2J3WA

The crystal structure of the bet3-trs31-sedlin complex.
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
142
structure length
142
Chain Sequence
LEMSGSFYFVIVGHHDNPVFEMEFLPPGKAESKDDHRHLNQFIAHAALDLVDENMWLSNNMYLKTVDKFNEWFVSAFVTAGHMRFIMLHDVRQEDGIKNFFTDVYDLYIKFAMNPFYEPNSPIRSSAFDRKVQFLGKKHLLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport
molecule keywords TRAFFICKING PROTEIN PARTICLE COMPLEX PROTEIN 2
publication title The Architecture of the Multisubunit Trapp I Complex Suggests a Model for Vesicle Tethering.
pubmed doi rcsb
source organism Mus musculus
total genus 41
structure length 142
sequence length 142
chains with identical sequence C
ec nomenclature
pdb deposition date 2006-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04628 Sedlin_N Sedlin, N-terminal conserved region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.70 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2j3wA00
3PR6A 3CUEC 2J3WA 2ZMVA 3CUEA 1H3QA 2J3TD 2J3TC
chains in the Genus database with same CATH superfamily
3PR6A 4B88A 2V20A 4MN5A 2W3EA 2PR6A 2FFFB 3TSGA 4EBNA 1PW8A 3MZFA 1KVLA 1ERMA 2XEPA 4OP5A 4S2PA 1WYCA 1OJ5A 1NRJA 2INWA 2VK3A 4E04A 2Y2LA 3V39A 1PYYA 4UEYA 1T1AA 3NI9A 1Y4OA 3SH9A 3FKVA 3O86A 1MC0A 2Y79A 3PYPA 3TE8A 5GHXA 1HVBA 1S0WA 2RL3A 3T4OA 2PU4A 3IS2B 1O07A 2V1ZA 3G6OA 4PPRA 3S4XA 4DRTA 4O7DA 3SH7A 2QWSA 2VEAA 1NRFA 1YLPA 3G30A 1EWZA 5TGFA 3G4PA 3LIAA 2JC7A 1AXBA 4DE0A 3JVUA 4ZJ1A 4HH3A 3UDIA 1JNUA 4E6WA 5F82A 4IJGA 1DRMA 3EOIA 3GR2A 3MR0A 4Z9QA 4U0XA 2XA7M 4NXFA 4M4XA 3MKEA 2OAP1 2EX2A 3N7WA 1EW0A 3HCYA 2LB9A 4ID4A 1X0OA 3BW6A 3LR0A 2HDSA 4S2LA 3IHAA 3UB5P 4O8GA 3BQ8A 5E2HA 2C6WB 1WA9A 1H5XA 4PHTA 2QZ6A 4HBTA 5L07A 4DE2A 3K3CA 3FC7A 3AGEA 4E3MA 1G28A 4KZAA 5HDCA 5JYOA 2VGKA 1N9BA 1VQQA 2V8FA 1K55C 4S2NC 1H8YA 4JGQA 5HAPA 5IS1A 2J3TD 4L9GA 1F9IA 5DKLA 2EXBA 1FCNA 3OPLA 3PBQA 3JPUA 3N8RA 2J9PA 5A92A 3MZEA 1DP9A 1PWCA 4H6JB 3HBRA 4S2OA 4EQIA 4E3JA 5GLBA 1K57C 1XFQA 2WKPA 1KVMA 3PBSA 1WE4A 3K2NA 3DTEA 5HDSA 2A24A 1M40A 5E43A 1G6OA 1F5MA 2M7VA 2ZL1A 4U3TA 3ZG0A 2Q9NA 3K3DA 2XRNA 3NC8A 3ZVWA 2ZQAA 3D9YA 3MBZA 3MFXA 3FYZA 3C5AA 3DW0A 1W8YA 1J9MA 2GJ3A 3CJMA 1BULA 3PBNA 3NHQA 1CI9A 2AVXA 4I3AA 1MPLA 4HESA 3ZQ5A 5AVFA 1T18A 1UWNX 3MZDA 1RGYA 4Q0JA 4JGPA 1WYBA 5TBMA 3TRCA 2ZC4B 4B4XA 2ZQDA 2JKTI 4S2JA 2ZC6B 1DJCA 3CPTB 1FR1A 2OAQ1 1YLJA 1VETA 1YLTA 3LI8A 2YKHA 1BYWA 3F1NB 3UE1A 2HZ5A 1TDGA 3W4OA 3B42A 3CMZA 2ZQCA 3OBFA 1I5QA 3LFVA 1W63Q 4DMZA 3HLWA 3S7OA 2HP6A 2Y91A 4HBUA 2VZWA 3E98A 1MWRA 4DDYA 3BWLA 1LSVA 3FWLA 2PHYA 5KZHA 3LGOA 3HLGA 1L0DA 1BTLA 4YFMA 4O0PA 1RGZA 4LCLA 3UPPA 4YWZA 3UMDA 1JWVA 2O9AA 4P87A 4QD4A 4EXOA 5E2EA 1PIOA 3AGDA 3P09A 5IT5A 3T4KA 3BLSA 3JVVA 1KOUA 2XGNA 2DRWA 1JTGA 3S1YA 1L0EA 3IXGA 3IHBA 1YLZA 2XLNA 3ULFA 3GRJA 4XUXA 5FAQA 3HUOA 5TJJA 3F1OA 3IBJA 1K55A 4S2NA 2OV5A 4R4SA 5D3OA 2UWXA 2XFSA 5CHJA 1VEUB 4JXSA 1BLHA 4K0WA 5G4ZA 3VOYA 1EROA 4WLAA 2OLUA 1BZAA 5J7EA 4HNBA 3LO7A 5DF7A 1K57A 3ZG5A 1DJAA 1I2SA 5EVIB 4UQIM 2ZD8A 2G7UA 1OTIA 4UA6A 1Y28A 4XT2A 2Y55A 5GHZA 3FZCA 4GLQA 4C75A 3UDFA 5JYPA 4LV1A 3S7NA 4XUZA 1PZPA 2I9VA 4GNUA 2R9WA 1G6AA 3BQAA 3V5MA 2JHEA 4P0MA 4PM5A 3WRZA 4LPZA 3LEQA 5CGXA 4GD8A 1XP4A 2WKEA 1ONHA 4EETB 2XD1A 3HLCA 4MCWA 5FAOA 3G32A 4WM9A 3ISGA 2VV8A 4JF6A 3BM6A 2ZMAA 1A0KA 3BEBA 4N1XA 4ARZB 2XDMA 2V2FF 2XH9A 4KZBA 4KZ8A 3TG9A 3ZNYA 3BRMA 1FQGA 2JKFA 3V3RA 4ESPA 4UA7A 1L3LA 3RXWA 1BT5A 4IBRA 3AGFA 3TW8A 4ETZA 3IWOA 4EQ1A 3LICA 3LYXA 3LUQA 4NXEA 4QU3A 3WWXA 1FIKA 1K56D 4OPRA 4PM7A 3OPHA 1MXOA 2JCHA 2Z2LB 1MWSA 3MXSA 1LI0A 4PM9A 3BFEA 3I7JA 5MC7A 3CHWP 2Y2GA 4R3JA 1IYSA 1K56A 1S4RA 2WGWA 3NOPC 1IYOA 5HX9A 2Y59A 3WS4A 4R1GA 1KGFA 3IF5A 4WZ4A 3UB9A 5F1FA 3PXPA 2X01A 2C5WB 4KG6A 4I3JA 4BENA 4OOMA 3LIBA 3EEHA 3VP2A 1GA0A 2WZZA 1ZKJA 4YOFA 3A0SA 1GA9A 2P74A 5CECA 1O7EA 3W4QA 3QNCA 5HDDA 2ZJ9A 3WS5A 5TFQA 5EVLA 1IEMA 2PBYA 1FSWA 2RCXA 1SDNA 3TOIA 4P6BA 1PI4A 2LB5A 4R23A 4X1LA 1LHYA 4HOIA 2Y2JA 3VE3A 4WYYA 1KDSA 1TVFA 4BLMA 4Y0TA 2BG1A 2OWHA 5EM1A 4E3KA 5K5BA 3KYZA 1DP6A 5KMWA 3U4LP 2Y2HA 3QP6A 5J4EA 4B9OA 4CQHA 3LIEA 1MKIA 1YMSA 1LL5A 4IVKA 1XJ3A 1FILA 4BJPA 3T4TA 1N9NA 1TD5A 3A3JA 2Y2PA 3CI6A 5FI2A 3MJQA 3R4KA 5EUAA 2B5RA 2PRFA 3MMHA 2L0WA 1YMXA 2GZAA 3H82A 3T1SA 3IXHA 3MKFA 2L1MA 4KZ5A 5DFXA 4JXWA 4LRYC 4CLCE 2V0UA 5HD5A 4FH4A 1NLZA 5E2GA 1MKMA 2ZM2A 4LENA 3HLEA 4S2KA 4GZBA 3F1PA 4P6ZS 1GCEA 2L4RA 3UE6A 3QHYA 5HWVA 2WGIA 4HP4A 3GDIA 4P85A 3IF6B 1KE3A 5F83A 4GS9A 1IFQA 3ITAA 3V67A 3L9KA 4I5SA 4DE3A 3EEAA 3LI9A 3LY4A 2Z6DA 3PBOA 1NJ4A 2J9OA 4ZDXA 2XD5A 3PTEA 5DTKA 1FOFA 3R7WA 3NECA 2KDKA 4GJ4A 5HAIA 1W8QA 4JLFA 2QPNA 2PD8A 4BBTA 2YKFA 3LIDA 2BASA 4UA9A 3GSGA 3NDGA 1MWUA 1TS8A 4F3LA 2V0WA 3ZG7B 5F1GA 3HVFA 4DJ3A 1BLCA 1STZA 3W8KA 4NK3A 3A3FA 3MQ0A 4KQRA 1NLYA 2JE5A 4OPZA 4IHQA 3OC2A 5FSRA 2VKSA 4X68A 1CJFA 4OQ0A 5DJTA 4RX2A 3DTKA 3OPRA 3HLFA 2K7SA 2VV6A 3A3DA 3VE4A 5FQ9A 2A24B 1N4OA 1K25A 3UB6A 2M1CA 2Q9MA 3IQAA 5HL6A 4MNRA 5EECA 1P97A 2X02A 1VB6A 3BFCA 1L0GA 1OJGA 4N9LA 3PBRA 4H8RA 2VJWA 5FA7A 4JGOA 5HWWA 5L8MA 4GDBA 2QKPA 3MFDA 3RFBA 3VOLA 2J80A 3UB7A 2MJ6A 2WADA 3BJNA 2Y2QA 4WF0A 5EM0A 5CGSA 1E4DA 2EWVA 3ZDJA 5TBMB 3BFDA 1HD8A 4PM6A 4OLDA 1MWTA 2FZ0A 1IOUA 5DTTA 1VETB 1P9WA 3PBTA 3GQZA 2VGJA 1TS0A 5HSQA 3FKWA 1XX2A 2XR0A 2PT7A 1F2KA 1YT4A 5FEFA 2EX9A 4BD0A 2KX6A 1H8ZA 1V9ZA 5F6AA 4GHIB 2VLGA 1S4SA 2PU2A 4X53A 3HJIA 1V9YA 5HARA 3S7QA 3NJAA 3KYEA 1H0MA 1IYQA 2W1RA 5CRFA 3SZTA 1ZC2A 2ZC5B 1OPXA 4I3IA 4BL2A 5FEGA 3GVBA 4ZTKA 1YM1A 3P98A 4PKYG 5AQ7A 4B4ZA 2A49A 4OQGA 3BYDA 3T12B 2Q0OA 4IBXA 3T4JA 3ZNTA 2OOLA 2ZQ8A 3T4QA 5FL3A 2HDRA 1ERQA 1XGJA 2DCFA 3IX4A 3QP2A 1TF1A 3MXQA 4R0QA 2XQZA 4EEPA 2HJ9C 1T1BA 4X55A 3H7WA 3VSLA 5M1AA 5EPHA 3MSHA 2IWDA 3LR5A 3IBRA 3DWZA 4QHCA 1NYYA 3P7NA 3RXXA 1ALQA 1S66L 2ZC7A 4DF6A 5F5YA 2ACGA 3UPNA 1SZVA 4YNRA 3B33A 4XT2B 4CJNA 2PBDP 5AQAA 2VGLS 3Q82A 4Y7PA 4L9FA 2CC1A 1ZG4A 2PYRA 2ZC3B 4MN6A 4PM8A 5HAQA 4HIAA 2P9VA 3PHYA 2G2WA 3RTYA 4OPQA 4R38A 3Q81A 5FQIA 1T1CA 2GNXA 1PW1A 1SCWA 4DXBA 4Q0IA 1XA7A 2E8JA 2D02A 4X69A 4X1MA 4R70A 2PDRA 3GTCA 4EV4A 3RJUA 4IUKA 1BLSA 1XPBA 5EE8A 4OKPA 2HPBA 1SKOB 1TS7A 3IH8A 4E3OA 1H8MA 4EEUA 2XFTA 2EWWA 1LI9A 1XGIA 4LGWA 2PD7A 1OTAA 2XA7S 2R9XA 3UE3A 4MDZA 4EUZA 3BFFA 3HUMA 3OPPA 3MS6A 1GHPA 1K4FA 4GOGA 1PNEA 3C4PA 4MLLA 1ES2A 2J7VA 3IX3A 3EQVA 4Y13A 1QMEA 2X71A 2J3WA 4KZ7A 4EERA 1D7EA 4C6YA 4JF4A 3UDXA 1HZOA 2HJEA 2ZOHA 3UNWA 3G35A 4JXGA 1YPRA 1BLPA 4CLCC 3OOVA 2H0YA 2ZLYA 1XKZA 5HW3A 2I72A 2IWBA 2NUPC 5DF9A 3VP1A 2WGWB 1YLWA 3BFGA 1VM1A 2V9AA 2ZBBA 3DTIA 1YSQA 3IWQA 5GLAA 1JWPA 2QJ7A 2PR5A 4DN0A 5HFOA 2NUTC 1GSVA 3T1QB 3C4OA 3Q07A 5AVEA 5A93A 4DKIA 3MXRA 3C2WA 2HF6A 1DY6A 5IHVA 4GN2A 4HJ4A 3A3IA 2W1TA 4WZ5C 5A90A 3A0VA 1ONGA 3IT9A 4JF5A 1OTDA 3UB8A 1FCMA 4QY6A 3E0YA 3IX8A 1XXMA 1W5DA 3VFFA 1ES3A 1OTBA 2Y2MA 4FD8A 3BY8A 5KSHA 4G3WA 5BOHA 1PFLA 3OCNA 1K6RA 3SH8A 2A3UA 1NZUA 1GHMA 2WKRA 3IH9A 1XJ2A 1LSXA 2W3FA 4ZBEA 3BECA 4FUWA 3HUNA 3CITA 4Q0HA 3IWIA 4QJGA 1IYPA 4KENB 3ZHHA 2KOIA 2ZMFA 3T4LA 3IF6C 4BQMA 2IWCA 1CF0A 3LCEA 4EBPA 3GV9A 3V3SA 2Y2KA 2QYBA 1MZUA 3EWKA 4GW9A 4HHDA 5J3WA 1OT9A 2WAEA 2IA2A 5M18A 5LBRA 2VV7A 3C38A 5EOEA 3H82B 3VP3A 4LRXC 4JXVA 3S7PA 5DJUA 1GHIA 2O9BA 4OH0A 2WYXA 4D2OA 4CLCD 4L9EA 4HP9A 2JKRM 1DP8A 4NG2A 3Q7VA 4UAAA 3SS5A 4FSFA 1IELA 5HD3A 1L2SA 2H10A 3F1PB 3OZHA 3M2JA 3VV4A 1LLBA 3KSGA 1NY0A 4GS9B 4YINA 4Y2FA 4CLCA 3Q1FA 1CEGA 5I5LA 4KUKA 1YLYA 1LL8A 3QP4A 3T1RA 1H3QA 4G3VA 3C30A 4UHUA 3R7WB 2XSSA 4HH2A 1IKGA 4C3QA 4EU0A 4OQHA 4E6XA 5I94A 2PAVP 3FV7A 3FPVA 4RA7A 5FATA 1BSGA 2UV0E 1JVJA 3O5YA 2V8CA 1G68A 4IEDA 1CI8A 4S2MA 2W3GA 3UY6A 5G18A 4OONA 2EA9A 3UN7A 1LL9A 4BMWA 1P0ZA 3O87A 4F3LB 4M3KA 5FQJA 4WZ5A 2M7UA 4HI4A 4UQIS 2V1BA 1ACFA 3E4OA 3SOIA 2VGLM 2ZQ7A 5HPFA 2QJ5A 4X56A 4R6LA 5AJGA 2WKHA 1S1YA 3LR3A 4BL3A 4RVAA 5GLCA 4NETA 2EX8A 2ZM0A 4JGRA 1VHMA 3G34A 5A8BA 4KZ4A 3NOTC 3PAGA 5CERA 1KDWA 5GHYA 1OT6A 4MBFA 4Q8IA 1NYMA 5CX7A 3VOZA 3MQQA 4GCZA 3GMWA 3DBAA 4II7A 1E3UD 3MF0A 4NEED 3M6BA 4OOLA 2P08A 2D01A 2W0NA 4EWFA 1T19A 4HY8A 3N8LA 4FTXA 2WKQA 1XJ4A 3O3VA 1C3BA 4EUVA 3D4FA 4D60A 3IF6A 4G3KA 2ZM8A 2ZOIA 1FSYA 2QHKA 4FOFA 1GSXA 3IS2A 1Z6FA 5CTNA 1ODVA 1E3UA 3A3EA 1M6KA 1S67L 2ZL1B 4KZ9A 4B93A 1ES5A 1SHVA 1Z09A 1D06A 1N9OA 3VSKA 4MBHA 1TDLA 3E2LA 3RH8B 5HWTA 4Z1WA 4PMAA 2WZXA 3W2ZA 3P01A 3UO9A 1J3WA 3QP1A 4LRZE 3CZDA 4FH2A 1ESIA 1Y54A 4QWOA 4JKTA 2B95A 3FPWA 4KG2A 1W63M 4WBGA 4WELA 5C5KA 4X25A 5CTMA 2OWJA 4KQDA 1L0FA 5DFYA 3B3XA 4DDSA 3O88A 4GD6A 3HLBA 1K54C 3C7VA 2JKGA 5CEDA 4HJ3A 1NZOA 2H0TA 4IUHA 3NULA 3VMAA 3KYQA 3N6IA 3EGDC 4E3LA 1P9RA 4LFUA 2KLIA 2O9CA 3ICYA 2WKIA 3UMEA 5FDHA 1OTEA 4MN7A 1FR6A 4LV3A 2BTFP 1KE4A 2WAFA 1CEFA 4FCFA 3G2ZA 3JYIA 2XK1A 2HDQA 5EV0A 1NWZA 4WEJA 5EFWA 4BWIA 2PYPA 3NCKA 5CHUA 4K0XA 1FCOA 2OLVA 3NIAA 4KG5A 2Z6CA 4GKUA 3G31A 5TR7A 2Y2OA 3QP8A 4H6JA 3E4PA 4MBKA 3NDEA 4HEFA 5FQQA 4BBUA 2FFYA 2R78A 3T1XA 1EI5A 1PI5A 3H7WB 3LR4A 4Y17A 3QNBA 5EVIC 5DVAA 2EXAA 3D3OA 2HP5A 3SW1A 4K91A 5AQBA 5CHMA 2K31A 4KQOA 1YSPA 3NBLA 3IXBA 1QMFA 1OMEA 4AFIA 4BD1A 2P04A 3SS4A 5FQKA 3CUEC 3F1OB 3KSFA 2BLSA 5FAPA 4OLGA 2P9VB 3ZGAB 4X6TA 4LCMA 1ESUA 4OOYA 4GHIA 3OCLA 2DMWA 4ME4A 4S2IA 2DNSA 4NXBA 4Y15A 2GX5A 3V50A 1ZTUA 3VP0A 1HLUP 3CPTA 2E8IA 4LV0A 3HREA 3F1NA 1Q2PA 4LLOB 1W7FA 3N4IA 3W4PA 3TJZC 4E3NA 1ZHHB 1E25A 1TS6A 3CWFA 4RYEA 4EW7A 2JN7A 1IKIA 1G5UA 4CPKA 4F94A 1YQSA 5HPIA 3G2YA 5GLDA 1KGGA 5E2FA 3ZYTA 1CQAA 1S1ZA 4BBVA 1PZOA 3NOUC 2EFXA 2J8YA 4QB8A 4NKPA 2JKTM 2Y8HA 1PWGA 2HV1A 1RCJA 5KSCA 3B47A 3E4QA 1K6SA 4HQAA 5AQ9A 4Y3IA 2W3DA 2K2NA 3Q7ZA 4P6ZM 1K54A 1HTZA 1UGUA 4Y0OA 2G2UA 5HL1A 3H9WA 5FI7A 2Y2IA 4A5RA 3KSIA 3EQUA 4KZ3A 3WS2A 2B18A 3HLDA 2O0YA 1K38A 2O99A 4WL9A 5U47A 1JWZA 1AWIA 2HGVA 5EVID 4EBLA 1NXYA 3DAVA 1VEUA 2P7JA 2W1TB 2VA0A 1Q2QA 4OQIA 5GL9A 1CK3A 1XA1A 3OLOA 1GSWA 1MY8A 1W79A 4R3BA 3ZVTA 3DTMA 5EOOA 4OP8A 4ZJ2A 4ZJ3A 4PAUA 1LSWA 2EFUA 4EESA 3C8CA 5IU1A 4RQ9A 5EVIA 3U2AA 3D72A 1SKOA 4GDNA 3WRTA 5FQMA 4DE1A 3LEZA 2WK0A 1I2WA 5CXWA 1XJ6A 5DF8A 3T4SA 4KQQA 5DTSA 5EVEA 2WGVA 2XROA 3ZFZA 1F98A 4ETXA 4DJ2A 5FI6A 3CUEA 4XXRA 1KE0A 2JKRI 3ZG8B 4N92A 5G4YA 2VX8A 2ZQ9A 3S22A 4ARZA 1TEMA 3BY9A 3KX0X 3CG5A 4ZRRA 3E2KA 4N1HA 3HL9A 4DXCA 3ZG9B 3CAXA 2A2LA 1PRQA 5L10A 1DJBA 1LT0A 2JBFA 4LV2A 3BLMA 1SDEA 4QY5A 4OPYA 4R4RA 3MQOA 4MEZA 3VP4A 3PAEA 1MBLA 4O01A 2HP9A 1N9LA 4Y5FA 5FDSA 3KO6A 3UE0A 2H28A 4QPRA 1ES4A 4HJ6A 4WN5A 4OVDA 3FG8A 3Q7VB 5KIZA 4R3AA 4KZ6A 4JPMA 2FH5A 3T50A 3CLOA 1JTDA 3N8SA 2QMIA 3HJKA 3EGXC 2H5SA 4K08A 2W3HA 3DWKA 1UWPX 4RX3A 3ZCZA 3UPOA 2CMNA 5F69A 5A91A 5F68A 4WEKA 4PKYA 4CLCB 1ZG6A 4KUOA 5FASA 3C7UA 4WUJA 1RP5A 3GECA 1U60A 3QP5A 3LIFA 4JBFA 4L0LA 3L7HA 3M2KA 4I39A 1D1JA 5HZHA 5M19A 3M6HA 3NY4A 1BUEA 1YAXA 4ZAMA 4U0TA 3IXDA 3LY3A 2GDNA 1KGEA 1SKFA 1K4EA 4WMCD 5J8XA 4MMNA 4NXGA 2EX6A 4Y0UA 4GB7A 3VFHA 4E3IA 1PWDA 5DKKA 2Z2MB 2XF3A 4I38A 2OSUA 5CGWA 3SS3A 4N9KA 3WS1A 3KSHA 1S6RA 3ITBA 1XFNA 2WUQA 3A0RA 4IVIA 2V1AA 2Y4AA 4WMCA 5L2FA 1K0KA 2ZMVA 5CEBA 2W27A 2HDUA 5L09A 3WS0A 2B02A 1YKDA 2J3TC 2Y2NA
chains in the Genus database with same CATH topology
3PR6A 5F5YA 2OWJA 4KQDA 4MN5A 4YNRA 3B33A 4XT2B 2W3EA 5MC7A 2PR6A 5DFYA 2VGLS 4HJ3A 4L9FA 1S4RA 4IUHA 3KYQA 3EGDC 2PYRA 4MN6A 1P9RA 3NOPC 1OJ5A 2KLIA 2O9CA 3PHYA 4HIAA 1NRJA 2INWA 3RTYA 3ICYA 4E04A 3UMEA 1OTEA 4MN7A 4UEYA 1T1AA 4R38A 1T1CA 2GNXA 1MC0A 4Q0IA 3UB9A 2Y79A 3PYPA 2D02A 3TE8A 3PXPA 3T4OA 4R70A 2PDRA 3IS2B 4IUKA 4I3JA 1NWZA 4WEJA 5EFWA 3G6OA 4BWIA 2PYPA 4OOMA 3LIBA 3EEHA 1TS7A 2QWSA 4EEUA 1H8MA 2VEAA 2EWWA 4YOFA 2PD7A 3A0SA 2Z6CA 1OTAA 2XA7S 3UE3A 3LIAA 4MDZA 4H6JA 3E4PA 3JVUA 4HH3A 5HDDA 1JNUA 4BBUA 4IJGA 1DRMA 2R78A 3EOIA 3EQVA 3H7WB 3LR4A 2J3WA 3MR0A 4EERA 2XA7M 1D7EA 4NXFA 4M4XA 3D3OA 3SW1A 2HJEA 2OAP1 2ZOHA 2LB5A 4HOIA 2K31A 4KQOA 1EW0A 3VE3A 3HCYA 2LB9A 4CLCC 1X0OA 3OOVA 3BW6A 3LR0A 2OWHA 5K5BA 1YSPA 4AFIA 2P04A 3KYZA 2NUPC 5DF9A 4O8GA 1DP6A 3BQ8A 3CUEC 3F1OB 1WA9A 3KSFA 2V9AA 2ZBBA 5J4EA 4PHTA 4B9OA 4CQHA 3LIEA 1YSQA 1XJ3A 4BJPA 3T4TA 1N9NA 3K3CA 1TD5A 4GHIA 3FC7A 3OCLA 2QJ7A 2DMWA 3CI6A 4ME4A 2PR5A 3MJQA 4DN0A 4NXBA 3R4KA 3MMHA 2NUTC 2L0WA 1G28A 2GZAA 3H82A 5HDCA 2GX5A 1GSVA 5AVEA 1ZTUA 3C2WA 2HF6A 4HJ4A 2W1TA 4JGQA 5IS1A 2L1MA 3F1NA 5DFXA 4LLOB 2J3TD 4L9GA 1F9IA 4LRYC 4CLCE 5DKLA 3TJZC 3PBQA 2V0UA 1ZHHB 3A0VA 5HD5A 1TS6A 1NLZA 1OTDA 3UB8A 1DP9A 3CWFA 4H6JB 4EW7A 1MKMA 2JN7A 3E0YA 5HPIA 1XFQA 2WKPA 3F1PA 4P6ZS 3PBSA 2L4RA 1OTBA 3K2NA 3UE6A 3BY8A 3ZYTA 4G3WA 5HDSA 5HWVA 5KSHA 1S1ZA 2A24A 4HP4A 1G6OA 3GDIA 1F5MA 3OCNA 4BBVA 3NOUC 2M7VA 4GS9A 1IFQA 2WKRA 1XJ2A 1LSXA 2W3FA 3V67A 4NKPA 2JKTM 2Y8HA 2HV1A 4I5SA 3B47A 3K3DA 3E4QA 3EEAA 2XRNA 3LI9A 2Z6DA 3PBOA 4HQAA 4Y3IA 3MFXA 2W3DA 2K2NA 3CITA 4Q0HA 4P6ZM 1UGUA 3R7WA 2GJ3A 2KOIA 2ZMFA 3T4LA 2KDKA 3H9WA 3PBNA 3NHQA 4GJ4A 4I3AA 3KSIA 3ZQ5A 5AVFA 2QYBA 2PD8A 1T18A 1UWNX 1MZUA 3EWKA 4GW9A 4HHDA 3EQUA 5J3WA 4BBTA 2B18A 2YKFA 3LIDA 1OT9A 2BASA 4JGPA 4Q0JA 5TBMA 2O0YA 2IA2A 3TRCA 5LBRA 1TS8A 2VV7A 3C38A 2O99A 4WL9A 2JKTI 3H82B 2HGVA 4F3LA 2V0WA 4LRXC 2OAQ1 4DJ3A 2P7JA 3S7PA 2W1TB 2VA0A 5DJUA 3LI8A 2YKHA 1STZA 1BYWA 3F1NB 3OLOA 1GSWA 2O9BA 3MQ0A 3B42A 1NLYA 4CLCD 4L9EA 4HP9A 2JKRM 3OBFA 4IHQA 1DP8A 3LFVA 3OC2A 1W63Q 4PAUA 4DMZA 2VKSA 1LSWA 4EESA 3C8CA 3S7OA 4FSFA 5DJTA 5IU1A 5HD3A 4RQ9A 3U2AA 3D72A 3F1PB 2VZWA 2K7SA 2VV6A 3VE4A 3E98A 2A24B 3VV4A 1XJ6A 3KSGA 3UB6A 3BWLA 4GS9B 1LSVA 2M1CA 3T4SA 5HL6A 2PHYA 4Y2FA 1P97A 4CLCA 5I5LA 1VB6A 4KUKA 4O0PA 1LL8A 1OJGA 2XROA 1F98A 4YWZA 3PBRA 3UMDA 1H3QA 2O9AA 4G3VA 3C30A 2VJWA 4ETXA 4DJ2A 4JGOA 4EXOA 3R7WB 2XSSA 3CUEA 4HH2A 5HWWA 5L8MA 2JKRI 4EU0A 5G4YA 3FPVA 5IT5A 2VX8A 3T4KA 2QKPA 3JVVA 1KOUA 4ARZA 3O5YA 3BY9A 3KX0X 3RFBA 3VOLA 2J80A 3UB7A 4ZRRA 2MJ6A 3BJNA 4WF0A 3CAXA 2A2LA 2EWVA 3ULFA 1LT0A 5TBMB 2W3GA 2EA9A 5TJJA 4BMWA 3F1OA 3IBJA 1P0ZA 3MQOA 4F3LB 2FZ0A 2M7UA 1IOUA 1P9WA 4HI4A 3PBTA 4UQIS 2V1BA 5G4ZA 3E4OA 2VGLM 1TS0A 4O01A 1N9LA 4WLAA 4Y5FA 5HSQA 5HPFA 2QJ5A 5J7EA 3KO6A 4HNBA 2H28A 4R6LA 4QPRA 2PT7A 5AJGA 4HJ6A 4WN5A 1S1YA 3LR3A 3FG8A 5KIZA 4R3AA 4JGRA 2FH5A 3T50A 3CLOA 1VHMA 2KX6A 4UQIM 2G7UA 5A8BA 1OTIA 3HJKA 3EGXC 1Y28A 1V9ZA 4XT2A 4GLQA 4K08A 5F6AA 3NOTC 4GHIB 2VLGA 2W3HA 1S4SA 1UWPX 3HJIA 1V9YA 2CMNA 5F69A 3S7NA 3S7QA 3NJAA 1OT6A 2I9VA 5F68A 3BQAA 2JHEA 4PKYA 4WEKA 5CX7A 4CLCB 4KUOA 3MQQA 4GCZA 4WUJA 3DBAA 4II7A 4LPZA 3GECA 3MF0A 4NEED 4OOLA 2P08A 2W1RA 2D01A 3LIFA 2W0NA 1T19A 4HY8A 2WKQA 1XJ4A 4I39A 4L0LA 5HZHA 1OPXA 4EETB 4EUVA 4MCWA 4G3KA 2ZOIA 4I3IA 1YAXA 2VV8A 2QHKA 4FOFA 1GSXA 4PKYG 4ARZB 3IS2A 4MMNA 1ODVA 4NXGA 3T4JA 2OOLA 1S67L 5DKKA 3T4QA 4I38A 5FL3A 4B93A 3KSHA 1TF1A 1D06A 1N9OA 1XFNA 3MXQA 3A0RA 3RH8B 3TW8A 4EEPA 2HJ9C 1T1BA 5HWTA 2V1AA 4Z1WA 4EQ1A 4ETZA 3LICA 3LYXA 3LUQA 4NXEA 3H7WA 3W2ZA 3P01A 2ZMVA 4LRZE 3LR5A 3IBRA 3FPWA 2W27A 3P7NA 1S66L 1W63M 4WELA 2B02A 1YKDA 2J3TC 5C5KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PR6 A;  3CUE C;  2J3W A;  2ZMV A;  3CUE A;  1H3Q A;  2J3T D;  2J3T C; 
#chains in the Genus database with same CATH topology
 3PR6 A;  4B88 A;  2V20 A;  4MN5 A;  2W3E A;  2PR6 A;  2FFF B;  3TSG A;  4EBN A;  1PW8 A;  3MZF A;  1KVL A;  1ERM A;  2XEP A;  4OP5 A;  4S2P A;  1WYC A;  1OJ5 A;  1NRJ A;  2INW A;  2VK3 A;  4E04 A;  2Y2L A;  3V39 A;  1PYY A;  4UEY A;  1T1A A;  3NI9 A;  1Y4O A;  3SH9 A;  3FKV A;  3O86 A;  1MC0 A;  2Y79 A;  3PYP A;  3TE8 A;  5GHX A;  1HVB A;  1S0W A;  2RL3 A;  3T4O A;  2PU4 A;  3IS2 B;  1O07 A;  2V1Z A;  3G6O A;  4PPR A;  3S4X A;  4DRT A;  4O7D A;  3SH7 A;  2QWS A;  2VEA A;  1NRF A;  1YLP A;  3G30 A;  1EWZ A;  5TGF A;  3G4P A;  3LIA A;  2JC7 A;  1AXB A;  4DE0 A;  3JVU A;  4ZJ1 A;  4HH3 A;  3UDI A;  1JNU A;  4E6W A;  5F82 A;  4IJG A;  1DRM A;  3EOI A;  3GR2 A;  3MR0 A;  4Z9Q A;  4U0X A;  2XA7 M;  4NXF A;  4M4X A;  3MKE A;  2OAP 1;  2EX2 A;  3N7W A;  1EW0 A;  3HCY A;  2LB9 A;  4ID4 A;  1X0O A;  3BW6 A;  3LR0 A;  2HDS A;  4S2L A;  3IHA A;  3UB5 P;  4O8G A;  3BQ8 A;  5E2H A;  2C6W B;  1WA9 A;  1H5X A;  4PHT A;  2QZ6 A;  4HBT A;  5L07 A;  4DE2 A;  3K3C A;  3FC7 A;  3AGE A;  4E3M A;  1G28 A;  4KZA A;  5HDC A;  5JYO A;  2VGK A;  1N9B A;  1VQQ A;  2V8F A;  1K55 C;  4S2N C;  1H8Y A;  4JGQ A;  5HAP A;  5IS1 A;  2J3T D;  4L9G A;  1F9I A;  5DKL A;  2EXB A;  1FCN A;  3OPL A;  3PBQ A;  3JPU A;  3N8R A;  2J9P A;  5A92 A;  3MZE A;  1DP9 A;  1PWC A;  4H6J B;  3HBR A;  4S2O A;  4EQI A;  4E3J A;  5GLB A;  1K57 C;  1XFQ A;  2WKP A;  1KVM A;  3PBS A;  1WE4 A;  3K2N A;  3DTE A;  5HDS A;  2A24 A;  1M40 A;  5E43 A;  1G6O A;  1F5M A;  2M7V A;  2ZL1 A;  4U3T A;  3ZG0 A;  2Q9N A;  3K3D A;  2XRN A;  3NC8 A;  3ZVW A;  2ZQA A;  3D9Y A;  3MBZ A;  3MFX A;  3FYZ A;  3C5A A;  3DW0 A;  1W8Y A;  1J9M A;  2GJ3 A;  3CJM A;  1BUL A;  3PBN A;  3NHQ A;  1CI9 A;  2AVX A;  4I3A A;  1MPL A;  4HES A;  3ZQ5 A;  5AVF A;  1T18 A;  1UWN X;  3MZD A;  1RGY A;  4Q0J A;  4JGP A;  1WYB A;  5TBM A;  3TRC A;  2ZC4 B;  4B4X A;  2ZQD A;  2JKT I;  4S2J A;  2ZC6 B;  1DJC A;  3CPT B;  1FR1 A;  2OAQ 1;  1YLJ A;  1VET A;  1YLT A;  3LI8 A;  2YKH A;  1BYW A;  3F1N B;  3UE1 A;  2HZ5 A;  1TDG A;  3W4O A;  3B42 A;  3CMZ A;  2ZQC A;  3OBF A;  1I5Q A;  3LFV A;  1W63 Q;  4DMZ A;  3HLW A;  3S7O A;  2HP6 A;  2Y91 A;  4HBU A;  2VZW A;  3E98 A;  1MWR A;  4DDY A;  3BWL A;  1LSV A;  3FWL A;  2PHY A;  5KZH A;  3LGO A;  3HLG A;  1L0D A;  1BTL A;  4YFM A;  4O0P A;  1RGZ A;  4LCL A;  3UPP A;  4YWZ A;  3UMD A;  1JWV A;  2O9A A;  4P87 A;  4QD4 A;  4EXO A;  5E2E A;  1PIO A;  3AGD A;  3P09 A;  5IT5 A;  3T4K A;  3BLS A;  3JVV A;  1KOU A;  2XGN A;  2DRW A;  1JTG A;  3S1Y A;  1L0E A;  3IXG A;  3IHB A;  1YLZ A;  2XLN A;  3ULF A;  3GRJ A;  4XUX A;  5FAQ A;  3HUO A;  5TJJ A;  3F1O A;  3IBJ A;  1K55 A;  4S2N A;  2OV5 A;  4R4S A;  5D3O A;  2UWX A;  2XFS A;  5CHJ A;  1VEU B;  4JXS A;  1BLH A;  4K0W A;  5G4Z A;  3VOY A;  1ERO A;  4WLA A;  2OLU A;  1BZA A;  5J7E A;  4HNB A;  3LO7 A;  5DF7 A;  1K57 A;  3ZG5 A;  1DJA A;  1I2S A;  5EVI B;  4UQI M;  2ZD8 A;  2G7U A;  1OTI A;  4UA6 A;  1Y28 A;  4XT2 A;  2Y55 A;  5GHZ A;  3FZC A;  4GLQ A;  4C75 A;  3UDF A;  5JYP A;  4LV1 A;  3S7N A;  4XUZ A;  1PZP A;  2I9V A;  4GNU A;  2R9W A;  1G6A A;  3BQA A;  3V5M A;  2JHE A;  4P0M A;  4PM5 A;  3WRZ A;  4LPZ A;  3LEQ A;  5CGX A;  4GD8 A;  1XP4 A;  2WKE A;  1ONH A;  4EET B;  2XD1 A;  3HLC A;  4MCW A;  5FAO A;  3G32 A;  4WM9 A;  3ISG A;  2VV8 A;  4JF6 A;  3BM6 A;  2ZMA A;  1A0K A;  3BEB A;  4N1X A;  4ARZ B;  2XDM A;  2V2F F;  2XH9 A;  4KZB A;  4KZ8 A;  3TG9 A;  3ZNY A;  3BRM A;  1FQG A;  2JKF A;  3V3R A;  4ESP A;  4UA7 A;  1L3L A;  3RXW A;  1BT5 A;  4IBR A;  3AGF A;  3TW8 A;  4ETZ A;  3IWO A;  4EQ1 A;  3LIC A;  3LYX A;  3LUQ A;  4NXE A;  4QU3 A;  3WWX A;  1FIK A;  1K56 D;  4OPR A;  4PM7 A;  3OPH A;  1MXO A;  2JCH A;  2Z2L B;  1MWS A;  3MXS A;  1LI0 A;  4PM9 A;  3BFE A;  3I7J A;  5MC7 A;  3CHW P;  2Y2G A;  4R3J A;  1IYS A;  1K56 A;  1S4R A;  2WGW A;  3NOP C;  1IYO A;  5HX9 A;  2Y59 A;  3WS4 A;  4R1G A;  1KGF A;  3IF5 A;  4WZ4 A;  3UB9 A;  5F1F A;  3PXP A;  2X01 A;  2C5W B;  4KG6 A;  4I3J A;  4BEN A;  4OOM A;  3LIB A;  3EEH A;  3VP2 A;  1GA0 A;  2WZZ A;  1ZKJ A;  4YOF A;  3A0S A;  1GA9 A;  2P74 A;  5CEC A;  1O7E A;  3W4Q A;  3QNC A;  5HDD A;  2ZJ9 A;  3WS5 A;  5TFQ A;  5EVL A;  1IEM A;  2PBY A;  1FSW A;  2RCX A;  1SDN A;  3TOI A;  4P6B A;  1PI4 A;  2LB5 A;  4R23 A;  4X1L A;  1LHY A;  4HOI A;  2Y2J A;  3VE3 A;  4WYY A;  1KDS A;  1TVF A;  4BLM A;  4Y0T A;  2BG1 A;  2OWH A;  5EM1 A;  4E3K A;  5K5B A;  3KYZ A;  1DP6 A;  5KMW A;  3U4L P;  2Y2H A;  3QP6 A;  5J4E A;  4B9O A;  4CQH A;  3LIE A;  1MKI A;  1YMS A;  1LL5 A;  4IVK A;  1XJ3 A;  1FIL A;  4BJP A;  3T4T A;  1N9N A;  1TD5 A;  3A3J A;  2Y2P A;  3CI6 A;  5FI2 A;  3MJQ A;  3R4K A;  5EUA A;  2B5R A;  2PRF A;  3MMH A;  2L0W A;  1YMX A;  2GZA A;  3H82 A;  3T1S A;  3IXH A;  3MKF A;  2L1M A;  4KZ5 A;  5DFX A;  4JXW A;  4LRY C;  4CLC E;  2V0U A;  5HD5 A;  4FH4 A;  1NLZ A;  5E2G A;  1MKM A;  2ZM2 A;  4LEN A;  3HLE A;  4S2K A;  4GZB A;  3F1P A;  4P6Z S;  1GCE A;  2L4R A;  3UE6 A;  3QHY A;  5HWV A;  2WGI A;  4HP4 A;  3GDI A;  4P85 A;  3IF6 B;  1KE3 A;  5F83 A;  4GS9 A;  1IFQ A;  3ITA A;  3V67 A;  3L9K A;  4I5S A;  4DE3 A;  3EEA A;  3LI9 A;  3LY4 A;  2Z6D A;  3PBO A;  1NJ4 A;  2J9O A;  4ZDX A;  2XD5 A;  3PTE A;  5DTK A;  1FOF A;  3R7W A;  3NEC A;  2KDK A;  4GJ4 A;  5HAI A;  1W8Q A;  4JLF A;  2QPN A;  2PD8 A;  4BBT A;  2YKF A;  3LID A;  2BAS A;  4UA9 A;  3GSG A;  3NDG A;  1MWU A;  1TS8 A;  4F3L A;  2V0W A;  3ZG7 B;  5F1G A;  3HVF A;  4DJ3 A;  1BLC A;  1STZ A;  3W8K A;  4NK3 A;  3A3F A;  3MQ0 A;  4KQR A;  1NLY A;  2JE5 A;  4OPZ A;  4IHQ A;  3OC2 A;  5FSR A;  2VKS A;  4X68 A;  1CJF A;  4OQ0 A;  5DJT A;  4RX2 A;  3DTK A;  3OPR A;  3HLF A;  2K7S A;  2VV6 A;  3A3D A;  3VE4 A;  5FQ9 A;  2A24 B;  1N4O A;  1K25 A;  3UB6 A;  2M1C A;  2Q9M A;  3IQA A;  5HL6 A;  4MNR A;  5EEC A;  1P97 A;  2X02 A;  1VB6 A;  3BFC A;  1L0G A;  1OJG A;  4N9L A;  3PBR A;  4H8R A;  2VJW A;  5FA7 A;  4JGO A;  5HWW A;  5L8M A;  4GDB A;  2QKP A;  3MFD A;  3RFB A;  3VOL A;  2J80 A;  3UB7 A;  2MJ6 A;  2WAD A;  3BJN A;  2Y2Q A;  4WF0 A;  5EM0 A;  5CGS A;  1E4D A;  2EWV A;  3ZDJ A;  5TBM B;  3BFD A;  1HD8 A;  4PM6 A;  4OLD A;  1MWT A;  2FZ0 A;  1IOU A;  5DTT A;  1VET B;  1P9W A;  3PBT A;  3GQZ A;  2VGJ A;  1TS0 A;  5HSQ A;  3FKW A;  1XX2 A;  2XR0 A;  2PT7 A;  1F2K A;  1YT4 A;  5FEF A;  2EX9 A;  4BD0 A;  2KX6 A;  1H8Z A;  1V9Z A;  5F6A A;  4GHI B;  2VLG A;  1S4S A;  2PU2 A;  4X53 A;  3HJI A;  1V9Y A;  5HAR A;  3S7Q A;  3NJA A;  3KYE A;  1H0M A;  1IYQ A;  2W1R A;  5CRF A;  3SZT A;  1ZC2 A;  2ZC5 B;  1OPX A;  4I3I A;  4BL2 A;  5FEG A;  3GVB A;  4ZTK A;  1YM1 A;  3P98 A;  4PKY G;  5AQ7 A;  4B4Z A;  2A49 A;  4OQG A;  3BYD A;  3T12 B;  2Q0O A;  4IBX A;  3T4J A;  3ZNT A;  2OOL A;  2ZQ8 A;  3T4Q A;  5FL3 A;  2HDR A;  1ERQ A;  1XGJ A;  2DCF A;  3IX4 A;  3QP2 A;  1TF1 A;  3MXQ A;  4R0Q A;  2XQZ A;  4EEP A;  2HJ9 C;  1T1B A;  4X55 A;  3H7W A;  3VSL A;  5M1A A;  5EPH A;  3MSH A;  2IWD A;  3LR5 A;  3IBR A;  3DWZ A;  4QHC A;  1NYY A;  3P7N A;  3RXX A;  1ALQ A;  1S66 L;  2ZC7 A;  4DF6 A;  5F5Y A;  2ACG A;  3UPN A;  1SZV A;  4YNR A;  3B33 A;  4XT2 B;  4CJN A;  2PBD P;  5AQA A;  2VGL S;  3Q82 A;  4Y7P A;  4L9F A;  2CC1 A;  1ZG4 A;  2PYR A;  2ZC3 B;  4MN6 A;  4PM8 A;  5HAQ A;  4HIA A;  2P9V A;  3PHY A;  2G2W A;  3RTY A;  4OPQ A;  4R38 A;  3Q81 A;  5FQI A;  1T1C A;  2GNX A;  1PW1 A;  1SCW A;  4DXB A;  4Q0I A;  1XA7 A;  2E8J A;  2D02 A;  4X69 A;  4X1M A;  4R70 A;  2PDR A;  3GTC A;  4EV4 A;  3RJU A;  4IUK A;  1BLS A;  1XPB A;  5EE8 A;  4OKP A;  2HPB A;  1SKO B;  1TS7 A;  3IH8 A;  4E3O A;  1H8M A;  4EEU A;  2XFT A;  2EWW A;  1LI9 A;  1XGI A;  4LGW A;  2PD7 A;  1OTA A;  2XA7 S;  2R9X A;  3UE3 A;  4MDZ A;  4EUZ A;  3BFF A;  3HUM A;  3OPP A;  3MS6 A;  1GHP A;  1K4F A;  4GOG A;  1PNE A;  3C4P A;  4MLL A;  1ES2 A;  2J7V A;  3IX3 A;  3EQV A;  4Y13 A;  1QME A;  2X71 A;  2J3W A;  4KZ7 A;  4EER A;  1D7E A;  4C6Y A;  4JF4 A;  3UDX A;  1HZO A;  2HJE A;  2ZOH A;  3UNW A;  3G35 A;  4JXG A;  1YPR A;  1BLP A;  4CLC C;  3OOV A;  2H0Y A;  2ZLY A;  1XKZ A;  5HW3 A;  2I72 A;  2IWB A;  2NUP C;  5DF9 A;  3VP1 A;  2WGW B;  1YLW A;  3BFG A;  1VM1 A;  2V9A A;  2ZBB A;  3DTI A;  1YSQ A;  3IWQ A;  5GLA A;  1JWP A;  2QJ7 A;  2PR5 A;  4DN0 A;  5HFO A;  2NUT C;  1GSV A;  3T1Q B;  3C4O A;  3Q07 A;  5AVE A;  5A93 A;  4DKI A;  3MXR A;  3C2W A;  2HF6 A;  1DY6 A;  5IHV A;  4GN2 A;  4HJ4 A;  3A3I A;  2W1T A;  4WZ5 C;  5A90 A;  3A0V A;  1ONG A;  3IT9 A;  4JF5 A;  1OTD A;  3UB8 A;  1FCM A;  4QY6 A;  3E0Y A;  3IX8 A;  1XXM A;  1W5D A;  3VFF A;  1ES3 A;  1OTB A;  2Y2M A;  4FD8 A;  3BY8 A;  5KSH A;  4G3W A;  5BOH A;  1PFL A;  3OCN A;  1K6R A;  3SH8 A;  2A3U A;  1NZU A;  1GHM A;  2WKR A;  3IH9 A;  1XJ2 A;  1LSX A;  2W3F A;  4ZBE A;  3BEC A;  4FUW A;  3HUN A;  3CIT A;  4Q0H A;  3IWI A;  4QJG A;  1IYP A;  4KEN B;  3ZHH A;  2KOI A;  2ZMF A;  3T4L A;  3IF6 C;  4BQM A;  2IWC A;  1CF0 A;  3LCE A;  4EBP A;  3GV9 A;  3V3S A;  2Y2K A;  2QYB A;  1MZU A;  3EWK A;  4GW9 A;  4HHD A;  5J3W A;  1OT9 A;  2WAE A;  2IA2 A;  5M18 A;  5LBR A;  2VV7 A;  3C38 A;  5EOE A;  3H82 B;  3VP3 A;  4LRX C;  4JXV A;  3S7P A;  5DJU A;  1GHI A;  2O9B A;  4OH0 A;  2WYX A;  4D2O A;  4CLC D;  4L9E A;  4HP9 A;  2JKR M;  1DP8 A;  4NG2 A;  3Q7V A;  4UAA A;  3SS5 A;  4FSF A;  1IEL A;  5HD3 A;  1L2S A;  2H10 A;  3F1P B;  3OZH A;  3M2J A;  3VV4 A;  1LLB A;  3KSG A;  1NY0 A;  4GS9 B;  4YIN A;  4Y2F A;  4CLC A;  3Q1F A;  1CEG A;  5I5L A;  4KUK A;  1YLY A;  1LL8 A;  3QP4 A;  3T1R A;  1H3Q A;  4G3V A;  3C30 A;  4UHU A;  3R7W B;  2XSS A;  4HH2 A;  1IKG A;  4C3Q A;  4EU0 A;  4OQH A;  4E6X A;  5I94 A;  2PAV P;  3FV7 A;  3FPV A;  4RA7 A;  5FAT A;  1BSG A;  2UV0 E;  1JVJ A;  3O5Y A;  2V8C A;  1G68 A;  4IED A;  1CI8 A;  4S2M A;  2W3G A;  3UY6 A;  5G18 A;  4OON A;  2EA9 A;  3UN7 A;  1LL9 A;  4BMW A;  1P0Z A;  3O87 A;  4F3L B;  4M3K A;  5FQJ A;  4WZ5 A;  2M7U A;  4HI4 A;  4UQI S;  2V1B A;  1ACF A;  3E4O A;  3SOI A;  2VGL M;  2ZQ7 A;  5HPF A;  2QJ5 A;  4X56 A;  4R6L A;  5AJG A;  2WKH A;  1S1Y A;  3LR3 A;  4BL3 A;  4RVA A;  5GLC A;  4NET A;  2EX8 A;  2ZM0 A;  4JGR A;  1VHM A;  3G34 A;  5A8B A;  4KZ4 A;  3NOT C;  3PAG A;  5CER A;  1KDW A;  5GHY A;  1OT6 A;  4MBF A;  4Q8I A;  1NYM A;  5CX7 A;  3VOZ A;  3MQQ A;  4GCZ A;  3GMW A;  3DBA A;  4II7 A;  1E3U D;  3MF0 A;  4NEE D;  3M6B A;  4OOL A;  2P08 A;  2D01 A;  2W0N A;  4EWF A;  1T19 A;  4HY8 A;  3N8L A;  4FTX A;  2WKQ A;  1XJ4 A;  3O3V A;  1C3B A;  4EUV A;  3D4F A;  4D60 A;  3IF6 A;  4G3K A;  2ZM8 A;  2ZOI A;  1FSY A;  2QHK A;  4FOF A;  1GSX A;  3IS2 A;  1Z6F A;  5CTN A;  1ODV A;  1E3U A;  3A3E A;  1M6K A;  1S67 L;  2ZL1 B;  4KZ9 A;  4B93 A;  1ES5 A;  1SHV A;  1Z09 A;  1D06 A;  1N9O A;  3VSK A;  4MBH A;  1TDL A;  3E2L A;  3RH8 B;  5HWT A;  4Z1W A;  4PMA A;  2WZX A;  3W2Z A;  3P01 A;  3UO9 A;  1J3W A;  3QP1 A;  4LRZ E;  3CZD A;  4FH2 A;  1ESI A;  1Y54 A;  4QWO A;  4JKT A;  2B95 A;  3FPW A;  4KG2 A;  1W63 M;  4WBG A;  4WEL A;  5C5K A;  4X25 A;  5CTM A;  2OWJ A;  4KQD A;  1L0F A;  5DFY A;  3B3X A;  4DDS A;  3O88 A;  4GD6 A;  3HLB A;  1K54 C;  3C7V A;  2JKG A;  5CED A;  4HJ3 A;  1NZO A;  2H0T A;  4IUH A;  3NUL A;  3VMA A;  3KYQ A;  3N6I A;  3EGD C;  4E3L A;  1P9R A;  4LFU A;  2KLI A;  2O9C A;  3ICY A;  2WKI A;  3UME A;  5FDH A;  1OTE A;  4MN7 A;  1FR6 A;  4LV3 A;  2BTF P;  1KE4 A;  2WAF A;  1CEF A;  4FCF A;  3G2Z A;  3JYI A;  2XK1 A;  2HDQ A;  5EV0 A;  1NWZ A;  4WEJ A;  5EFW A;  4BWI A;  2PYP A;  3NCK A;  5CHU A;  4K0X A;  1FCO A;  2OLV A;  3NIA A;  4KG5 A;  2Z6C A;  4GKU A;  3G31 A;  5TR7 A;  2Y2O A;  3QP8 A;  4H6J A;  3E4P A;  4MBK A;  3NDE A;  4HEF A;  5FQQ A;  4BBU A;  2FFY A;  2R78 A;  3T1X A;  1EI5 A;  1PI5 A;  3H7W B;  3LR4 A;  4Y17 A;  3QNB A;  5EVI C;  5DVA A;  2EXA A;  3D3O A;  2HP5 A;  3SW1 A;  4K91 A;  5AQB A;  5CHM A;  2K31 A;  4KQO A;  1YSP A;  3NBL A;  3IXB A;  1QMF A;  1OME A;  4AFI A;  4BD1 A;  2P04 A;  3SS4 A;  5FQK A;  3CUE C;  3F1O B;  3KSF A;  2BLS A;  5FAP A;  4OLG A;  2P9V B;  3ZGA B;  4X6T A;  4LCM A;  1ESU A;  4OOY A;  4GHI A;  3OCL A;  2DMW A;  4ME4 A;  4S2I A;  2DNS A;  4NXB A;  4Y15 A;  2GX5 A;  3V50 A;  1ZTU A;  3VP0 A;  1HLU P;  3CPT A;  2E8I A;  4LV0 A;  3HRE A;  3F1N A;  1Q2P A;  4LLO B;  1W7F A;  3N4I A;  3W4P A;  3TJZ C;  4E3N A;  1ZHH B;  1E25 A;  1TS6 A;  3CWF A;  4RYE A;  4EW7 A;  2JN7 A;  1IKI A;  1G5U A;  4CPK A;  4F94 A;  1YQS A;  5HPI A;  3G2Y A;  5GLD A;  1KGG A;  5E2F A;  3ZYT A;  1CQA A;  1S1Z A;  4BBV A;  1PZO A;  3NOU C;  2EFX A;  2J8Y A;  4QB8 A;  4NKP A;  2JKT M;  2Y8H A;  1PWG A;  2HV1 A;  1RCJ A;  5KSC A;  3B47 A;  3E4Q A;  1K6S A;  4HQA A;  5AQ9 A;  4Y3I A;  2W3D A;  2K2N A;  3Q7Z A;  4P6Z M;  1K54 A;  1HTZ A;  1UGU A;  4Y0O A;  2G2U A;  5HL1 A;  3H9W A;  5FI7 A;  2Y2I A;  4A5R A;  3KSI A;  3EQU A;  4KZ3 A;  3WS2 A;  2B18 A;  3HLD A;  2O0Y A;  1K38 A;  2O99 A;  4WL9 A;  5U47 A;  1JWZ A;  1AWI A;  2HGV A;  5EVI D;  4EBL A;  1NXY A;  3DAV A;  1VEU A;  2P7J A;  2W1T B;  2VA0 A;  1Q2Q A;  4OQI A;  5GL9 A;  1CK3 A;  1XA1 A;  3OLO A;  1GSW A;  1MY8 A;  1W79 A;  4R3B A;  3ZVT A;  3DTM A;  5EOO A;  4OP8 A;  4ZJ2 A;  4ZJ3 A;  4PAU A;  1LSW A;  2EFU A;  4EES A;  3C8C A;  5IU1 A;  4RQ9 A;  5EVI A;  3U2A A;  3D72 A;  1SKO A;  4GDN A;  3WRT A;  5FQM A;  4DE1 A;  3LEZ A;  2WK0 A;  1I2W A;  5CXW A;  1XJ6 A;  5DF8 A;  3T4S A;  4KQQ A;  5DTS A;  5EVE A;  2WGV A;  2XRO A;  3ZFZ A;  1F98 A;  4ETX A;  4DJ2 A;  5FI6 A;  3CUE A;  4XXR A;  1KE0 A;  2JKR I;  3ZG8 B;  4N92 A;  5G4Y A;  2VX8 A;  2ZQ9 A;  3S22 A;  4ARZ A;  1TEM A;  3BY9 A;  3KX0 X;  3CG5 A;  4ZRR A;  3E2K A;  4N1H A;  3HL9 A;  4DXC A;  3ZG9 B;  3CAX A;  2A2L A;  1PRQ A;  5L10 A;  1DJB A;  1LT0 A;  2JBF A;  4LV2 A;  3BLM A;  1SDE A;  4QY5 A;  4OPY A;  4R4R A;  3MQO A;  4MEZ A;  3VP4 A;  3PAE A;  1MBL A;  4O01 A;  2HP9 A;  1N9L A;  4Y5F A;  5FDS A;  3KO6 A;  3UE0 A;  2H28 A;  4QPR A;  1ES4 A;  4HJ6 A;  4WN5 A;  4OVD A;  3FG8 A;  3Q7V B;  5KIZ A;  4R3A A;  4KZ6 A;  4JPM A;  2FH5 A;  3T50 A;  3CLO A;  1JTD A;  3N8S A;  2QMI A;  3HJK A;  3EGX C;  2H5S A;  4K08 A;  2W3H A;  3DWK A;  1UWP X;  4RX3 A;  3ZCZ A;  3UPO A;  2CMN A;  5F69 A;  5A91 A;  5F68 A;  4WEK A;  4PKY A;  4CLC B;  1ZG6 A;  4KUO A;  5FAS A;  3C7U A;  4WUJ A;  1RP5 A;  3GEC A;  1U60 A;  3QP5 A;  3LIF A;  4JBF A;  4L0L A;  3L7H A;  3M2K A;  4I39 A;  1D1J A;  5HZH A;  5M19 A;  3M6H A;  3NY4 A;  1BUE A;  1YAX A;  4ZAM A;  4U0T A;  3IXD A;  3LY3 A;  2GDN A;  1KGE A;  1SKF A;  1K4E A;  4WMC D;  5J8X A;  4MMN A;  4NXG A;  2EX6 A;  4Y0U A;  4GB7 A;  3VFH A;  4E3I A;  1PWD A;  5DKK A;  2Z2M B;  2XF3 A;  4I38 A;  2OSU A;  5CGW A;  3SS3 A;  4N9K A;  3WS1 A;  3KSH A;  1S6R A;  3ITB A;  1XFN A;  2WUQ A;  3A0R A;  4IVI A;  2V1A A;  2Y4A A;  4WMC A;  5L2F A;  1K0K A;  2ZMV A;  5CEB A;  2W27 A;  2HDU A;  5L09 A;  3WS0 A;  2B02 A;  1YKD A;  2J3T C;  2Y2N A; 
#chains in the Genus database with same CATH homology
 3PR6 A;  5F5Y A;  2OWJ A;  4KQD A;  4MN5 A;  4YNR A;  3B33 A;  4XT2 B;  2W3E A;  5MC7 A;  2PR6 A;  5DFY A;  2VGL S;  4HJ3 A;  4L9F A;  1S4R A;  4IUH A;  3KYQ A;  3EGD C;  2PYR A;  4MN6 A;  1P9R A;  3NOP C;  1OJ5 A;  2KLI A;  2O9C A;  3PHY A;  4HIA A;  1NRJ A;  2INW A;  3RTY A;  3ICY A;  4E04 A;  3UME A;  1OTE A;  4MN7 A;  4UEY A;  1T1A A;  4R38 A;  1T1C A;  2GNX A;  1MC0 A;  4Q0I A;  3UB9 A;  2Y79 A;  3PYP A;  2D02 A;  3TE8 A;  3PXP A;  3T4O A;  4R70 A;  2PDR A;  3IS2 B;  4IUK A;  4I3J A;  1NWZ A;  4WEJ A;  5EFW A;  3G6O A;  4BWI A;  2PYP A;  4OOM A;  3LIB A;  3EEH A;  1TS7 A;  2QWS A;  4EEU A;  1H8M A;  2VEA A;  2EWW A;  4YOF A;  2PD7 A;  3A0S A;  2Z6C A;  1OTA A;  2XA7 S;  3UE3 A;  3LIA A;  4MDZ A;  4H6J A;  3E4P A;  3JVU A;  4HH3 A;  5HDD A;  1JNU A;  4BBU A;  4IJG A;  1DRM A;  2R78 A;  3EOI A;  3EQV A;  3H7W B;  3LR4 A;  2J3W A;  3MR0 A;  4EER A;  2XA7 M;  1D7E A;  4NXF A;  4M4X A;  3D3O A;  3SW1 A;  2HJE A;  2OAP 1;  2ZOH A;  2LB5 A;  4HOI A;  2K31 A;  4KQO A;  1EW0 A;  3VE3 A;  3HCY A;  2LB9 A;  4CLC C;  1X0O A;  3OOV A;  3BW6 A;  3LR0 A;  2OWH A;  5K5B A;  1YSP A;  4AFI A;  2P04 A;  3KYZ A;  2NUP C;  5DF9 A;  4O8G A;  1DP6 A;  3BQ8 A;  3CUE C;  3F1O B;  1WA9 A;  3KSF A;  2V9A A;  2ZBB A;  5J4E A;  4PHT A;  4B9O A;  4CQH A;  3LIE A;  1YSQ A;  1XJ3 A;  4BJP A;  3T4T A;  1N9N A;  3K3C A;  1TD5 A;  4GHI A;  3FC7 A;  3OCL A;  2QJ7 A;  2DMW A;  3CI6 A;  4ME4 A;  2PR5 A;  3MJQ A;  4DN0 A;  4NXB A;  3R4K A;  3MMH A;  2NUT C;  2L0W A;  1G28 A;  2GZA A;  3H82 A;  5HDC A;  2GX5 A;  1GSV A;  5AVE A;  1ZTU A;  3C2W A;  2HF6 A;  4HJ4 A;  2W1T A;  4JGQ A;  5IS1 A;  2L1M A;  3F1N A;  5DFX A;  4LLO B;  2J3T D;  4L9G A;  1F9I A;  4LRY C;  4CLC E;  5DKL A;  3TJZ C;  3PBQ A;  2V0U A;  1ZHH B;  3A0V A;  5HD5 A;  1TS6 A;  1NLZ A;  1OTD A;  3UB8 A;  1DP9 A;  3CWF A;  4H6J B;  4EW7 A;  1MKM A;  2JN7 A;  3E0Y A;  5HPI A;  1XFQ A;  2WKP A;  3F1P A;  4P6Z S;  3PBS A;  2L4R A;  1OTB A;  3K2N A;  3UE6 A;  3BY8 A;  3ZYT A;  4G3W A;  5HDS A;  5HWV A;  5KSH A;  1S1Z A;  2A24 A;  4HP4 A;  1G6O A;  3GDI A;  1F5M A;  3OCN A;  4BBV A;  3NOU C;  2M7V A;  4GS9 A;  1IFQ A;  2WKR A;  1XJ2 A;  1LSX A;  2W3F A;  3V67 A;  4NKP A;  2JKT M;  2Y8H A;  2HV1 A;  4I5S A;  3B47 A;  3K3D A;  3E4Q A;  3EEA A;  2XRN A;  3LI9 A;  2Z6D A;  3PBO A;  4HQA A;  4Y3I A;  3MFX A;  2W3D A;  2K2N A;  3CIT A;  4Q0H A;  4P6Z M;  1UGU A;  3R7W A;  2GJ3 A;  2KOI A;  2ZMF A;  3T4L A;  2KDK A;  3H9W A;  3PBN A;  3NHQ A;  4GJ4 A;  4I3A A;  3KSI A;  3ZQ5 A;  5AVF A;  2QYB A;  2PD8 A;  1T18 A;  1UWN X;  1MZU A;  3EWK A;  4GW9 A;  4HHD A;  3EQU A;  5J3W A;  4BBT A;  2B18 A;  2YKF A;  3LID A;  1OT9 A;  2BAS A;  4JGP A;  4Q0J A;  5TBM A;  2O0Y A;  2IA2 A;  3TRC A;  5LBR A;  1TS8 A;  2VV7 A;  3C38 A;  2O99 A;  4WL9 A;  2JKT I;  3H82 B;  2HGV A;  4F3L A;  2V0W A;  4LRX C;  2OAQ 1;  4DJ3 A;  2P7J A;  3S7P A;  2W1T B;  2VA0 A;  5DJU A;  3LI8 A;  2YKH A;  1STZ A;  1BYW A;  3F1N B;  3OLO A;  1GSW A;  2O9B A;  3MQ0 A;  3B42 A;  1NLY A;  4CLC D;  4L9E A;  4HP9 A;  2JKR M;  3OBF A;  4IHQ A;  1DP8 A;  3LFV A;  3OC2 A;  1W63 Q;  4PAU A;  4DMZ A;  2VKS A;  1LSW A;  4EES A;  3C8C A;  3S7O A;  4FSF A;  5DJT A;  5IU1 A;  5HD3 A;  4RQ9 A;  3U2A A;  3D72 A;  3F1P B;  2VZW A;  2K7S A;  2VV6 A;  3VE4 A;  3E98 A;  2A24 B;  3VV4 A;  1XJ6 A;  3KSG A;  3UB6 A;  3BWL A;  4GS9 B;  1LSV A;  2M1C A;  3T4S A;  5HL6 A;  2PHY A;  4Y2F A;  1P97 A;  4CLC A;  5I5L A;  1VB6 A;  4KUK A;  4O0P A;  1LL8 A;  1OJG A;  2XRO A;  1F98 A;  4YWZ A;  3PBR A;  3UMD A;  1H3Q A;  2O9A A;  4G3V A;  3C30 A;  2VJW A;  4ETX A;  4DJ2 A;  4JGO A;  4EXO A;  3R7W B;  2XSS A;  3CUE A;  4HH2 A;  5HWW A;  5L8M A;  2JKR I;  4EU0 A;  5G4Y A;  3FPV A;  5IT5 A;  2VX8 A;  3T4K A;  2QKP A;  3JVV A;  1KOU A;  4ARZ A;  3O5Y A;  3BY9 A;  3KX0 X;  3RFB A;  3VOL A;  2J80 A;  3UB7 A;  4ZRR A;  2MJ6 A;  3BJN A;  4WF0 A;  3CAX A;  2A2L A;  2EWV A;  3ULF A;  1LT0 A;  5TBM B;  2W3G A;  2EA9 A;  5TJJ A;  4BMW A;  3F1O A;  3IBJ A;  1P0Z A;  3MQO A;  4F3L B;  2FZ0 A;  2M7U A;  1IOU A;  1P9W A;  4HI4 A;  3PBT A;  4UQI S;  2V1B A;  5G4Z A;  3E4O A;  2VGL M;  1TS0 A;  4O01 A;  1N9L A;  4WLA A;  4Y5F A;  5HSQ A;  5HPF A;  2QJ5 A;  5J7E A;  3KO6 A;  4HNB A;  2H28 A;  4R6L A;  4QPR A;  2PT7 A;  5AJG A;  4HJ6 A;  4WN5 A;  1S1Y A;  3LR3 A;  3FG8 A;  5KIZ A;  4R3A A;  4JGR A;  2FH5 A;  3T50 A;  3CLO A;  1VHM A;  2KX6 A;  4UQI M;  2G7U A;  5A8B A;  1OTI A;  3HJK A;  3EGX C;  1Y28 A;  1V9Z A;  4XT2 A;  4GLQ A;  4K08 A;  5F6A A;  3NOT C;  4GHI B;  2VLG A;  2W3H A;  1S4S A;  1UWP X;  3HJI A;  1V9Y A;  2CMN A;  5F69 A;  3S7N A;  3S7Q A;  3NJA A;  1OT6 A;  2I9V A;  5F68 A;  3BQA A;  2JHE A;  4PKY A;  4WEK A;  5CX7 A;  4CLC B;  4KUO A;  3MQQ A;  4GCZ A;  4WUJ A;  3DBA A;  4II7 A;  4LPZ A;  3GEC A;  3MF0 A;  4NEE D;  4OOL A;  2P08 A;  2W1R A;  2D01 A;  3LIF A;  2W0N A;  1T19 A;  4HY8 A;  2WKQ A;  1XJ4 A;  4I39 A;  4L0L A;  5HZH A;  1OPX A;  4EET B;  4EUV A;  4MCW A;  4G3K A;  2ZOI A;  4I3I A;  1YAX A;  2VV8 A;  2QHK A;  4FOF A;  1GSX A;  4PKY G;  4ARZ B;  3IS2 A;  4MMN A;  1ODV A;  4NXG A;  3T4J A;  2OOL A;  1S67 L;  5DKK A;  3T4Q A;  4I38 A;  5FL3 A;  4B93 A;  3KSH A;  1TF1 A;  1D06 A;  1N9O A;  1XFN A;  3MXQ A;  3A0R A;  3RH8 B;  3TW8 A;  4EEP A;  2HJ9 C;  1T1B A;  5HWT A;  2V1A A;  4Z1W A;  4EQ1 A;  4ETZ A;  3LIC A;  3LYX A;  3LUQ A;  4NXE A;  3H7W A;  3W2Z A;  3P01 A;  2ZMV A;  4LRZ E;  3LR5 A;  3IBR A;  3FPW A;  2W27 A;  3P7N A;  1S66 L;  1W63 M;  4WEL A;  2B02 A;  1YKD A;  2J3T C;  5C5K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...