2J3WA

The crystal structure of the bet3-trs31-sedlin complex.
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
142
structure length
142
Chain Sequence
b'LEMSGSFYFVIVGHHDNPVFEMEFLPPGKAESKDDHRHLNQFIAHAALDLVDENMWLSNNMYLKTVDKFNEWFVSAFVTAGHMRFIMLHDVRQEDGIKNFFTDVYDLYIKFAMNPFYEPNSPIRSSAFDRKVQFLGKKHLLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRAFFICKING PROTEIN PARTICLE COMPLEX PROTEIN 2
publication title The Architecture of the Multisubunit Trapp I Complex Suggests a Model for Vesicle Tethering.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport
total genus 41
structure length 142
sequence length 142
chains with identical sequence C
ec nomenclature
pdb deposition date 2006-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04628 Sedlin_N Sedlin, N-terminal conserved region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.70 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2j3wA00
3CUEA 3PR6A 1H3QA 3CUEC 2J3TC 2J3WA 2J3TD 2ZMVA
chains in the Genus database with same CATH superfamily
3E4PA 1OTIA 4ESPA 2ZC6B 5GLDA 1HVBA 2D02A 3IWQA 4BD1A 2WAEA 1L3LA 4HIAA 3Q7VA 4BQMA 3LR5A 1GCEA 4G3WA 3VSKA 2NUTC 1XPBA 1GA0A 3WRTA 3W2ZA 3ISGA 3F1OA 3ZG5A 4OQHA 4IBXA 3RJUA 2P04A 4HI4A 4HESA 1IYSA 4B4ZA 5EV0A 4PM5A 5HDSA 1KVLA 3VOZA 1W5DA 3LEZA 4S2LA 3NI9A 1XKZA 4EUZA 5FATA 1K4EA 2JE5A 4KENB 3UE3A 1ONHA 3GQZA 5CGSA 3UE6A 1PWDA 2VV6A 3PXPA 3E4OA 1QMFA 4UEYA 2HDUA 1OPXA 2ZQ8A 5DTTA 4HP4A 3UO9A 3VOYA 1LL5A 4B93A 5JYPA 3UMDA 5FDHA 4HH2A 3T4LA 3MZDA 1JVJA 5DF7A 1S1ZA 1AXBA 3PAEA 4KG2A 1V9ZA 3SS4A 5GLCA 2WGWA 1GSVA 3Q81A 3LR3A 4BBUA 3Q07A 2WGVA 2O9BA 1OTDA 5AJGA 3SH8A 3V3RA 5FASA 1BLSA 4OONA 3ZG8B 3FZCA 3B42A 1VETA 5FAQA 1FIKA 3PR6A 4ZAMA 2KDKA 3MBZA 2J7VA 3T1RA 1OJGA 2Z6CA 4Y7PA 5U47A 5IU1A 3MXQA 4DE1A 1X0OA 1JTGA 2EX6A 2O9AA 3BM6A 3LR4A 2ZQCA 2ZLYA 1ALQA 1NZUA 4LRXC 2QKPA 2WADA 4L9EA 4OOYA 1K6RA 4WMCA 2K7SA 5I94A 2C5WB 3MF0A 4GLQA 4JKTA 2XK1A 2ZL1B 3OBFA 2LB5A 4NXEA 4GDNA 3KYEA 3OCLA 2XROA 4WUJA 1CF0A 2JN7A 2EFXA 3T4SA 3T4JA 2R9WA 4X69A 2H0YA 1XFQA 5FI7A 3CLOA 2HDSA 4JXWA 1ES3A 1LT0A 2PRFA 2PBYA 2WKQA 1LSVA 3WS0A 3QP4A 3IH8A 2J3WA 3UB5P 5HWWA 3GTCA 5E2FA 2QMIA 1HTZA 2E8IA 1YKDA 2OAQ1 1MWRA 4NXFA 1EROA 3D4FA 2ZC7A 2HGVA 3CPTA 1YMSA 4HJ6A 4X53A 3JVUA 4H8RA 1PI5A 2EX9A 3H7WB 5HWTA 1F5MA 4UHUA 3RXXA 2EWWA 2GZAA 2EWVA 2PU4A 4NG2A 3VV4A 2I9VA 2CC1A 5HL1A 1VQQA 1IYQA 3EEAA 2Y2MA 5EM0A 2PR5A 4KQOA 1TS8A 1NWZA 2Q0OA 2V2FF 4BBVA 4KZ6A 2PD8A 3TRCA 3LIDA 1EI5A 4E3OA 2P74A 3R7WB 4B4XA 3LEQA 2W1RA 3IXBA 2KOIA 3BFFA 3FPVA 2O99A 3NDGA 3LGOA 4WL9A 3V67A 4IVIA 5HDDA 3DW0A 2HJ9C 1L0DA 1GHPA 3WRZA 4MBKA 1OTAA 4Y0UA 4R23A 2J9PA 1D06A 3T4QA 4OKPA 1YMXA 2V20A 2PBDP 1P97A 1S6RA 3O5YA 5CTNA 1WYBA 1KDWA 3S7NA 4I5SA 3IF6C 1KE0A 3D3OA 2HP6A 5L8MA 3IF6B 3FYZA 4OQGA 3V50A 4P6BA 3OOVA 4HOIA 1T1AA 1FCNA 3H7WA 2ZQAA 3QP2A 5DKLA 1W63M 3ICYA 4I3AA 2H0TA 1ZHHB 4KZBA 3G35A 2QJ7A 3A3IA 5DJUA 3WS1A 3FKWA 2QPNA 4FH4A 3QP8A 2B5RA 4H6JB 2XLNA 1PZPA 3CUEC 2Z2LB 2EFUA 1STZA 3M6HA 3UMEA 3UE1A 3R7WA 3OZHA 5AVEA 5L10A 2H28A 4GW9A 1ODVA 4DKIA 5FQMA 3KYQA 3VMAA 1H8ZA 3SW1A 3EGXC 1M40A 4Z9QA 2VEAA 1T19A 3CMZA 3IS2A 1GSWA 4OPYA 4LV1A 2AVXA 1NYMA 1K0KA 4GD8A 2RCXA 3S7PA 4DJ3A 1K56A 1DRMA 4XT2B 3BFEA 2PDRA 2WZXA 2ZQDA 4Z1WA 1EWZA 2UWXA 3Q82A 5TJJA 3S22A 3IWOA 4WEJA 1CI9A 1S67L 1VB6A 1U60A 3P01A 3S7QA 1ONGA 1WA9A 2XD5A 1HLUP 3A3JA 3IF6A 5EVEA 1XP4A 3PBOA 4GHIB 4HJ3A 3MQ0A 2ZC4B 4DDSA 3MQQA 1E3UA 3QNBA 4ZTKA 3H82B 4B9OA 1PW8A 2ZMFA 2JKRI 3OC2A 1WYCA 4H6JA 1MC0A 4P6ZM 5GHXA 2X01A 5CHMA 2INWA 3ZNTA 2FH5A 2ZBBA 3CUEA 1N9LA 3Q7ZA 1NLYA 3MZFA 1V9YA 1TDGA 1YT4A 5C5KA 4R3BA 1NJ4A 1PYYA 3KX0X 5CTMA 3O86A 4ZJ1A 4EV4A 2DMWA 5CERA 1ACFA 5FQQA 2XA7S 3IXGA 3MKEA 3LIEA 5IHVA 4QHCA 4DXBA 4IUHA 3PBQA 3MQOA 4QD4A 4RVAA 4CLCC 1NZOA 1KE4A 4PM7A 1SDEA 1G5UA 2OWJA 4KG6A 1ESUA 4CJNA 4PM8A 2VZWA 4E04A 3MZEA 3SH7A 4LENA 1BSGA 5HDCA 1TEMA 4KZ4A 5E2GA 5L09A 3NC8A 1PFLA 1Y28A 3DTIA 2OOLA 4HHDA 1HZOA 5EVLA 3D9YA 4GHIA 1FSWA 3LYXA 2FFFB 4IHQA 4I39A 5F69A 2A24B 3ZG7B 4CQHA 2A49A 4OVDA 1OMEA 1J9MA 4DF6A 3C38A 3ZG9B 3GVBA 3NY4A 3QHYA 5FI2A 3E98A 2XGNA 4X6TA 4BD0A 2Y55A 1VETB 2J3TD 4DRTA 1JNUA 1L2SA 2W3DA 2VKSA 1GHIA 3QNCA 1F98A 5FEFA 3UB8A 3MS6A 5CXWA 1DJCA 4PM6A 4AFIA 4DE2A 1L0EA 2A3UA 2ZOHA 4PAUA 4BWIA 3P09A 2V1ZA 4DXCA 4KG5A 1S4RA 2K2NA 1KDSA 2C6WB 1YPRA 3D72A 1NRFA 1UGUA 1H5XA 1JWVA 3VP1A 2L4RA 5J3WA 1TS7A 1AWIA 3NHQA 1SKFA 1MY8A 4EERA 2HZ5A 1I2WA 4X68A 3OPHA 1Y4OA 4CLCA 3VSLA 1XJ3A 3N7WA 4Y3IA 5HPFA 2WKIA 2J80A 2V1AA 4O7DA 3IQAA 1GHMA 3O88A 5HL6A 4OPRA 4K91A 1UWPX 4YNRA 2OWHA 3UDXA 4E3LA 3FKVA 3HLFA 4HJ4A 5EVIC 4IEDA 1H8YA 4LLOB 2A24A 5EVIB 3MXSA 3HLWA 2BG1A 2IWBA 5EUAA 1W8QA 4OLDA 5HSQA 4S2OA 1XXMA 4Q0JA 1PI4A 5E43A 3OPPA 3ITAA 4EEPA 5CX7A 3EGDC 1YAXA 1BLPA 3HBRA 3OPLA 1GSXA 5IS1A 3S4XA 3IWIA 3SOIA 3CPTB 3MSHA 5HFOA 2XQZA 3M6BA 5KSHA 3BW6A 4EUVA 5KMWA 2ZM0A 1L0FA 3TOIA 4X55A 1K55C 3C8CA 3OLOA 3BECA 3I7JA 1LHYA 4M4XA 4HY8A 4LV0A 2KLIA 4LGWA 3PTEA 4K08A 3WS4A 1VM1A 5A93A 4UA6A 3LIAA 4L0LA 1CEGA 4JGQA 5HAIA 4X25A 1P9RA 3BWLA 2XFSA 4WEKA 5GHZA 4RQ9A 4C3QA 5FDSA 4XUXA 2M7VA 1ZG6A 2JKTM 4Y13A 5DFYA 3O87A 5A90A 4BBTA 3BY8A 2W3EA 5CEBA 2V8CA 4P87A 1MKIA 3N8RA 4WELA 2BASA 3ITBA 3LI9A 3BFGA 1TDLA 4JBFA 5FQIA 5J8XA 1K54C 5DKKA 1PW1A 2H10A 1VHMA 2ACGA 2Y91A 4S2PA 4KZ7A 4JGRA 4MN5A 4C75A 4A5RA 5EVIA 2Y2KA 4OOLA 2V0UA 4Y17A 3KYZA 1FOFA 4BJPA 4ID4A 2YKFA 4KZ8A 4GN2A 2Y2IA 3KSFA 2QZ6A 4E6WA 3JYIA 1EW0A 2Y2JA 4OP5A 1H8MA 4F3LB 3CITA 3VP0A 2PYPA 3WS5A 5E2EA 4ZRRA 3FC7A 4WZ5C 5E2HA 4NXBA 5EOOA 4ZBEA 2Y2NA 1K6SA 3C5AA 1XGJA 5M1AA 1S4SA 3ZCZA 2JHEA 1W79A 4PM9A 1E4DA 5TGFA 3V39A 4QWOA 2X71A 1K55A 2D01A 2XDMA 4EQ1A 1W63Q 2R78A 1FILA 3ZYTA 4QY5A 1DP9A 4D2OA 4S2NC 3GMWA 3E4QA 4HNBA 2Y2OA 1K25A 4RX3A 3CZDA 5DJTA 1G28A 4PMAA 4LRZE 4EWFA 3UNWA 3LR0A 2M7UA 1BLCA 4M3KA 4WN5A 1BT5A 2ZD8A 3U4LP 2P9VB 3PYPA 2P08A 4GB7A 4UQIS 1K54A 1T1BA 3IS2B 1H0MA 4WBGA 4LCMA 3DTMA 3IBRA 4HBTA 1TD5A 5HX9A 4U3TA 3PBRA 4O8GA 2I72A 2XH9A 2PT7A 5FAOA 2MJ6A 1RP5A 4NETA 4JLFA 4F3LA 1YSQA 2HDRA 3MFXA 4DE3A 3UDIA 3E0YA 4L9FA 4ETXA 4UQIM 4WZ5A 4HBUA 4II7A 3PBNA 4BL3A 3BY9A 2DCFA 1S1YA 1YLPA 1VEUB 3GR2A 2WYXA 1DP8A 3FV7A 2UV0E 3B47A 3LI8A 5HPIA 3DAVA 5CGXA 3UB7A 1OT6A 3PBSA 3G30A 1YLTA 3IX3A 4E3IA 3M2KA 2ZMVA 2BTFP 1SCWA 1LL9A 3BLSA 4IBRA 4S2NA 4R4RA 4N1HA 3CAXA 1NLZA 4GD6A 4CPKA 1W8YA 5FQJA 1TVFA 1YLJA 1T18A 3MKFA 5HW3A 1BZAA 3UE0A 1I2SA 1SZVA 3E2KA 3GV9A 4EW7A 1LLBA 2P9VA 5G4ZA 1MKMA 4FOFA 1IYPA 1E25A 1FR6A 3ZHHA 4IUKA 4NEED 2WZZA 1KGFA 4R6LA 4L9GA 3EWKA 1ZKJA 4I3IA 3G2ZA 5EE8A 4D60A 3CHWP 5DFXA 2IWCA 2L1MA 4KZ3A 4OLGA 2IA2A 1Z6FA 1ZG4A 1XFNA 1G6AA 4K0WA 4JF5A 1K38A 3GRJA 3A3DA 2L0WA 1NRJA 2Y8HA 4FD8A 1NYYA 3NCKA 4R70A 4MEZA 3WS2A 3MR0A 4LRYC 2FFYA 4LPZA 3A0RA 3S7OA 5DF9A 2W3HA 1SDNA 3EQUA 5FSRA 1VEUA 2Y2PA 4O0PA 4WZ4A 1S66L 2PD7A 2W3FA 4BLMA 2VV8A 2G2UA 2DNSA 1JWZA 4O01A 4PKYA 3S1YA 3K3DA 3ZDJA 1P0ZA 3IF5A 2Q9MA 2G2WA 4JF6A 2WAFA 5F82A 3TG9A 4ARZB 3A3EA 3BRMA 2JKGA 3A3FA 4MNRA 3C2WA 1TS0A 2E8JA 4MMNA 3HREA 4K0XA 4JF4A 1ESIA 1P9WA 2XF3A 5LBRA 1WE4A 2EX8A 2QYBA 4MDZA 1YQSA 4NK3A 4C6YA 2WKHA 3QP5A 3LICA 3NJAA 4QB8A 4Q8IA 2HDQA 3KSHA 4MBFA 4YINA 2OV5A 4BL2A 2OLVA 3O3VA 3NOUC 3MMHA 3DTKA 2RL3A 1XJ6A 5EECA 3ZQ5A 3RXWA 3BEBA 4R1GA 3PHYA 4CLCB 3IXDA 4GS9B 4XXRA 1Z09A 4HP9A 1SHVA 3V5MA 5G18A 5FI6A 2HJEA 4CLCE 1PWCA 2B95A 3NECA 1Y54A 4DE0A 1LL8A 1D7EA 2XA7M 4UA7A 3C30A 5AVFA 3CI6A 3B3XA 2V1BA 2VJWA 1BYWA 1YM1A 4KZ5A 2GX5A 3SS5A 2A2LA 5GLAA 4N9KA 5HWVA 3K3CA 4HH3A 4Y0TA 4ARZA 2PHYA 5A8BA 4DN0A 3NDEA 3EOIA 3AGFA 2VGLS 2Y2LA 2ZQ7A 3P7NA 2Y79A 1PWGA 3RTYA 4R4SA 1O07A 4EBPA 3IXHA 4G3VA 2QWSA 1ERQA 1FCMA 3IH9A 1F9IA 3LCEA 1DJAA 2DRWA 3SH9A 4WMCD 4EBNA 3V3SA 5HARA 3T1XA 1IOUA 2J3TC 4EXOA 1KVMA 2ZC5B 3UPOA 4JPMA 5EM1A 5TR7A 1XJ2A 2JC7A 1XJ4A 3TSGA 3DWKA 1N4OA 4WLAA 2VGLM 4EEUA 2J9OA 5J4EA 1W7FA 3P98A 4GS9A 3T1SA 2PYRA 3F1NA 4JGOA 3W4QA 3EQVA 5GL9A 4DJ2A 2Y2HA 5EVID 2W3GA 1IELA 3SZTA 3DBAA 2QHKA 4KQDA 2GNXA 1KGEA 4P85A 2JKTI 2W1TB 2Y2QA 4IVKA 4HQAA 1IYOA 5EFWA 4R3AA 1YLWA 3UB6A 1PNEA 2P7JA 3KSGA 4UA9A 2V9AA 3H9WA 2J8YA 3G34A 3AGEA 3ZVWA 2KX6A 4GNUA 1KGGA 1G6OA 2VGKA 1CEFA 4B88A 2EA9A 3G2YA 3SS3A 2HP9A 2B02A 4GZBA 3GSGA 5HZHA 2NUPC 3C7UA 2EX2A 3HUOA 2HP5A 5FL3A 4X1MA 4KUOA 2HF6A 1ERMA 3HLGA 1KOUA 1OTEA 2V0WA 2EXBA 3IX4A 1UWNX 5FEGA 2W0NA 5DF8A 1ES5A 2ZM8A 1F2KA 4LFUA 1L0GA 4PKYG 3VOLA 4KZAA 1MBLA 2VV7A 3G4PA 5F5YA 4YFMA 4YOFA 1QMEA 5FAPA 3JVVA 3HLCA 3MJQA 5L07A 5TBMB 4MBHA 3JPUA 2Y2GA 3ZFZA 4EETB 3IHBA 3W4OA 2W27A 3B33A 4PHTA 3G32A 3C4PA 3TE8A 4ZDXA 3UN7A 3UY6A 2Y4AA 3KSIA 1FSYA 2EXAA 3LUQA 2W1TA 3VP2A 1PZOA 3CG5A 3OPRA 3A0VA 3HVFA 1PIOA 3VE3A 2Z2MB 1OT9A 1XA1A 3R4KA 4ETZA 4EBLA 5M18A 3CJMA 1PRQA 3M2JA 3LIBA 5DTKA 4MLLA 4FUWA 2XFTA 5HD3A 3T12B 3L7HA 5FQ9A 4JXVA 2PAVP 2LB9A 3CWFA 2PR6A 2WK0A 4KQRA 5HAPA 5M19A 1OJ5A 1RGZA 4EQIA 2O0YA 3HJKA 1TS6A 5MC7A 4X1LA 3N4IA 3LO7A 3FG8A 3T4OA 1LI0A 4OPZA 3FPWA 5D3OA 5CHJA 3HUNA 2ZJ9A 3AGDA 3N6IA 4ME4A 4QPRA 3UB9A 1DP6A 4Y0OA 3UPPA 2VGJA 4ZJ3A 2XD1A 4HEFA 4FCFA 1ZC2A 3A0SA 4OQIA 5CECA 2QJ5A 3N8LA 5CGWA 2R9XA 1BUEA 1DY6A 4KZ9A 5TBMA 4Q0IA 1G68A 1XGIA 2WKPA 1YLYA 5K5BA 2ZQ9A 3TJZC 4WYYA 4F94A 4BENA 2XR0A 2ZL1A 4WM9A 4S2MA 1K56D 1ES2A 4ZJ2A 4MN7A 3BQ8A 5GHYA 4RYEA 1XX2A 1IEMA 5I5LA 4OQ0A 1T1CA 1C3BA 4GDBA 3NOTC 3W8KA 2JCHA 3UDFA 4OOMA 1SKOB 5AQ7A 3L9KA 4E3NA 3OCNA 1BTLA 3WWXA 4U0TA 3HJIA 3QP6A 1TF1A 2K31A 3PBTA 4S2KA 1E3UD 3LY4A 4NXGA 4OPQA 5F83A 4R3JA 1Q2PA 4E3MA 4DDYA 1N9OA 4Y5FA 2O9CA 1LSXA 4GKUA 4JXSA 2YKHA 5KIZA 4U0XA 4KQQA 1RGYA 2GJ3A 4OP8A 3BYDA 1XA7A 4WF0A 4FSFA 4UAAA 4X56A 3NOPC 3HUMA 3T50A 1JWPA 2HPBA 1BLHA 5IT5A 4MCWA 2ZM2A 2JBFA 5F1FA 2XEPA 1FR1A 4S2JA 5CHUA 3N8SA 1OTBA 1CQAA 1FCOA 1FQGA 4YWZA 3IX8A 5HD5A 5F6AA 1IKGA 2XRNA 4G3KA 2H5SA 3RH8B 3ZVTA 4S2IA 3U2AA 1MWTA 5AQAA 1N9BA 5GLBA 4EESA 1ES4A 5G4YA 3E2LA 1JTDA 2FZ0A 4LV2A 3HCYA 4LV3A 3W4PA 1IKIA 3EEHA 5FA7A 1A0KA 1SKOA 4QY6A 3VFFA 2WGIA 3F1PB 5A91A 1MPLA 4JXGA 2WKRA 3TW8A 3HL9A 2Q9NA 1CK3A 4N92A 1O7EA 4QJGA 2G7UA 2WKEA 2ZOIA 1MZUA 1NY0A 1K57C 2V8FA 1RCJA 4R0QA 3MXRA 3ZG0A 3ULFA 4R38A 2B18A 3BQAA 4FTXA 2IWDA 2X02A 5AQBA 3KO6A 4P6ZS 5BOHA 3T4TA 1H3QA 5F1GA 1ZTUA 4RX2A 2HV1A 3G6OA 2CMNA 4IJGA 4N9LA 3VP3A 1D1JA 4N1XA 2ZC3B 3GDIA 5CEDA 1J3WA 4KUKA 3NIAA 3IHAA 3BFDA 5HAQA 2WUQA 3C7VA 3QP1A 4MN6A 1KE3A 5KSCA 2BLSA 3T1QB 1I5QA 1MXOA 4PPRA 1IFQA 1CI8A 5J7EA 4LCLA 3VE4A 5EPHA 2OLUA 1GA9A 2GDNA 3GECA 1YLZA 4I3JA 2Z6DA 3DWZA 1LI9A 4P0MA 3ZNYA 3HLBA 3K2NA 4E6XA 2ZMAA 2Y59A 5DVAA 3ZGAB 1CJFA 4QU3A 5F68A 3Q7VB 1LSWA 3BLMA 5DTSA 4I38A 4CLCD 5A92A 5AQ9A 3IT9A 2VA0A 4XUZA 3F1OB 3MFDA 5FQKA 5JYOA 4Q0HA 3F1PA 2OAP1 1K4FA 3BFCA 1N9NA 3F1NB 4JGPA 2JKFA 1NXYA 4NKPA 3PAGA 3FWLA 2M1CA 4GJ4A 1YSPA 3VP4A 4DMZA 1MWSA 3VFHA 5L2FA 5KZHA 3RFBA 4XT2A 1HD8A 5EOEA 4E3KA 1DJBA 4EU0A 4GCZA 2PU2A 1K57A 4Y2FA 3LY3A 3LIFA 2OSUA 3G31A 2VX8A 3NULA 3LFVA 2VLGA 1MWUA 2VK3A 4Y15A 4BMWA 2JKRM 3Q1FA 3NBLA 1BULA 4FH2A 2WGWB 3UPNA 1Q2QA 2XSSA 3C4OA 3BJNA 4RA7A 1M6KA 4E3JA 3IBJA 3DTEA 3HLDA 5TFQA 3HLEA 3T4KA 5CRFA 4GOGA 3H82A 4OH0A 1S0WA
chains in the Genus database with same CATH topology
2VV7A 1WA9A 3IBRA 5F5YA 3E4PA 4YOFA 1OTIA 1TD5A 3JVVA 3MJQA 3PBOA 4GHIB 5TBMB 4HJ3A 3MQ0A 3PBRA 2D02A 4O8GA 3MQQA 4EETB 2W27A 3B33A 4HIAA 4PHTA 2PT7A 2MJ6A 3TE8A 3LR5A 4G3WA 4F3LA 2NUTC 3KSIA 1YSQA 3MFXA 3H82B 3W2ZA 3LUQA 2W1TA 3F1OA 4B9OA 3A0VA 3VE3A 2ZMFA 2JKRI 2P04A 3E0YA 1OT9A 4HI4A 4L9FA 4ETXA 3OC2A 4H6JA 4UQIM 3R4KA 1MC0A 4II7A 4ETZA 4P6ZM 3PBNA 3BY9A 3LIBA 5HDSA 1S1YA 2INWA 5HD3A 2FH5A 2ZBBA 1DP8A 3CUEA 1N9LA 3UE3A 3LI8A 3B47A 2LB9A 3CWFA 2PR6A 3UE6A 2VV6A 3PXPA 1NLYA 5HPIA 3E4OA 4UEYA 3UB7A 1OJ5A 1V9YA 5C5KA 1OT6A 3PBSA 1OPXA 4HP4A 3KX0X 2O0YA 3HJKA 4B93A 2DMWA 1TS6A 2ZMVA 5MC7A 3UMDA 3T4LA 4HH2A 2XA7S 1S1ZA 3LIEA 3CAXA 3FG8A 4IUHA 3PBQA 1NLZA 3MQOA 3T4OA 1V9ZA 3FPWA 4CLCC 1T18A 1GSVA 2OWJA 3LR3A 4BBUA 4ME4A 4QPRA 3UB9A 1DP6A 4EW7A 2O9BA 2VZWA 4E04A 5G4ZA 1OTDA 1MKMA 4FOFA 5AJGA 5HDCA 4IUKA 3A0SA 3B42A 4NEED 2QJ5A 1Y28A 4R6LA 3PR6A 2OOLA 4HHDA 4L9GA 3EWKA 4GHIA 2KDKA 5TBMA 4I3IA 4Q0IA 3LYXA 4IHQA 4I39A 5F69A 2A24B 2WKPA 1OJGA 4CQHA 2Z6CA 5K5BA 3TJZC 5DFXA 2L1MA 3C38A 5IU1A 3MXQA 2IA2A 1X0OA 1XFNA 3E98A 2O9AA 3LR4A 4LRXC 4MN7A 2QKPA 3BQ8A 2L0WA 1NRJA 2J3TD 2Y8HA 5I5LA 4R70A 1JNUA 3MR0A 2W3DA 4L9EA 4LRYC 4LPZA 1T1CA 2VKSA 3A0RA 3S7OA 3NOTC 5DF9A 2W3HA 3EQUA 1F98A 4OOMA 2K7SA 4O0PA 1S66L 2PD7A 2W3FA 3MF0A 3OCNA 2VV8A 4GLQA 3UB8A 3OBFA 3HJIA 4O01A 4PKYA 1TF1A 2LB5A 3K3DA 4NXEA 2K31A 4AFIA 1P0ZA 3PBTA 3OCLA 2ZOHA 4PAUA 2XROA 4BWIA 4WUJA 4NXGA 4ARZB 2JN7A 1S4RA 2K2NA 1N9OA 4Y5FA 3C2WA 3T4SA 3D72A 1UGUA 2O9CA 1LSXA 2YKHA 3T4JA 5KIZA 1TS0A 2L4RA 5J3WA 1TS7A 3NHQA 4MMNA 2GJ3A 1XFQA 4WF0A 1P9WA 4FSFA 5LBRA 4EERA 2QYBA 4MDZA 3CLOA 3NOPC 3T50A 4CLCA 1LT0A 1XJ3A 2WKQA 4Y3IA 5HPFA 1LSVA 2J80A 3LICA 5IT5A 4MCWA 2V1AA 5HL6A 3NJAA 2J3WA 3KSHA 5HWWA 1UWPX 4YNRA 2OWHA 1OTBA 1YKDA 4HJ4A 2OAQ1 3NOUC 4NXFA 4YWZA 3MMHA 2HGVA 4LLOB 5HD5A 2A24A 5F6AA 1XJ6A 3ZQ5A 2XRNA 4G3KA 3RH8B 3PHYA 4HJ6A 5HSQA 4CLCB 3JVUA 4Q0JA 4GS9B 3U2AA 4HP9A 3H7WB 5HWTA 1F5MA 2HJEA 4CLCE 2EWWA 4EESA 5G4YA 2GZAA 4EEPA 5CX7A 2EWVA 3EGDC 1YAXA 2FZ0A 3HCYA 3VV4A 2I9VA 3EEHA 1GSXA 1LL8A 5IS1A 1D7EA 3EEAA 2XA7M 3C30A 5AVFA 3F1PB 2PR5A 3CI6A 5KSHA 2V1BA 3BW6A 1TS8A 2WKRA 4KQOA 2VJWA 3TW8A 4EUVA 1NWZA 1BYWA 2GX5A 4BBVA 3C8CA 3OLOA 2PD8A 2A2LA 3LIDA 3TRCA 3R7WB 2G7UA 2ZOIA 5HWVA 3K3CA 4M4XA 1MZUA 2W1RA 4HH3A 4HY8A 2KLIA 2KOIA 2PHYA 4ARZA 4K08A 3FPVA 2O99A 5A8BA 3ULFA 4R38A 4DN0A 2B18A 3BQAA 3LIAA 3EOIA 4L0LA 4WL9A 3V67A 2VGLS 5HDDA 4JGQA 3KO6A 1P9RA 3P7NA 3BWLA 2Y79A 4P6ZS 4WEKA 2HJ9C 4RQ9A 3T4TA 2M7VA 1H3QA 1ZTUA 2JKTM 3RTYA 1OTAA 5DFYA 4G3VA 2HV1A 2QWSA 3G6OA 1D06A 4BBTA 3BY8A 1F9IA 2W3EA 3T4QA 2CMNA 4IJGA 1IOUA 4WELA 2J3TC 3GDIA 2BASA 4EXOA 3LI9A 4KUKA 1P97A 5DKKA 3O5YA 4MN6A 1XJ2A 1XJ4A 1VHMA 3S7NA 1IFQA 4I5SA 4JGRA 5J7EA 4MN5A 3D3OA 4WLAA 3VE4A 2VGLM 4OOLA 5L8MA 4EEUA 2V0UA 5J4EA 3GECA 3KYZA 4I3JA 4GS9A 2PYRA 2Z6DA 3F1NA 3OOVA 4JGOA 4BJPA 4HOIA 1T1AA 3EQVA 2YKFA 3H7WA 4DJ2A 3KSFA 3K2NA 5DKLA 1W63M 3ICYA 4I3AA 1EW0A 1H8MA 2W3GA 1ZHHB 5F68A 1LSWA 3DBAA 2QHKA 4I38A 2QJ7A 4CLCD 4F3LB 3CITA 5DJUA 4KQDA 2GNXA 2PYPA 2JKTI 4ZRRA 2VA0A 3FC7A 2W1TB 3F1OB 4HQAA 4NXBA 5EFWA 4R3AA 4H6JB 4Q0HA 3F1PA 2OAP1 1N9NA 3CUEC 3F1NB 4JGPA 3UB6A 1S4SA 2P7JA 3KSGA 2JHEA 4NKPA 1STZA 2V9AA 3H9WA 3UMEA 2M1CA 3R7WA 4GJ4A 5AVEA 1YSPA 4DMZA 3RFBA 2KX6A 4XT2A 2H28A 4GW9A 2D01A 4EQ1A 1ODVA 4EU0A 1G6OA 3KYQA 4GCZA 1W63Q 4Y2FA 2R78A 3SW1A 3EGXC 3ZYTA 2EA9A 3LIFA 2VEAA 2B02A 1DP9A 2VX8A 3E4QA 4HNBA 1T19A 3IS2A 2VLGA 3LFVA 1GSWA 2NUPC 5HZHA 5DJTA 4BMWA 2JKRM 1G28A 4LRZE 5FL3A 3S7PA 4DJ3A 4KUOA 2HF6A 1DRMA 2XSSA 3LR0A 3BJNA 2M7UA 4XT2B 2PDRA 4WN5A 1KOUA 1OTEA 2V0WA 3IBJA 4Z1WA 1UWNX 2W0NA 3T4KA 3PYPA 2P08A 4UQIS 5TJJA 4PKYG 4WEJA 3H82A 1S67L 3VOLA 1T1BA 3IS2B 1VB6A 3P01A 3S7QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CUE A;  3PR6 A;  1H3Q A;  3CUE C;  2J3T C;  2J3W A;  2J3T D;  2ZMV A; 
#chains in the Genus database with same CATH topology
 3E4P A;  1OTI A;  4ESP A;  2ZC6 B;  5GLD A;  1HVB A;  2D02 A;  3IWQ A;  4BD1 A;  2WAE A;  1L3L A;  4HIA A;  3Q7V A;  4BQM A;  3LR5 A;  1GCE A;  4G3W A;  3VSK A;  2NUT C;  1XPB A;  1GA0 A;  3WRT A;  3W2Z A;  3ISG A;  3F1O A;  3ZG5 A;  4OQH A;  4IBX A;  3RJU A;  2P04 A;  4HI4 A;  4HES A;  1IYS A;  4B4Z A;  5EV0 A;  4PM5 A;  5HDS A;  1KVL A;  3VOZ A;  1W5D A;  3LEZ A;  4S2L A;  3NI9 A;  1XKZ A;  4EUZ A;  5FAT A;  1K4E A;  2JE5 A;  4KEN B;  3UE3 A;  1ONH A;  3GQZ A;  5CGS A;  3UE6 A;  1PWD A;  2VV6 A;  3PXP A;  3E4O A;  1QMF A;  4UEY A;  2HDU A;  1OPX A;  2ZQ8 A;  5DTT A;  4HP4 A;  3UO9 A;  3VOY A;  1LL5 A;  4B93 A;  5JYP A;  3UMD A;  5FDH A;  4HH2 A;  3T4L A;  3MZD A;  1JVJ A;  5DF7 A;  1S1Z A;  1AXB A;  3PAE A;  4KG2 A;  1V9Z A;  3SS4 A;  5GLC A;  2WGW A;  1GSV A;  3Q81 A;  3LR3 A;  4BBU A;  3Q07 A;  2WGV A;  2O9B A;  1OTD A;  5AJG A;  3SH8 A;  3V3R A;  5FAS A;  1BLS A;  4OON A;  3ZG8 B;  3FZC A;  3B42 A;  1VET A;  5FAQ A;  1FIK A;  3PR6 A;  4ZAM A;  2KDK A;  3MBZ A;  2J7V A;  3T1R A;  1OJG A;  2Z6C A;  4Y7P A;  5U47 A;  5IU1 A;  3MXQ A;  4DE1 A;  1X0O A;  1JTG A;  2EX6 A;  2O9A A;  3BM6 A;  3LR4 A;  2ZQC A;  2ZLY A;  1ALQ A;  1NZU A;  4LRX C;  2QKP A;  2WAD A;  4L9E A;  4OOY A;  1K6R A;  4WMC A;  2K7S A;  5I94 A;  2C5W B;  3MF0 A;  4GLQ A;  4JKT A;  2XK1 A;  2ZL1 B;  3OBF A;  2LB5 A;  4NXE A;  4GDN A;  3KYE A;  3OCL A;  2XRO A;  4WUJ A;  1CF0 A;  2JN7 A;  2EFX A;  3T4S A;  3T4J A;  2R9W A;  4X69 A;  2H0Y A;  1XFQ A;  5FI7 A;  3CLO A;  2HDS A;  4JXW A;  1ES3 A;  1LT0 A;  2PRF A;  2PBY A;  2WKQ A;  1LSV A;  3WS0 A;  3QP4 A;  3IH8 A;  2J3W A;  3UB5 P;  5HWW A;  3GTC A;  5E2F A;  2QMI A;  1HTZ A;  2E8I A;  1YKD A;  2OAQ 1;  1MWR A;  4NXF A;  1ERO A;  3D4F A;  2ZC7 A;  2HGV A;  3CPT A;  1YMS A;  4HJ6 A;  4X53 A;  3JVU A;  4H8R A;  1PI5 A;  2EX9 A;  3H7W B;  5HWT A;  1F5M A;  4UHU A;  3RXX A;  2EWW A;  2GZA A;  2EWV A;  2PU4 A;  4NG2 A;  3VV4 A;  2I9V A;  2CC1 A;  5HL1 A;  1VQQ A;  1IYQ A;  3EEA A;  2Y2M A;  5EM0 A;  2PR5 A;  4KQO A;  1TS8 A;  1NWZ A;  2Q0O A;  2V2F F;  4BBV A;  4KZ6 A;  2PD8 A;  3TRC A;  3LID A;  1EI5 A;  4E3O A;  2P74 A;  3R7W B;  4B4X A;  3LEQ A;  2W1R A;  3IXB A;  2KOI A;  3BFF A;  3FPV A;  2O99 A;  3NDG A;  3LGO A;  4WL9 A;  3V67 A;  4IVI A;  5HDD A;  3DW0 A;  2HJ9 C;  1L0D A;  1GHP A;  3WRZ A;  4MBK A;  1OTA A;  4Y0U A;  4R23 A;  2J9P A;  1D06 A;  3T4Q A;  4OKP A;  1YMX A;  2V20 A;  2PBD P;  1P97 A;  1S6R A;  3O5Y A;  5CTN A;  1WYB A;  1KDW A;  3S7N A;  4I5S A;  3IF6 C;  1KE0 A;  3D3O A;  2HP6 A;  5L8M A;  3IF6 B;  3FYZ A;  4OQG A;  3V50 A;  4P6B A;  3OOV A;  4HOI A;  1T1A A;  1FCN A;  3H7W A;  2ZQA A;  3QP2 A;  5DKL A;  1W63 M;  3ICY A;  4I3A A;  2H0T A;  1ZHH B;  4KZB A;  3G35 A;  2QJ7 A;  3A3I A;  5DJU A;  3WS1 A;  3FKW A;  2QPN A;  4FH4 A;  3QP8 A;  2B5R A;  4H6J B;  2XLN A;  1PZP A;  3CUE C;  2Z2L B;  2EFU A;  1STZ A;  3M6H A;  3UME A;  3UE1 A;  3R7W A;  3OZH A;  5AVE A;  5L10 A;  2H28 A;  4GW9 A;  1ODV A;  4DKI A;  5FQM A;  3KYQ A;  3VMA A;  1H8Z A;  3SW1 A;  3EGX C;  1M40 A;  4Z9Q A;  2VEA A;  1T19 A;  3CMZ A;  3IS2 A;  1GSW A;  4OPY A;  4LV1 A;  2AVX A;  1NYM A;  1K0K A;  4GD8 A;  2RCX A;  3S7P A;  4DJ3 A;  1K56 A;  1DRM A;  4XT2 B;  3BFE A;  2PDR A;  2WZX A;  2ZQD A;  4Z1W A;  1EWZ A;  2UWX A;  3Q82 A;  5TJJ A;  3S22 A;  3IWO A;  4WEJ A;  1CI9 A;  1S67 L;  1VB6 A;  1U60 A;  3P01 A;  3S7Q A;  1ONG A;  1WA9 A;  2XD5 A;  1HLU P;  3A3J A;  3IF6 A;  5EVE A;  1XP4 A;  3PBO A;  4GHI B;  4HJ3 A;  3MQ0 A;  2ZC4 B;  4DDS A;  3MQQ A;  1E3U A;  3QNB A;  4ZTK A;  3H82 B;  4B9O A;  1PW8 A;  2ZMF A;  2JKR I;  3OC2 A;  1WYC A;  4H6J A;  1MC0 A;  4P6Z M;  5GHX A;  2X01 A;  5CHM A;  2INW A;  3ZNT A;  2FH5 A;  2ZBB A;  3CUE A;  1N9L A;  3Q7Z A;  1NLY A;  3MZF A;  1V9Y A;  1TDG A;  1YT4 A;  5C5K A;  4R3B A;  1NJ4 A;  1PYY A;  3KX0 X;  5CTM A;  3O86 A;  4ZJ1 A;  4EV4 A;  2DMW A;  5CER A;  1ACF A;  5FQQ A;  2XA7 S;  3IXG A;  3MKE A;  3LIE A;  5IHV A;  4QHC A;  4DXB A;  4IUH A;  3PBQ A;  3MQO A;  4QD4 A;  4RVA A;  4CLC C;  1NZO A;  1KE4 A;  4PM7 A;  1SDE A;  1G5U A;  2OWJ A;  4KG6 A;  1ESU A;  4CJN A;  4PM8 A;  2VZW A;  4E04 A;  3MZE A;  3SH7 A;  4LEN A;  1BSG A;  5HDC A;  1TEM A;  4KZ4 A;  5E2G A;  5L09 A;  3NC8 A;  1PFL A;  1Y28 A;  3DTI A;  2OOL A;  4HHD A;  1HZO A;  5EVL A;  3D9Y A;  4GHI A;  1FSW A;  3LYX A;  2FFF B;  4IHQ A;  4I39 A;  5F69 A;  2A24 B;  3ZG7 B;  4CQH A;  2A49 A;  4OVD A;  1OME A;  1J9M A;  4DF6 A;  3C38 A;  3ZG9 B;  3GVB A;  3NY4 A;  3QHY A;  5FI2 A;  3E98 A;  2XGN A;  4X6T A;  4BD0 A;  2Y55 A;  1VET B;  2J3T D;  4DRT A;  1JNU A;  1L2S A;  2W3D A;  2VKS A;  1GHI A;  3QNC A;  1F98 A;  5FEF A;  3UB8 A;  3MS6 A;  5CXW A;  1DJC A;  4PM6 A;  4AFI A;  4DE2 A;  1L0E A;  2A3U A;  2ZOH A;  4PAU A;  4BWI A;  3P09 A;  2V1Z A;  4DXC A;  4KG5 A;  1S4R A;  2K2N A;  1KDS A;  2C6W B;  1YPR A;  3D72 A;  1NRF A;  1UGU A;  1H5X A;  1JWV A;  3VP1 A;  2L4R A;  5J3W A;  1TS7 A;  1AWI A;  3NHQ A;  1SKF A;  1MY8 A;  4EER A;  2HZ5 A;  1I2W A;  4X68 A;  3OPH A;  1Y4O A;  4CLC A;  3VSL A;  1XJ3 A;  3N7W A;  4Y3I A;  5HPF A;  2WKI A;  2J80 A;  2V1A A;  4O7D A;  3IQA A;  1GHM A;  3O88 A;  5HL6 A;  4OPR A;  4K91 A;  1UWP X;  4YNR A;  2OWH A;  3UDX A;  4E3L A;  3FKV A;  3HLF A;  4HJ4 A;  5EVI C;  4IED A;  1H8Y A;  4LLO B;  2A24 A;  5EVI B;  3MXS A;  3HLW A;  2BG1 A;  2IWB A;  5EUA A;  1W8Q A;  4OLD A;  5HSQ A;  4S2O A;  1XXM A;  4Q0J A;  1PI4 A;  5E43 A;  3OPP A;  3ITA A;  4EEP A;  5CX7 A;  3EGD C;  1YAX A;  1BLP A;  3HBR A;  3OPL A;  1GSX A;  5IS1 A;  3S4X A;  3IWI A;  3SOI A;  3CPT B;  3MSH A;  5HFO A;  2XQZ A;  3M6B A;  5KSH A;  3BW6 A;  4EUV A;  5KMW A;  2ZM0 A;  1L0F A;  3TOI A;  4X55 A;  1K55 C;  3C8C A;  3OLO A;  3BEC A;  3I7J A;  1LHY A;  4M4X A;  4HY8 A;  4LV0 A;  2KLI A;  4LGW A;  3PTE A;  4K08 A;  3WS4 A;  1VM1 A;  5A93 A;  4UA6 A;  3LIA A;  4L0L A;  1CEG A;  4JGQ A;  5HAI A;  4X25 A;  1P9R A;  3BWL A;  2XFS A;  4WEK A;  5GHZ A;  4RQ9 A;  4C3Q A;  5FDS A;  4XUX A;  2M7V A;  1ZG6 A;  2JKT M;  4Y13 A;  5DFY A;  3O87 A;  5A90 A;  4BBT A;  3BY8 A;  2W3E A;  5CEB A;  2V8C A;  4P87 A;  1MKI A;  3N8R A;  4WEL A;  2BAS A;  3ITB A;  3LI9 A;  3BFG A;  1TDL A;  4JBF A;  5FQI A;  5J8X A;  1K54 C;  5DKK A;  1PW1 A;  2H10 A;  1VHM A;  2ACG A;  2Y91 A;  4S2P A;  4KZ7 A;  4JGR A;  4MN5 A;  4C75 A;  4A5R A;  5EVI A;  2Y2K A;  4OOL A;  2V0U A;  4Y17 A;  3KYZ A;  1FOF A;  4BJP A;  4ID4 A;  2YKF A;  4KZ8 A;  4GN2 A;  2Y2I A;  3KSF A;  2QZ6 A;  4E6W A;  3JYI A;  1EW0 A;  2Y2J A;  4OP5 A;  1H8M A;  4F3L B;  3CIT A;  3VP0 A;  2PYP A;  3WS5 A;  5E2E A;  4ZRR A;  3FC7 A;  4WZ5 C;  5E2H A;  4NXB A;  5EOO A;  4ZBE A;  2Y2N A;  1K6S A;  3C5A A;  1XGJ A;  5M1A A;  1S4S A;  3ZCZ A;  2JHE A;  1W79 A;  4PM9 A;  1E4D A;  5TGF A;  3V39 A;  4QWO A;  2X71 A;  1K55 A;  2D01 A;  2XDM A;  4EQ1 A;  1W63 Q;  2R78 A;  1FIL A;  3ZYT A;  4QY5 A;  1DP9 A;  4D2O A;  4S2N C;  3GMW A;  3E4Q A;  4HNB A;  2Y2O A;  1K25 A;  4RX3 A;  3CZD A;  5DJT A;  1G28 A;  4PMA A;  4LRZ E;  4EWF A;  3UNW A;  3LR0 A;  2M7U A;  1BLC A;  4M3K A;  4WN5 A;  1BT5 A;  2ZD8 A;  3U4L P;  2P9V B;  3PYP A;  2P08 A;  4GB7 A;  4UQI S;  1K54 A;  1T1B A;  3IS2 B;  1H0M A;  4WBG A;  4LCM A;  3DTM A;  3IBR A;  4HBT A;  1TD5 A;  5HX9 A;  4U3T A;  3PBR A;  4O8G A;  2I72 A;  2XH9 A;  2PT7 A;  5FAO A;  2MJ6 A;  1RP5 A;  4NET A;  4JLF A;  4F3L A;  1YSQ A;  2HDR A;  3MFX A;  4DE3 A;  3UDI A;  3E0Y A;  4L9F A;  4ETX A;  4UQI M;  4WZ5 A;  4HBU A;  4II7 A;  3PBN A;  4BL3 A;  3BY9 A;  2DCF A;  1S1Y A;  1YLP A;  1VEU B;  3GR2 A;  2WYX A;  1DP8 A;  3FV7 A;  2UV0 E;  3B47 A;  3LI8 A;  5HPI A;  3DAV A;  5CGX A;  3UB7 A;  1OT6 A;  3PBS A;  3G30 A;  1YLT A;  3IX3 A;  4E3I A;  3M2K A;  2ZMV A;  2BTF P;  1SCW A;  1LL9 A;  3BLS A;  4IBR A;  4S2N A;  4R4R A;  4N1H A;  3CAX A;  1NLZ A;  4GD6 A;  4CPK A;  1W8Y A;  5FQJ A;  1TVF A;  1YLJ A;  1T18 A;  3MKF A;  5HW3 A;  1BZA A;  3UE0 A;  1I2S A;  1SZV A;  3E2K A;  3GV9 A;  4EW7 A;  1LLB A;  2P9V A;  5G4Z A;  1MKM A;  4FOF A;  1IYP A;  1E25 A;  1FR6 A;  3ZHH A;  4IUK A;  4NEE D;  2WZZ A;  1KGF A;  4R6L A;  4L9G A;  3EWK A;  1ZKJ A;  4I3I A;  3G2Z A;  5EE8 A;  4D60 A;  3CHW P;  5DFX A;  2IWC A;  2L1M A;  4KZ3 A;  4OLG A;  2IA2 A;  1Z6F A;  1ZG4 A;  1XFN A;  1G6A A;  4K0W A;  4JF5 A;  1K38 A;  3GRJ A;  3A3D A;  2L0W A;  1NRJ A;  2Y8H A;  4FD8 A;  1NYY A;  3NCK A;  4R70 A;  4MEZ A;  3WS2 A;  3MR0 A;  4LRY C;  2FFY A;  4LPZ A;  3A0R A;  3S7O A;  5DF9 A;  2W3H A;  1SDN A;  3EQU A;  5FSR A;  1VEU A;  2Y2P A;  4O0P A;  4WZ4 A;  1S66 L;  2PD7 A;  2W3F A;  4BLM A;  2VV8 A;  2G2U A;  2DNS A;  1JWZ A;  4O01 A;  4PKY A;  3S1Y A;  3K3D A;  3ZDJ A;  1P0Z A;  3IF5 A;  2Q9M A;  2G2W A;  4JF6 A;  2WAF A;  5F82 A;  3TG9 A;  4ARZ B;  3A3E A;  3BRM A;  2JKG A;  3A3F A;  4MNR A;  3C2W A;  1TS0 A;  2E8J A;  4MMN A;  3HRE A;  4K0X A;  4JF4 A;  1ESI A;  1P9W A;  2XF3 A;  5LBR A;  1WE4 A;  2EX8 A;  2QYB A;  4MDZ A;  1YQS A;  4NK3 A;  4C6Y A;  2WKH A;  3QP5 A;  3LIC A;  3NJA A;  4QB8 A;  4Q8I A;  2HDQ A;  3KSH A;  4MBF A;  4YIN A;  2OV5 A;  4BL2 A;  2OLV A;  3O3V A;  3NOU C;  3MMH A;  3DTK A;  2RL3 A;  1XJ6 A;  5EEC A;  3ZQ5 A;  3RXW A;  3BEB A;  4R1G A;  3PHY A;  4CLC B;  3IXD A;  4GS9 B;  4XXR A;  1Z09 A;  4HP9 A;  1SHV A;  3V5M A;  5G18 A;  5FI6 A;  2HJE A;  4CLC E;  1PWC A;  2B95 A;  3NEC A;  1Y54 A;  4DE0 A;  1LL8 A;  1D7E A;  2XA7 M;  4UA7 A;  3C30 A;  5AVF A;  3CI6 A;  3B3X A;  2V1B A;  2VJW A;  1BYW A;  1YM1 A;  4KZ5 A;  2GX5 A;  3SS5 A;  2A2L A;  5GLA A;  4N9K A;  5HWV A;  3K3C A;  4HH3 A;  4Y0T A;  4ARZ A;  2PHY A;  5A8B A;  4DN0 A;  3NDE A;  3EOI A;  3AGF A;  2VGL S;  2Y2L A;  2ZQ7 A;  3P7N A;  2Y79 A;  1PWG A;  3RTY A;  4R4S A;  1O07 A;  4EBP A;  3IXH A;  4G3V A;  2QWS A;  1ERQ A;  1FCM A;  3IH9 A;  1F9I A;  3LCE A;  1DJA A;  2DRW A;  3SH9 A;  4WMC D;  4EBN A;  3V3S A;  5HAR A;  3T1X A;  1IOU A;  2J3T C;  4EXO A;  1KVM A;  2ZC5 B;  3UPO A;  4JPM A;  5EM1 A;  5TR7 A;  1XJ2 A;  2JC7 A;  1XJ4 A;  3TSG A;  3DWK A;  1N4O A;  4WLA A;  2VGL M;  4EEU A;  2J9O A;  5J4E A;  1W7F A;  3P98 A;  4GS9 A;  3T1S A;  2PYR A;  3F1N A;  4JGO A;  3W4Q A;  3EQV A;  5GL9 A;  4DJ2 A;  2Y2H A;  5EVI D;  2W3G A;  1IEL A;  3SZT A;  3DBA A;  2QHK A;  4KQD A;  2GNX A;  1KGE A;  4P85 A;  2JKT I;  2W1T B;  2Y2Q A;  4IVK A;  4HQA A;  1IYO A;  5EFW A;  4R3A A;  1YLW A;  3UB6 A;  1PNE A;  2P7J A;  3KSG A;  4UA9 A;  2V9A A;  3H9W A;  2J8Y A;  3G34 A;  3AGE A;  3ZVW A;  2KX6 A;  4GNU A;  1KGG A;  1G6O A;  2VGK A;  1CEF A;  4B88 A;  2EA9 A;  3G2Y A;  3SS3 A;  2HP9 A;  2B02 A;  4GZB A;  3GSG A;  5HZH A;  2NUP C;  3C7U A;  2EX2 A;  3HUO A;  2HP5 A;  5FL3 A;  4X1M A;  4KUO A;  2HF6 A;  1ERM A;  3HLG A;  1KOU A;  1OTE A;  2V0W A;  2EXB A;  3IX4 A;  1UWN X;  5FEG A;  2W0N A;  5DF8 A;  1ES5 A;  2ZM8 A;  1F2K A;  4LFU A;  1L0G A;  4PKY G;  3VOL A;  4KZA A;  1MBL A;  2VV7 A;  3G4P A;  5F5Y A;  4YFM A;  4YOF A;  1QME A;  5FAP A;  3JVV A;  3HLC A;  3MJQ A;  5L07 A;  5TBM B;  4MBH A;  3JPU A;  2Y2G A;  3ZFZ A;  4EET B;  3IHB A;  3W4O A;  2W27 A;  3B33 A;  4PHT A;  3G32 A;  3C4P A;  3TE8 A;  4ZDX A;  3UN7 A;  3UY6 A;  2Y4A A;  3KSI A;  1FSY A;  2EXA A;  3LUQ A;  2W1T A;  3VP2 A;  1PZO A;  3CG5 A;  3OPR A;  3A0V A;  3HVF A;  1PIO A;  3VE3 A;  2Z2M B;  1OT9 A;  1XA1 A;  3R4K A;  4ETZ A;  4EBL A;  5M18 A;  3CJM A;  1PRQ A;  3M2J A;  3LIB A;  5DTK A;  4MLL A;  4FUW A;  2XFT A;  5HD3 A;  3T12 B;  3L7H A;  5FQ9 A;  4JXV A;  2PAV P;  2LB9 A;  3CWF A;  2PR6 A;  2WK0 A;  4KQR A;  5HAP A;  5M19 A;  1OJ5 A;  1RGZ A;  4EQI A;  2O0Y A;  3HJK A;  1TS6 A;  5MC7 A;  4X1L A;  3N4I A;  3LO7 A;  3FG8 A;  3T4O A;  1LI0 A;  4OPZ A;  3FPW A;  5D3O A;  5CHJ A;  3HUN A;  2ZJ9 A;  3AGD A;  3N6I A;  4ME4 A;  4QPR A;  3UB9 A;  1DP6 A;  4Y0O A;  3UPP A;  2VGJ A;  4ZJ3 A;  2XD1 A;  4HEF A;  4FCF A;  1ZC2 A;  3A0S A;  4OQI A;  5CEC A;  2QJ5 A;  3N8L A;  5CGW A;  2R9X A;  1BUE A;  1DY6 A;  4KZ9 A;  5TBM A;  4Q0I A;  1G68 A;  1XGI A;  2WKP A;  1YLY A;  5K5B A;  2ZQ9 A;  3TJZ C;  4WYY A;  4F94 A;  4BEN A;  2XR0 A;  2ZL1 A;  4WM9 A;  4S2M A;  1K56 D;  1ES2 A;  4ZJ2 A;  4MN7 A;  3BQ8 A;  5GHY A;  4RYE A;  1XX2 A;  1IEM A;  5I5L A;  4OQ0 A;  1T1C A;  1C3B A;  4GDB A;  3NOT C;  3W8K A;  2JCH A;  3UDF A;  4OOM A;  1SKO B;  5AQ7 A;  3L9K A;  4E3N A;  3OCN A;  1BTL A;  3WWX A;  4U0T A;  3HJI A;  3QP6 A;  1TF1 A;  2K31 A;  3PBT A;  4S2K A;  1E3U D;  3LY4 A;  4NXG A;  4OPQ A;  5F83 A;  4R3J A;  1Q2P A;  4E3M A;  4DDY A;  1N9O A;  4Y5F A;  2O9C A;  1LSX A;  4GKU A;  4JXS A;  2YKH A;  5KIZ A;  4U0X A;  4KQQ A;  1RGY A;  2GJ3 A;  4OP8 A;  3BYD A;  1XA7 A;  4WF0 A;  4FSF A;  4UAA A;  4X56 A;  3NOP C;  3HUM A;  3T50 A;  1JWP A;  2HPB A;  1BLH A;  5IT5 A;  4MCW A;  2ZM2 A;  2JBF A;  5F1F A;  2XEP A;  1FR1 A;  4S2J A;  5CHU A;  3N8S A;  1OTB A;  1CQA A;  1FCO A;  1FQG A;  4YWZ A;  3IX8 A;  5HD5 A;  5F6A A;  1IKG A;  2XRN A;  4G3K A;  2H5S A;  3RH8 B;  3ZVT A;  4S2I A;  3U2A A;  1MWT A;  5AQA A;  1N9B A;  5GLB A;  4EES A;  1ES4 A;  5G4Y A;  3E2L A;  1JTD A;  2FZ0 A;  4LV2 A;  3HCY A;  4LV3 A;  3W4P A;  1IKI A;  3EEH A;  5FA7 A;  1A0K A;  1SKO A;  4QY6 A;  3VFF A;  2WGI A;  3F1P B;  5A91 A;  1MPL A;  4JXG A;  2WKR A;  3TW8 A;  3HL9 A;  2Q9N A;  1CK3 A;  4N92 A;  1O7E A;  4QJG A;  2G7U A;  2WKE A;  2ZOI A;  1MZU A;  1NY0 A;  1K57 C;  2V8F A;  1RCJ A;  4R0Q A;  3MXR A;  3ZG0 A;  3ULF A;  4R38 A;  2B18 A;  3BQA A;  4FTX A;  2IWD A;  2X02 A;  5AQB A;  3KO6 A;  4P6Z S;  5BOH A;  3T4T A;  1H3Q A;  5F1G A;  1ZTU A;  4RX2 A;  2HV1 A;  3G6O A;  2CMN A;  4IJG A;  4N9L A;  3VP3 A;  1D1J A;  4N1X A;  2ZC3 B;  3GDI A;  5CED A;  1J3W A;  4KUK A;  3NIA A;  3IHA A;  3BFD A;  5HAQ A;  2WUQ A;  3C7V A;  3QP1 A;  4MN6 A;  1KE3 A;  5KSC A;  2BLS A;  3T1Q B;  1I5Q A;  1MXO A;  4PPR A;  1IFQ A;  1CI8 A;  5J7E A;  4LCL A;  3VE4 A;  5EPH A;  2OLU A;  1GA9 A;  2GDN A;  3GEC A;  1YLZ A;  4I3J A;  2Z6D A;  3DWZ A;  1LI9 A;  4P0M A;  3ZNY A;  3HLB A;  3K2N A;  4E6X A;  2ZMA A;  2Y59 A;  5DVA A;  3ZGA B;  1CJF A;  4QU3 A;  5F68 A;  3Q7V B;  1LSW A;  3BLM A;  5DTS A;  4I38 A;  4CLC D;  5A92 A;  5AQ9 A;  3IT9 A;  2VA0 A;  4XUZ A;  3F1O B;  3MFD A;  5FQK A;  5JYO A;  4Q0H A;  3F1P A;  2OAP 1;  1K4F A;  3BFC A;  1N9N A;  3F1N B;  4JGP A;  2JKF A;  1NXY A;  4NKP A;  3PAG A;  3FWL A;  2M1C A;  4GJ4 A;  1YSP A;  3VP4 A;  4DMZ A;  1MWS A;  3VFH A;  5L2F A;  5KZH A;  3RFB A;  4XT2 A;  1HD8 A;  5EOE A;  4E3K A;  1DJB A;  4EU0 A;  4GCZ A;  2PU2 A;  1K57 A;  4Y2F A;  3LY3 A;  3LIF A;  2OSU A;  3G31 A;  2VX8 A;  3NUL A;  3LFV A;  2VLG A;  1MWU A;  2VK3 A;  4Y15 A;  4BMW A;  2JKR M;  3Q1F A;  3NBL A;  1BUL A;  4FH2 A;  2WGW B;  3UPN A;  1Q2Q A;  2XSS A;  3C4O A;  3BJN A;  4RA7 A;  1M6K A;  4E3J A;  3IBJ A;  3DTE A;  3HLD A;  5TFQ A;  3HLE A;  3T4K A;  5CRF A;  4GOG A;  3H82 A;  4OH0 A;  1S0W A; 
#chains in the Genus database with same CATH homology
 2VV7 A;  1WA9 A;  3IBR A;  5F5Y A;  3E4P A;  4YOF A;  1OTI A;  1TD5 A;  3JVV A;  3MJQ A;  3PBO A;  4GHI B;  5TBM B;  4HJ3 A;  3MQ0 A;  3PBR A;  2D02 A;  4O8G A;  3MQQ A;  4EET B;  2W27 A;  3B33 A;  4HIA A;  4PHT A;  2PT7 A;  2MJ6 A;  3TE8 A;  3LR5 A;  4G3W A;  4F3L A;  2NUT C;  3KSI A;  1YSQ A;  3MFX A;  3H82 B;  3W2Z A;  3LUQ A;  2W1T A;  3F1O A;  4B9O A;  3A0V A;  3VE3 A;  2ZMF A;  2JKR I;  2P04 A;  3E0Y A;  1OT9 A;  4HI4 A;  4L9F A;  4ETX A;  3OC2 A;  4H6J A;  4UQI M;  3R4K A;  1MC0 A;  4II7 A;  4ETZ A;  4P6Z M;  3PBN A;  3BY9 A;  3LIB A;  5HDS A;  1S1Y A;  2INW A;  5HD3 A;  2FH5 A;  2ZBB A;  1DP8 A;  3CUE A;  1N9L A;  3UE3 A;  3LI8 A;  3B47 A;  2LB9 A;  3CWF A;  2PR6 A;  3UE6 A;  2VV6 A;  3PXP A;  1NLY A;  5HPI A;  3E4O A;  4UEY A;  3UB7 A;  1OJ5 A;  1V9Y A;  5C5K A;  1OT6 A;  3PBS A;  1OPX A;  4HP4 A;  3KX0 X;  2O0Y A;  3HJK A;  4B93 A;  2DMW A;  1TS6 A;  2ZMV A;  5MC7 A;  3UMD A;  3T4L A;  4HH2 A;  2XA7 S;  1S1Z A;  3LIE A;  3CAX A;  3FG8 A;  4IUH A;  3PBQ A;  1NLZ A;  3MQO A;  3T4O A;  1V9Z A;  3FPW A;  4CLC C;  1T18 A;  1GSV A;  2OWJ A;  3LR3 A;  4BBU A;  4ME4 A;  4QPR A;  3UB9 A;  1DP6 A;  4EW7 A;  2O9B A;  2VZW A;  4E04 A;  5G4Z A;  1OTD A;  1MKM A;  4FOF A;  5AJG A;  5HDC A;  4IUK A;  3A0S A;  3B42 A;  4NEE D;  2QJ5 A;  1Y28 A;  4R6L A;  3PR6 A;  2OOL A;  4HHD A;  4L9G A;  3EWK A;  4GHI A;  2KDK A;  5TBM A;  4I3I A;  4Q0I A;  3LYX A;  4IHQ A;  4I39 A;  5F69 A;  2A24 B;  2WKP A;  1OJG A;  4CQH A;  2Z6C A;  5K5B A;  3TJZ C;  5DFX A;  2L1M A;  3C38 A;  5IU1 A;  3MXQ A;  2IA2 A;  1X0O A;  1XFN A;  3E98 A;  2O9A A;  3LR4 A;  4LRX C;  4MN7 A;  2QKP A;  3BQ8 A;  2L0W A;  1NRJ A;  2J3T D;  2Y8H A;  5I5L A;  4R70 A;  1JNU A;  3MR0 A;  2W3D A;  4L9E A;  4LRY C;  4LPZ A;  1T1C A;  2VKS A;  3A0R A;  3S7O A;  3NOT C;  5DF9 A;  2W3H A;  3EQU A;  1F98 A;  4OOM A;  2K7S A;  4O0P A;  1S66 L;  2PD7 A;  2W3F A;  3MF0 A;  3OCN A;  2VV8 A;  4GLQ A;  3UB8 A;  3OBF A;  3HJI A;  4O01 A;  4PKY A;  1TF1 A;  2LB5 A;  3K3D A;  4NXE A;  2K31 A;  4AFI A;  1P0Z A;  3PBT A;  3OCL A;  2ZOH A;  4PAU A;  2XRO A;  4BWI A;  4WUJ A;  4NXG A;  4ARZ B;  2JN7 A;  1S4R A;  2K2N A;  1N9O A;  4Y5F A;  3C2W A;  3T4S A;  3D72 A;  1UGU A;  2O9C A;  1LSX A;  2YKH A;  3T4J A;  5KIZ A;  1TS0 A;  2L4R A;  5J3W A;  1TS7 A;  3NHQ A;  4MMN A;  2GJ3 A;  1XFQ A;  4WF0 A;  1P9W A;  4FSF A;  5LBR A;  4EER A;  2QYB A;  4MDZ A;  3CLO A;  3NOP C;  3T50 A;  4CLC A;  1LT0 A;  1XJ3 A;  2WKQ A;  4Y3I A;  5HPF A;  1LSV A;  2J80 A;  3LIC A;  5IT5 A;  4MCW A;  2V1A A;  5HL6 A;  3NJA A;  2J3W A;  3KSH A;  5HWW A;  1UWP X;  4YNR A;  2OWH A;  1OTB A;  1YKD A;  4HJ4 A;  2OAQ 1;  3NOU C;  4NXF A;  4YWZ A;  3MMH A;  2HGV A;  4LLO B;  5HD5 A;  2A24 A;  5F6A A;  1XJ6 A;  3ZQ5 A;  2XRN A;  4G3K A;  3RH8 B;  3PHY A;  4HJ6 A;  5HSQ A;  4CLC B;  3JVU A;  4Q0J A;  4GS9 B;  3U2A A;  4HP9 A;  3H7W B;  5HWT A;  1F5M A;  2HJE A;  4CLC E;  2EWW A;  4EES A;  5G4Y A;  2GZA A;  4EEP A;  5CX7 A;  2EWV A;  3EGD C;  1YAX A;  2FZ0 A;  3HCY A;  3VV4 A;  2I9V A;  3EEH A;  1GSX A;  1LL8 A;  5IS1 A;  1D7E A;  3EEA A;  2XA7 M;  3C30 A;  5AVF A;  3F1P B;  2PR5 A;  3CI6 A;  5KSH A;  2V1B A;  3BW6 A;  1TS8 A;  2WKR A;  4KQO A;  2VJW A;  3TW8 A;  4EUV A;  1NWZ A;  1BYW A;  2GX5 A;  4BBV A;  3C8C A;  3OLO A;  2PD8 A;  2A2L A;  3LID A;  3TRC A;  3R7W B;  2G7U A;  2ZOI A;  5HWV A;  3K3C A;  4M4X A;  1MZU A;  2W1R A;  4HH3 A;  4HY8 A;  2KLI A;  2KOI A;  2PHY A;  4ARZ A;  4K08 A;  3FPV A;  2O99 A;  5A8B A;  3ULF A;  4R38 A;  4DN0 A;  2B18 A;  3BQA A;  3LIA A;  3EOI A;  4L0L A;  4WL9 A;  3V67 A;  2VGL S;  5HDD A;  4JGQ A;  3KO6 A;  1P9R A;  3P7N A;  3BWL A;  2Y79 A;  4P6Z S;  4WEK A;  2HJ9 C;  4RQ9 A;  3T4T A;  2M7V A;  1H3Q A;  1ZTU A;  2JKT M;  3RTY A;  1OTA A;  5DFY A;  4G3V A;  2HV1 A;  2QWS A;  3G6O A;  1D06 A;  4BBT A;  3BY8 A;  1F9I A;  2W3E A;  3T4Q A;  2CMN A;  4IJG A;  1IOU A;  4WEL A;  2J3T C;  3GDI A;  2BAS A;  4EXO A;  3LI9 A;  4KUK A;  1P97 A;  5DKK A;  3O5Y A;  4MN6 A;  1XJ2 A;  1XJ4 A;  1VHM A;  3S7N A;  1IFQ A;  4I5S A;  4JGR A;  5J7E A;  4MN5 A;  3D3O A;  4WLA A;  3VE4 A;  2VGL M;  4OOL A;  5L8M A;  4EEU A;  2V0U A;  5J4E A;  3GEC A;  3KYZ A;  4I3J A;  4GS9 A;  2PYR A;  2Z6D A;  3F1N A;  3OOV A;  4JGO A;  4BJP A;  4HOI A;  1T1A A;  3EQV A;  2YKF A;  3H7W A;  4DJ2 A;  3KSF A;  3K2N A;  5DKL A;  1W63 M;  3ICY A;  4I3A A;  1EW0 A;  1H8M A;  2W3G A;  1ZHH B;  5F68 A;  1LSW A;  3DBA A;  2QHK A;  4I38 A;  2QJ7 A;  4CLC D;  4F3L B;  3CIT A;  5DJU A;  4KQD A;  2GNX A;  2PYP A;  2JKT I;  4ZRR A;  2VA0 A;  3FC7 A;  2W1T B;  3F1O B;  4HQA A;  4NXB A;  5EFW A;  4R3A A;  4H6J B;  4Q0H A;  3F1P A;  2OAP 1;  1N9N A;  3CUE C;  3F1N B;  4JGP A;  3UB6 A;  1S4S A;  2P7J A;  3KSG A;  2JHE A;  4NKP A;  1STZ A;  2V9A A;  3H9W A;  3UME A;  2M1C A;  3R7W A;  4GJ4 A;  5AVE A;  1YSP A;  4DMZ A;  3RFB A;  2KX6 A;  4XT2 A;  2H28 A;  4GW9 A;  2D01 A;  4EQ1 A;  1ODV A;  4EU0 A;  1G6O A;  3KYQ A;  4GCZ A;  1W63 Q;  4Y2F A;  2R78 A;  3SW1 A;  3EGX C;  3ZYT A;  2EA9 A;  3LIF A;  2VEA A;  2B02 A;  1DP9 A;  2VX8 A;  3E4Q A;  4HNB A;  1T19 A;  3IS2 A;  2VLG A;  3LFV A;  1GSW A;  2NUP C;  5HZH A;  5DJT A;  4BMW A;  2JKR M;  1G28 A;  4LRZ E;  5FL3 A;  3S7P A;  4DJ3 A;  4KUO A;  2HF6 A;  1DRM A;  2XSS A;  3LR0 A;  3BJN A;  2M7U A;  4XT2 B;  2PDR A;  4WN5 A;  1KOU A;  1OTE A;  2V0W A;  3IBJ A;  4Z1W A;  1UWN X;  2W0N A;  3T4K A;  3PYP A;  2P08 A;  4UQI S;  5TJJ A;  4PKY G;  4WEJ A;  3H82 A;  1S67 L;  3VOL A;  1T1B A;  3IS2 B;  1VB6 A;  3P01 A;  3S7Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...