3ZG7B 1IYSA 1Y4OA 3HREA 5DTSA 4OH0A 5I94A 1T1CA 5CTNA 3NC8A 5HWVA 3T12B 3G31A 1FSWA 1PW8A 4FH2A 4R38A 1S67L 4R1GA 4JGQA 4CLCC 2PR5A 4WEKA 2Y2NA 5FI7A 3BLSA 3KYQA 1YT4A 4GW9A 3CUEA 2ZJ9A 2X02A 2ZD8A 4DF6A 4Q0HA 1MKIA 5IU1A 4IUHA 2JN7A 4GCZA 3G35A 4ZAMA 3M6HA 4OQIA 4PM8A 3F1NA 4KZ8A 5JYOA 1YLPA 4EETB 3UE0A 1KOUA 3D3OA 1K6SA 4ETXA 1MC0A 4HEFA 3IBRA 1GSWA 3QP8A 2PAVP 3KSGA 4QB8A 3U2AA 4GDBA 4JF5A 3GDIA 2ZL1B 3W4PA 3PYPA 1IFQA 3GRJA 3MXRA 5HSQA 5HDSA 4OVDA 5D3OA 4JXWA 1ONGA 4GLQA 1XJ6A 5FDHA 3WS4A 2P7JA 1Z6FA 3G2YA 3FWLA 4B9OA 4IEDA 4Z1WA 2D01A 1PYYA 5GHXA 3UPNA 4RYEA 1DRMA 3A3FA 1ACFA 1D06A 4II7A 2XQZA 3PAGA 3O86A 4WMCD 4ME4A 1BT5A 3FV7A 1ODVA 4ZBEA 2O9CA 4JXVA 4BMWA 4BQMA 3C4OA 3N6IA 3ZHHA 3NULA 3OLOA 2H10A 3EOIA 3UO9A 5FQJA 2Y2MA 5FI2A 2JBFA 2WAEA 4Y15A 3UDIA 4OKPA 4HH2A 1S66L 2G2WA 4HBTA 3NIAA 4I39A 1YLTA 4MN6A 2J8YA 5FQ9A 4Y3IA 1TDGA 3H82B 1IKIA 4GJ4A 5GLBA 3UY6A 2HJ9C 4EESA 3ISGA 4HI4A 3ZVTA 1TS7A 3A0VA 2VGLS 3C5AA 4DXCA 2Y2PA 2DMWA 2A24A 2FFFB 5M19A 2FFYA 4R70A 2A49A 3ZYTA 5J3WA 3TG9A 1ERQA 5EVLA 2JC7A 1IEMA 4F94A 2W3HA 4JBFA 2XH9A 2IWDA 2J9OA 1LL8A 2J7VA 2ZC5B 2WKPA 1H8MA 4ESPA 1SHVA 3V39A 3VE3A 2A24B 1K55A 4KG2A 1N4OA 5FAPA 4OOMA 1QMEA 3HLGA 4WEJA 1T19A 5EM1A 3DTEA 3IX3A 4R0QA 3WS5A 4FCFA 3Q81A 2QMIA 3DTIA 1JTGA 3VP4A 2LB9A 2PRFA 4HJ3A 3S1YA 3R7WA 4ID4A 3MZEA 4KZ6A 4WLAA 5G4YA 2PU4A 5CEBA 4WZ4A 2OAP1 1C3BA 2AVXA 1N9OA 5GHZA 2B95A 4M3KA 3IXHA 1P9WA 3W4QA 4DJ2A 4Y13A 1MWUA 4Q0IA 2KOIA 1RGZA 3UE3A 4X6TA 3LIEA 3MFXA 2XD1A 2W27A 3LR4A 4FTXA 3R7WB 3IHBA 4GD8A 2ZBBA 3HLBA 2J80A 4D2OA 3IHAA 3FKWA 3GV9A 3WWXA 3QP1A 5IS1A 3M2JA 1YKDA 4Y0TA 1CJFA 1GHMA 5FQIA 1RP5A 1GA9A 4ZRRA 4G3WA 3KSHA 1BZAA 4EERA 1K4EA 1ES5A 4QPRA 4R23A 2Z6DA 3D4FA 4CPKA 1AXBA 4AFIA 3E4QA 2H28A 4Z9QA 3KSFA 5M1AA 4DDYA 1FIKA 1I5QA 2V8FA 2O99A 3WS2A 1K56A 3G34A 5EPHA 3HL9A 5FASA 3OCNA 3NECA 5G18A 2RL3A 1FQGA 3Q1FA 2Z2MB 1L3LA 3IBJA 2QYBA 3MQ0A 1LSVA 1ESIA 4DN0A 2Y79A 2Y91A 2ZMAA 3SZTA 1YMSA 3T1QB 3A0SA 3AGDA 3JVVA 4K0XA 3GTCA 5FA7A 1VETA 3C7VA 1MKMA 3OCLA 5K5BA 2ACGA 2CC1A 4HOIA 1SKOA 1XPBA 3OC2A 3E4PA 3UB7A 1EROA 5GHYA 2HDRA 5CRFA 4ARZA 5CXWA 1VETB 3LIBA 3E98A 5A92A 3SS5A 1T1AA 1G68A 5AQ9A 2KLIA 4QHCA 2WAFA 3E4OA 2XR0A 4D60A 1SKOB 1MWSA 2IA2A 5F5YA 4R3JA 4PM6A 5A8BA 3VV4A 5CECA 5DKLA 4OQHA 1TEMA 3LR0A 2VX8A 5I5LA 2O0YA 4ARZB 3O88A 4CLCA 3E0YA 1J3WA 1W63M 1YLYA 3CMZA 4S2LA 1ZC2A 5F82A 2XD5A 5DFYA 2Y55A 4HESA 1FILA 4Y0OA 1S0WA 3SH9A 4B4ZA 5GL9A 3HCYA 3T1XA 2PYRA 1NWZA 5J4EA 5HDCA 1YM1A 5EECA 3BY8A 1SDNA 3LI9A 2VGLM 2WGWA 3VP2A 2Y4AA 4BD1A 1CEFA 2OOLA 3DWKA 3MXSA 2HPBA 3FC7A 3BYDA 1A0KA 4WF0A 2FH5A 4GNUA 4DE1A 3BRMA 1OJ5A 4KENB 3LY4A 2ZC3B 2ZLYA 5CTMA 4JKTA 2H0TA 2WGWB 4Y7PA 1VM1A 3HLFA 2WKQA 3PBRA 5FQQA 4MBHA 4XUZA 2OWJA 4K08A 1FCOA 4U0TA 4I38A 1YLZA 1NRJA 1GSXA 4KUKA 4EBPA 1DP8A 2XSSA 4S2JA 4PM9A 2GDNA 5HL6A 4PM5A 3PR6A 3O5YA 3M6BA 3TOIA 1ES2A 1X0OA 5HAQA 2PBDP 4NK3A 4HBUA 2VEAA 2XEPA 2JKFA 4C3QA 4JF4A 1MWRA 1PW1A 1L0DA 1EI5A 2JKTI 3IH9A 2WADA 3LIAA 3MKFA 5AQAA 4R3AA 1F5MA 4GDNA 2A2LA 3MZDA 3QNBA 4FH4A 2Z2LB 3UDXA 2JCHA 3MSHA 2PHYA 3NCKA 5DTKA 4I3AA 4WYYA 1RCJA 3T1RA 4GS9A 4E3MA 3H7WB 1JWVA 4C75A 3RTYA 4ETZA 4LV2A 4G3VA 1P9RA 4LENA 1MBLA 2ZC4B 1ZG6A 1OMEA 4OPYA 4E3KA 4DE0A 4HQAA 3ZNTA 5FQKA 3NHQA 4OLGA 3GECA 4PHTA 4R6LA 1KDSA 2WK0A 2YKHA 3GR2A 4QY6A 1LL5A 2ZOHA 1UWNX 1F9IA 3TSGA 2Q9NA 4MNRA 3SS4A 3NI9A 2ZQ7A 2EX6A 3CAXA 3RH8B 4UQIS 1W5DA 4JF6A 5A91A 1BLSA 2NUTC 1N9LA 3M2KA 2OWHA 3W8KA 3IF6C 5E2GA 3OOVA 2HDSA 2WUQA 2W3FA 1XXMA 2V1AA 4F3LA 2Y2KA 1K0KA 4EBLA 4LRYC 2E8JA 3MBZA 3UB6A 3VSKA 3HJKA 2ZQAA 2XLNA 5L8MA 2L4RA 2WKEA 1W63Q
chains in the Genus database with same CATH topology
4QWOA 1FILA 2ZL1B 3LEQA 5EM0A 3MS6A 3T1XA 1FIKA 2VK3A 3MSHA 2V8FA 2HZ5A 3T1RA 1Y4OA 4ESPA 3CPTB 3NECA 3T1SA 5EM1A 5EV0A 3T12B 1Z09A 1PNEA 1ACFA 1A0KA 2PRFA 3T1QB 1PRQA 1SZVA 1VETA 1VEUA 1F2KA 2JKGA 2ACGA 1SKOA 2B95A 2ZL1A 1D1JA 2BTFP 3NULA 2V8CA 3U4LP 4X1LA 1YPRA 4X25A 4FTXA 5FDSA 1AWIA 1VETB 1VEUB 3L7HA 4FUWA 3D9YA 1G5UA 4D60A 1CF0A 1PFLA 1SKOB 3UB5P 1CJFA 1CQAA 4X1MA 1K0KA 5FEFA 5EVEA 2PBDP 3KYEA 2E8JA 5FEGA 3DAVA 1HLUP 2JKFA 3CHWP 3LGOA 1J3WA 3L9KA 2PAVP 3CPTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QWO A;  1FIL A;  2ZL1 B;  3LEQ A;  5EM0 A;  3MS6 A;  3T1X A;  1FIK A;  2VK3 A;  3MSH A;  2V8F A;  2HZ5 A;  3T1R A;  1Y4O A;  4ESP A;  3CPT B;  3NEC A;  3T1S A;  5EM1 A;  5EV0 A;  3T12 B;  1Z09 A;  1PNE A;  1ACF A;  1A0K A;  2PRF A;  3T1Q B;  1PRQ A;  1SZV A;  1VET A;  1VEU A;  1F2K A;  2JKG A;  2ACG A;  1SKO A;  2B95 A;  2ZL1 A;  1D1J A;  2BTF P;  3NUL A;  2V8C A;  3U4L P;  4X1L A;  1YPR A;  4X25 A;  4FTX A;  5FDS A;  1AWI A;  1VET B;  1VEU B;  3L7H A;  4FUW A;  3D9Y A;  1G5U A;  4D60 A;  1CF0 A;  1PFL A;  1SKO B;  3UB5 P;  1CJF A;  1CQA A;  4X1M A;  1K0K A;  5FEF A;  5EVE A;  2PBD P;  3KYE A;  2E8J A;  5FEG A;  3DAV A;  1HLU P;  2JKF A;  3CHW P;  3LGO A;  1J3W A;  3L9K A;  2PAV P;  3CPT A; 
#chains in the Genus database with same CATH topology
 3FKV A;  1LT0 A;  2L1M A;  5FAQ A;  4F3L B;  5F1G A;  3IXD A;  3MQQ A;  4BEN A;  2WGI A;  4X55 A;  2HP6 A;  4PKY G;  1W79 A;  2PDR A;  3PBS A;  3Q07 A;  1XJ2 A;  3WRT A;  2I9V A;  4MEZ A;  2Y8H A;  1Y28 A;  3CWF A;  3F1N B;  4OLD A;  5FSR A;  5EE8 A;  5CX7 A;  1FCM A;  2J9P A;  4DKI A;  1JVJ A;  2D02 A;  3T4Q A;  1PNE A;  4JLF A;  2C6W B;  1H0M A;  3ZQ5 A;  1NYY A;  5LBR A;  4N1H A;  1L2S A;  4NKP A;  2XK1 A;  4PMA A;  2ZM2 A;  3HUN A;  4GOG A;  1F2K A;  4S2I A;  1BUE A;  1FR6 A;  3BY9 A;  5HPI A;  1LI0 A;  1XJ4 A;  3S7N A;  4K0W A;  1NRF A;  4GKU A;  2V9A A;  2VV8 A;  2NUP C;  2B5R A;  4LGW A;  3N8S A;  2QKP A;  1E3U A;  3C38 A;  3P09 A;  3EEH A;  5J8X A;  5EVI C;  4NXF A;  1MZU A;  4S2O A;  1XJ3 A;  2W0N A;  2W1R A;  1YLW A;  4MCW A;  3W4O A;  4DXB A;  1OTD A;  2M1C A;  2J3W A;  4MBF A;  3UMD A;  1TDL A;  1G6O A;  3F1P A;  3HLD A;  1N9N A;  5AQ7 A;  1GSV A;  1DJA A;  4MBK A;  3LUQ A;  2X71 A;  1TS6 A;  2OSU A;  1PWD A;  3KSI A;  5HAR A;  3G4P A;  2E8I A;  3LEQ A;  1LSW A;  4P6B A;  4KZB A;  4L9E A;  4LV0 A;  3UN7 A;  1KDW A;  4JXG A;  4EV4 A;  2Y2Q A;  3VFF A;  4LCM A;  1M40 A;  2K2N A;  4GZB A;  1KE3 A;  4OPQ A;  3HVF A;  1VQQ A;  1L0F A;  4G3K A;  1J9M A;  2Y2G A;  3LYX A;  3S4X A;  3UB9 A;  4OP5 A;  1KVM A;  1PZO A;  3LR3 A;  3JYI A;  4KG5 A;  3GVB A;  1YSP A;  4BJP A;  1PI5 A;  2EWW A;  4P6Z M;  1JWP A;  1GCE A;  2R78 A;  5CHJ A;  3VP3 A;  3T4O A;  3LO7 A;  5KMW A;  3TRC A;  3EWK A;  4HIA A;  1H5X A;  4WM9 A;  4HNB A;  2INW A;  3IWI A;  1N9B A;  1ZTU A;  2XA7 M;  4WMC A;  5E2H A;  1O7E A;  2HDQ A;  4X1L A;  1CI9 A;  5HD3 A;  2O9A A;  4XT2 A;  4X25 A;  5L2F A;  4O0P A;  3BM6 A;  5F1F A;  3L7H A;  4OP8 A;  2PT7 A;  1TF1 A;  1K56 D;  1G5U A;  1CF0 A;  2EX8 A;  2JKT M;  1BYW A;  3BFC A;  2XDM A;  3HUM A;  3LFV A;  3OPP A;  3T4L A;  3BFG A;  4XT2 B;  1T1B A;  1LL9 A;  1HLU P;  3NOT C;  4KQR A;  3QP2 A;  3TJZ C;  1KGG A;  3VP0 A;  1OT9 A;  2J3T D;  3B3X A;  2VV7 A;  1K38 A;  4Y2F A;  4I5S A;  2HZ5 A;  4E6X A;  4P87 A;  1P0Z A;  2PYP A;  4HP9 A;  4UEY A;  3G6O A;  3B33 A;  3G2Z A;  2O9B A;  1OJG A;  4QJG A;  1MWT A;  3UE6 A;  3LID A;  5DJT A;  5J7E A;  1NLZ A;  5DTT A;  1SZV A;  4NXE A;  5HD5 A;  3T50 A;  1QMF A;  1VEU A;  1WA9 A;  5CGW A;  4EWF A;  4O8G A;  2IWC A;  2R9X A;  2V8C A;  2WZX A;  4S2M A;  1L0E A;  3WS0 A;  3V3R A;  5HW3 A;  3EQU A;  3LEZ A;  4X68 A;  4WUJ A;  3A3D A;  1VEU B;  2VLG A;  3H9W A;  2HP9 A;  2Q0O A;  5AQB A;  2JKR M;  4LPZ A;  2K31 A;  4S2K A;  4BBV A;  4E3N A;  2HV1 A;  3BWL A;  3UB5 P;  4ZJ3 A;  3NOP C;  3ZDJ A;  4KG6 A;  1EWZ A;  5HFO A;  2KDK A;  2V2F F;  2JHE A;  4P85 A;  4A5R A;  1YSQ A;  3CLO A;  4EEU A;  1BTL A;  3I7J A;  4QWO A;  1E25 A;  4WZ5 C;  3MFD A;  3ZFZ A;  4R4S A;  1HZO A;  4CLC E;  2VV6 A;  3GMW A;  2V1B A;  3RXW A;  1RGY A;  1K54 C;  2K7S A;  3A3I A;  5HZH A;  1MY8 A;  4X53 A;  3UNW A;  4Y0U A;  3HBR A;  5HL1 A;  3IF6 A;  5TJJ A;  5HPF A;  3RFB A;  3ZGA B;  2B02 A;  4UA7 A;  3TE8 A;  3A0R A;  3MXQ A;  3PBN A;  1LI9 A;  2OV5 A;  1PRQ A;  3VOL A;  4HJ6 A;  4CLC B;  1HD8 A;  5GLD A;  1XA7 A;  3WS1 A;  4EU0 A;  2EX2 A;  1S4S A;  5HAP A;  1D1J A;  2VJW A;  3IF5 A;  2P04 A;  1NJ4 A;  2W1T A;  5F6A A;  5KIZ A;  3NDE A;  3IS2 A;  4QY5 A;  3OPH A;  1YPR A;  4S2N C;  3KX0 X;  4DMZ A;  3BLM A;  2QWS A;  1ALQ A;  4B4X A;  4KQQ A;  3IXB A;  4H8R A;  4LFU A;  2PD7 A;  4E3O A;  4YOF A;  5A90 A;  4OPZ A;  4Y17 A;  1LSX A;  4I3J A;  2W1T B;  3IS2 B;  4H6J A;  4EW7 A;  3IWQ A;  3SH7 A;  3Q82 A;  4EBN A;  2BAS A;  2CMN A;  2HP5 A;  4MDZ A;  3FZC A;  3VFH A;  1XP4 A;  3LIF A;  4UAA A;  3EGX C;  2Y2J A;  2Y2L A;  3ITB A;  2EWV A;  5EOE A;  3BFF A;  4BL3 A;  2W3E A;  5EOO A;  3CZD A;  3KO6 A;  4XXR A;  5EVI A;  4LV3 A;  3S7Q A;  4FD8 A;  2QJ7 A;  4HY8 A;  4NG2 A;  4U3T A;  2ZM0 A;  3BQA A;  4CQH A;  2QJ5 A;  3K3C A;  1EW0 A;  3ZCZ A;  3SOI A;  1OT6 A;  3K2N A;  4GHI A;  1NXY A;  2M7U A;  1XKZ A;  4N9L A;  5EVI B;  3SS3 A;  2FZ0 A;  4NXG A;  2Y2H A;  1S1Y A;  1H3Q A;  2QPN A;  3G32 A;  2Y59 A;  3T4J A;  4IVI A;  1XGI A;  1L0G A;  5KSC A;  3U4L P;  1BSG A;  3T4T A;  3ZG5 A;  1P97 A;  3MR0 A;  3O3V A;  1NLY A;  4OQ0 A;  1TVF A;  1W7F A;  2HGV A;  2EA9 A;  1IYP A;  3N8L A;  4KZ7 A;  4S2P A;  5DFX A;  3R4K A;  1ZG4 A;  4LRZ E;  4X69 A;  1JWZ A;  1S6R A;  4GS9 B;  3OPR A;  3D9Y A;  1OTA A;  3LR5 A;  4KQO A;  4Y5F A;  4JGO A;  1PI4 A;  4OOY A;  4HJ4 A;  4DDS A;  2HF6 A;  1S4R A;  1CQA A;  1Q2P A;  5F69 A;  1UGU A;  3C2W A;  4BLM A;  5C5K A;  5EUA A;  4E3I A;  3AGE A;  5BOH A;  3RJU A;  1UWP X;  2WKH A;  1LLB A;  3LGO A;  2LB5 A;  5DF8 A;  1ES3 A;  4RA7 A;  3PBO A;  2XF3 A;  2YKF A;  1TS8 A;  4L0L A;  1NZU A;  4MLL A;  3D72 A;  4BBU A;  4ZDX A;  4U0X A;  1JNU A;  4L9F A;  1E3U D;  3V50 A;  1OPX A;  4KZ9 A;  4DE2 A;  3ZG9 B;  1IEL A;  3MJQ A;  1FSY A;  1IYQ A;  3SW1 A;  2V20 A;  2VKS A;  2JKR I;  3ZG0 A;  2ZM8 A;  3HLC A;  2ZOI A;  1FR1 A;  5EV0 A;  2P74 A;  1Z09 A;  4OQG A;  4LV1 A;  4EUV A;  1SDE A;  3WRZ A;  5TR7 A;  1BLC A;  2WZZ A;  1YMX A;  1HVB A;  2WGV A;  4C6Y A;  5KSH A;  4LCL A;  4YFM A;  2OAQ 1;  2GZA A;  1V9Z A;  5HWT A;  2R9W A;  3FPV A;  4XUX A;  2ZL1 A;  4KZ3 A;  2QHK A;  2V0W A;  2ZMF A;  3HUO A;  1PWC A;  2UV0 E;  4UA9 A;  1NY0 A;  5CHM A;  2WKR A;  3BJN A;  2EXA A;  4FUW A;  3UDF A;  3BFD A;  4I3I A;  5M18 A;  4K91 A;  3NJA A;  3FPW A;  1MPL A;  2W3G A;  3BEC A;  5TBM A;  3PTE A;  3LI8 A;  2DRW A;  2ZC6 B;  5E2E A;  4ZJ2 A;  3S7O A;  3CHW P;  2Y2O A;  3S7P A;  3CPT A;  1MXO A;  3IQA A;  3Q7Z A;  4PM7 A;  3UME A;  4IBX A;  1IYO A;  3MS6 A;  5TBM B;  3NBL A;  2XFS A;  3BFE A;  1XFQ A;  4JPM A;  3PBT A;  1K57 C;  3V67 A;  1DP6 A;  1M6K A;  2XGN A;  3B47 A;  4Q8I A;  4R3B A;  3CPT B;  3O87 A;  4IUK A;  1ONH A;  3HJI A;  3ZG8 B;  2Y2I A;  3H82 A;  4WL9 A;  1F98 A;  3V5M A;  3F1O A;  3ZNY A;  3ITA A;  3VP1 A;  2EFX A;  2KX6 A;  5CER A;  4ZTK A;  3F1P B;  3IX8 A;  2P9V A;  4NEE D;  3S22 A;  2WYX A;  3C7U A;  3MKE A;  1CK3 A;  4BBT A;  1D7E A;  4KZA A;  4OON A;  2BLS A;  1XA1 A;  3AGF A;  1KE0 A;  2X01 A;  2BTF P;  3C4P A;  3F1O B;  4WZ5 A;  2V1Z A;  4DE3 A;  4HP4 A;  2H0Y A;  4NXB A;  2P9V B;  1E4D A;  3JVU A;  3T4S A;  5AJG A;  3EGD C;  1YLJ A;  5JYP A;  5DF9 A;  1DP9 A;  1ZHH B;  2G2U A;  1K54 A;  1WYC A;  2ZC7 A;  3C8C A;  4EQI A;  1GHP A;  1T18 A;  2JE5 A;  3VSL A;  5CGS A;  1WE4 A;  5TFQ A;  2WKI A;  4DRT A;  4O7D A;  1JTD A;  3PAE A;  2OLV A;  4KQD A;  1VB6 A;  5EVE A;  1BUL A;  3FG8 A;  3KYZ A;  1CI8 A;  2GNX A;  3CI6 A;  1Y54 A;  4MN7 A;  3N7W A;  4PPR A;  5GLA A;  3CUE C;  3LCE A;  1YQS A;  3UB8 A;  2OLU A;  4RX2 A;  1W8Y A;  3ZVW A;  3IX4 A;  4CJN A;  3QNC A;  2PD8 A;  1I2S A;  3W2Z A;  5EFW A;  2C5W B;  1I2W A;  3Q7V A;  4S2N A;  4JXS A;  1OTI A;  5U47 A;  3E2K A;  4B93 A;  5HDD A;  4UQI M;  2UWX A;  1GA0 A;  4L9G A;  3T1S A;  1H8Y A;  3GQZ A;  3DBA A;  3P7N A;  1YAX A;  5L09 A;  1KGE A;  5CHU A;  5FAO A;  3BQ8 A;  4KZ5 A;  3ICY A;  2XRN A;  3G30 A;  1SKF A;  3Q7V B;  2GX5 A;  2JKG A;  3DTK A;  5AVF A;  4IJG A;  5DF7 A;  5CED A;  4N1X A;  2HJE A;  3P01 A;  1STZ A;  4LLO B;  3UPP A;  4KUO A;  4ZJ1 A;  5HWW A;  3IWO A;  1ERM A;  2VGK A;  5AVE A;  1HTZ A;  1U60 A;  4UHU A;  3NDG A;  4O01 A;  4X56 A;  2P08 A;  3CG5 A;  2W3D A;  3A3J A;  3LY3 A;  5FQM A;  2VGJ A;  4OOL A;  2V0U A;  3T4K A;  4BWI A;  4CLC D;  4N9K A;  2PR6 A;  5IT5 A;  2Z6C A;  3MQO A;  5FEF A;  4LRX C;  3P98 A;  2HDU A;  3L9K A;  3LIC A;  4R4R A;  4GN2 A;  1W8Q A;  2EFU A;  3JPU A;  3BW6 A;  4N92 A;  5CGX A;  1O07 A;  4HH3 A;  1IOU A;  2ZMV A;  3MZF A;  2G7U A;  3FYZ A;  4Q0J A;  1WYB A;  1XFN A;  3BEB A;  5FAT A;  1DJB A;  3UPO A;  1KE4 A;  2GJ3 A;  5L07 A;  4DJ3 A;  4PAU A;  3DWZ A;  5E43 A;  4RX3 A;  4EEP A;  4QD4 A;  3MF0 A;  5GLC A;  2EX9 A;  5KZH A;  2DCF A;  3HLE A;  3EQV A;  3V3S A;  2PU2 A;  1XGJ A;  3PXP A;  3GSG A;  4P0M A;  2B18 A;  4UA6 A;  3CJM A;  5A93 A;  3C30 A;  4BD0 A;  5HX9 A;  3SH8 A;  3NY4 A;  1DJC A;  3PHY A;  1FOF A;  3OZH A;  5DKK A;  4YNR A;  4NET A;  2XRO A;  1LHY A;  2IWB A;  1Q2Q A;  1S1Z A;  2MJ6 A;  5FDS A;  3VOY A;  1G28 A;  1AWI A;  1BLH A;  5F68 A;  1K55 C;  2BG1 A;  1FCN A;  5EVI D;  4RQ9 A;  1K6R A;  2VA0 A;  5F83 A;  3IXG A;  4EQ1 A;  4PKY A;  3B42 A;  3IF6 B;  3IH8 A;  4X1M A;  3ULF A;  3N4I A;  5DJU A;  3KYE A;  3RXX A;  4M4X A;  3DAV A;  5MC7 A;  3HLW A;  2A3U A;  4YWZ A;  3MMH A;  1NYM A;  4MMN A;  1KGF A;  5FI6 A;  3QHY A;  5EM0 A;  1TS0 A;  4YIN A;  1TD5 A;  1PWG A;  2EXB A;  2XFT A;  4KZ4 A;  4FOF A;  3EEA A;  4FSF A;  4BL2 A;  2RCX A;  4JGR A;  4B88 A;  1ZKJ A;  4WN5 A;  5DVA A;  4JGP A;  4IBR A;  1VHM A;  1PZP A;  2ZQD A;  4EXO A;  2L0W A;  3DW0 A;  4OPR A;  3E2L A;  2ZQC A;  3QP6 A;  5L10 A;  5TGF A;  5IHV A;  2DNS A;  2I72 A;  3TW8 A;  4H6J B;  4WEL A;  1NZO A;  4HHD A;  4WBG A;  2H5S A;  5FL3 A;  1BLP A;  2QZ6 A;  1IKG A;  3VOZ A;  3DTM A;  5HAI A;  3A3E A;  4MN5 A;  4QU3 A;  1KVL A;  1SCW A;  1K4F A;  1PIO A;  1K57 A;  3NOU C;  4E3L A;  1K25 A;  3H7W A;  3OBF A;  4GB7 A;  4RVA A;  1PFL A;  4P6Z S;  2ZQ9 A;  2PBY A;  2ZQ8 A;  3CIT A;  4E04 A;  4E3J A;  4EUZ A;  4GHI B;  3VMA A;  1ES4 A;  2VZW A;  1OTB A;  5FEG A;  1G6A A;  2XA7 S;  2J3T C;  1XX2 A;  5G4Z A;  3UE1 A;  1OTE A;  1GHI A;  1ESU A;  4E6W A;  3N8R A;  2Q9M A;  3IT9 A;  1H8Z A;  4IVK A;  3K3D A;  5E2F A;  1V9Y A;  2M7V A;  3PBQ A;  3OPL A;  1CEG A;  4GD6 A;  2VK3 A;  3QP5 A;  4IHQ A;  3VE4 A;  3QP4 A;  1DY6 A;  3ZG7 B;  1IYS A;  1Y4O A;  3HRE A;  5DTS A;  4OH0 A;  5I94 A;  1T1C A;  5CTN A;  3NC8 A;  5HWV A;  3T12 B;  3G31 A;  1FSW A;  1PW8 A;  4FH2 A;  4R38 A;  1S67 L;  4R1G A;  4JGQ A;  4CLC C;  2PR5 A;  4WEK A;  2Y2N A;  5FI7 A;  3BLS A;  3KYQ A;  1YT4 A;  4GW9 A;  3CUE A;  2ZJ9 A;  2X02 A;  2ZD8 A;  4DF6 A;  4Q0H A;  1MKI A;  5IU1 A;  4IUH A;  2JN7 A;  4GCZ A;  3G35 A;  4ZAM A;  3M6H A;  4OQI A;  4PM8 A;  3F1N A;  4KZ8 A;  5JYO A;  1YLP A;  4EET B;  3UE0 A;  1KOU A;  3D3O A;  1K6S A;  4ETX A;  1MC0 A;  4HEF A;  3IBR A;  1GSW A;  3QP8 A;  2PAV P;  3KSG A;  4QB8 A;  3U2A A;  4GDB A;  4JF5 A;  3GDI A;  2ZL1 B;  3W4P A;  3PYP A;  1IFQ A;  3GRJ A;  3MXR A;  5HSQ A;  5HDS A;  4OVD A;  5D3O A;  4JXW A;  1ONG A;  4GLQ A;  1XJ6 A;  5FDH A;  3WS4 A;  2P7J A;  1Z6F A;  3G2Y A;  3FWL A;  4B9O A;  4IED A;  4Z1W A;  2D01 A;  1PYY A;  5GHX A;  3UPN A;  4RYE A;  1DRM A;  3A3F A;  1ACF A;  1D06 A;  4II7 A;  2XQZ A;  3PAG A;  3O86 A;  4WMC D;  4ME4 A;  1BT5 A;  3FV7 A;  1ODV A;  4ZBE A;  2O9C A;  4JXV A;  4BMW A;  4BQM A;  3C4O A;  3N6I A;  3ZHH A;  3NUL A;  3OLO A;  2H10 A;  3EOI A;  3UO9 A;  5FQJ A;  2Y2M A;  5FI2 A;  2JBF A;  2WAE A;  4Y15 A;  3UDI A;  4OKP A;  4HH2 A;  1S66 L;  2G2W A;  4HBT A;  3NIA A;  4I39 A;  1YLT A;  4MN6 A;  2J8Y A;  5FQ9 A;  4Y3I A;  1TDG A;  3H82 B;  1IKI A;  4GJ4 A;  5GLB A;  3UY6 A;  2HJ9 C;  4EES A;  3ISG A;  4HI4 A;  3ZVT A;  1TS7 A;  3A0V A;  2VGL S;  3C5A A;  4DXC A;  2Y2P A;  2DMW A;  2A24 A;  2FFF B;  5M19 A;  2FFY A;  4R70 A;  2A49 A;  3ZYT A;  5J3W A;  3TG9 A;  1ERQ A;  5EVL A;  2JC7 A;  1IEM A;  4F94 A;  2W3H A;  4JBF A;  2XH9 A;  2IWD A;  2J9O A;  1LL8 A;  2J7V A;  2ZC5 B;  2WKP A;  1H8M A;  4ESP A;  1SHV A;  3V39 A;  3VE3 A;  2A24 B;  1K55 A;  4KG2 A;  1N4O A;  5FAP A;  4OOM A;  1QME A;  3HLG A;  4WEJ A;  1T19 A;  5EM1 A;  3DTE A;  3IX3 A;  4R0Q A;  3WS5 A;  4FCF A;  3Q81 A;  2QMI A;  3DTI A;  1JTG A;  3VP4 A;  2LB9 A;  2PRF A;  4HJ3 A;  3S1Y A;  3R7W A;  4ID4 A;  3MZE A;  4KZ6 A;  4WLA A;  5G4Y A;  2PU4 A;  5CEB A;  4WZ4 A;  2OAP 1;  1C3B A;  2AVX A;  1N9O A;  5GHZ A;  2B95 A;  4M3K A;  3IXH A;  1P9W A;  3W4Q A;  4DJ2 A;  4Y13 A;  1MWU A;  4Q0I A;  2KOI A;  1RGZ A;  3UE3 A;  4X6T A;  3LIE A;  3MFX A;  2XD1 A;  2W27 A;  3LR4 A;  4FTX A;  3R7W B;  3IHB A;  4GD8 A;  2ZBB A;  3HLB A;  2J80 A;  4D2O A;  3IHA A;  3FKW A;  3GV9 A;  3WWX A;  3QP1 A;  5IS1 A;  3M2J A;  1YKD A;  4Y0T A;  1CJF A;  1GHM A;  5FQI A;  1RP5 A;  1GA9 A;  4ZRR A;  4G3W A;  3KSH A;  1BZA A;  4EER A;  1K4E A;  1ES5 A;  4QPR A;  4R23 A;  2Z6D A;  3D4F A;  4CPK A;  1AXB A;  4AFI A;  3E4Q A;  2H28 A;  4Z9Q A;  3KSF A;  5M1A A;  4DDY A;  1FIK A;  1I5Q A;  2V8F A;  2O99 A;  3WS2 A;  1K56 A;  3G34 A;  5EPH A;  3HL9 A;  5FAS A;  3OCN A;  3NEC A;  5G18 A;  2RL3 A;  1FQG A;  3Q1F A;  2Z2M B;  1L3L A;  3IBJ A;  2QYB A;  3MQ0 A;  1LSV A;  1ESI A;  4DN0 A;  2Y79 A;  2Y91 A;  2ZMA A;  3SZT A;  1YMS A;  3T1Q B;  3A0S A;  3AGD A;  3JVV A;  4K0X A;  3GTC A;  5FA7 A;  1VET A;  3C7V A;  1MKM A;  3OCL A;  5K5B A;  2ACG A;  2CC1 A;  4HOI A;  1SKO A;  1XPB A;  3OC2 A;  3E4P A;  3UB7 A;  1ERO A;  5GHY A;  2HDR A;  5CRF A;  4ARZ A;  5CXW A;  1VET B;  3LIB A;  3E98 A;  5A92 A;  3SS5 A;  1T1A A;  1G68 A;  5AQ9 A;  2KLI A;  4QHC A;  2WAF A;  3E4O A;  2XR0 A;  4D60 A;  1SKO B;  1MWS A;  2IA2 A;  5F5Y A;  4R3J A;  4PM6 A;  5A8B A;  3VV4 A;  5CEC A;  5DKL A;  4OQH A;  1TEM A;  3LR0 A;  2VX8 A;  5I5L A;  2O0Y A;  4ARZ B;  3O88 A;  4CLC A;  3E0Y A;  1J3W A;  1W63 M;  1YLY A;  3CMZ A;  4S2L A;  1ZC2 A;  5F82 A;  2XD5 A;  5DFY A;  2Y55 A;  4HES A;  1FIL A;  4Y0O A;  1S0W A;  3SH9 A;  4B4Z A;  5GL9 A;  3HCY A;  3T1X A;  2PYR A;  1NWZ A;  5J4E A;  5HDC A;  1YM1 A;  5EEC A;  3BY8 A;  1SDN A;  3LI9 A;  2VGL M;  2WGW A;  3VP2 A;  2Y4A A;  4BD1 A;  1CEF A;  2OOL A;  3DWK A;  3MXS A;  2HPB A;  3FC7 A;  3BYD A;  1A0K A;  4WF0 A;  2FH5 A;  4GNU A;  4DE1 A;  3BRM A;  1OJ5 A;  4KEN B;  3LY4 A;  2ZC3 B;  2ZLY A;  5CTM A;  4JKT A;  2H0T A;  2WGW B;  4Y7P A;  1VM1 A;  3HLF A;  2WKQ A;  3PBR A;  5FQQ A;  4MBH A;  4XUZ A;  2OWJ A;  4K08 A;  1FCO A;  4U0T A;  4I38 A;  1YLZ A;  1NRJ A;  1GSX A;  4KUK A;  4EBP A;  1DP8 A;  2XSS A;  4S2J A;  4PM9 A;  2GDN A;  5HL6 A;  4PM5 A;  3PR6 A;  3O5Y A;  3M6B A;  3TOI A;  1ES2 A;  1X0O A;  5HAQ A;  2PBD P;  4NK3 A;  4HBU A;  2VEA A;  2XEP A;  2JKF A;  4C3Q A;  4JF4 A;  1MWR A;  1PW1 A;  1L0D A;  1EI5 A;  2JKT I;  3IH9 A;  2WAD A;  3LIA A;  3MKF A;  5AQA A;  4R3A A;  1F5M A;  4GDN A;  2A2L A;  3MZD A;  3QNB A;  4FH4 A;  2Z2L B;  3UDX A;  2JCH A;  3MSH A;  2PHY A;  3NCK A;  5DTK A;  4I3A A;  4WYY A;  1RCJ A;  3T1R A;  4GS9 A;  4E3M A;  3H7W B;  1JWV A;  4C75 A;  3RTY A;  4ETZ A;  4LV2 A;  4G3V A;  1P9R A;  4LEN A;  1MBL A;  2ZC4 B;  1ZG6 A;  1OME A;  4OPY A;  4E3K A;  4DE0 A;  4HQA A;  3ZNT A;  5FQK A;  3NHQ A;  4OLG A;  3GEC A;  4PHT A;  4R6L A;  1KDS A;  2WK0 A;  2YKH A;  3GR2 A;  4QY6 A;  1LL5 A;  2ZOH A;  1UWN X;  1F9I A;  3TSG A;  2Q9N A;  4MNR A;  3SS4 A;  3NI9 A;  2ZQ7 A;  2EX6 A;  3CAX A;  3RH8 B;  4UQI S;  1W5D A;  4JF6 A;  5A91 A;  1BLS A;  2NUT C;  1N9L A;  3M2K A;  2OWH A;  3W8K A;  3IF6 C;  5E2G A;  3OOV A;  2HDS A;  2WUQ A;  2W3F A;  1XXM A;  2V1A A;  4F3L A;  2Y2K A;  1K0K A;  4EBL A;  4LRY C;  2E8J A;  3MBZ A;  3UB6 A;  3VSK A;  3HJK A;  2ZQA A;  2XLN A;  5L8M A;  2L4R A;  2WKE A;  1W63 Q; 
#chains in the Genus database with same CATH homology
 4QWO A;  1FIL A;  2ZL1 B;  3LEQ A;  5EM0 A;  3MS6 A;  3T1X A;  1FIK A;  2VK3 A;  3MSH A;  2V8F A;  2HZ5 A;  3T1R A;  1Y4O A;  4ESP A;  3CPT B;  3NEC A;  3T1S A;  5EM1 A;  5EV0 A;  3T12 B;  1Z09 A;  1PNE A;  1ACF A;  1A0K A;  2PRF A;  3T1Q B;  1PRQ A;  1SZV A;  1VET A;  1VEU A;  1F2K A;  2JKG A;  2ACG A;  1SKO A;  2B95 A;  2ZL1 A;  1D1J A;  2BTF P;  3NUL A;  2V8C A;  3U4L P;  4X1L A;  1YPR A;  4X25 A;  4FTX A;  5FDS A;  1AWI A;  1VET B;  1VEU B;  3L7H A;  4FUW A;  3D9Y A;  1G5U A;  4D60 A;  1CF0 A;  1PFL A;  1SKO B;  3UB5 P;  1CJF A;  1CQA A;  4X1M A;  1K0K A;  5FEF A;  5EVE A;  2PBD P;  3KYE A;  2E8J A;  5FEG A;  3DAV A;  1HLU P;  2JKF A;  3CHW P;  3LGO A;  1J3W A;  3L9K A;  2PAV P;  3CPT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...