5L10A

Crystal structure of n-acylhomoserine lactone dependent luxr family transcriptionl factor cepr2 from burkholderia cenocepacia
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
172
structure length
172
Chain Sequence
NAMDLTILHDCFDALQRAPTAEAAFPPIAAAAAALGFRYCVYGLRRTLPLARPDMQIVGNHPREWEHRYVKFGYVTIDPIIKRVASQPRPVVWNAFDEPGDTAFWHDAACFGMRYGWSHGGYDRAGNLGVLTLVRDTTPLDADEISRLRAPCASLSHAAHAYLMPRLADPIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-acylhomoserine lactone dependent regulatory protein
publication title Crystal Structure of N-Acylhomoserine Lactone Dependent LuxR Family Transcriptionl Factor CepR2 from Burkholderia cenocepacia.
rcsb
source organism Burkholderia cenocepacia (strain atcc baa-245 / dsm 16553 / lmg 16656 / nctc 132
molecule tags Transcription
total genus 47
structure length 172
sequence length 172
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2016-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03472 Autoind_bind Autoinducer binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.80 Alpha Beta 2-Layer Sandwich Beta-Lactamase Transcription factor LuxR-like, autoinducer-binding domain 5l10A00
3IX8A 2AVXA 3QP2A 3QP4A 5L07A 4LGWA 1H0MA 4LFUA 3QP5A 4NG2A 3IX3A 5L10A 3IX4A 4Y13A 3JPUA 3QP6A 3QP8A 1L3LA 4Y15A 3SZTA 2Q0OA 5L09A 2UV0E 3QP1A 4Y17A
chains in the Genus database with same CATH superfamily
3KO6A 4F3LB 4C3QA 4N9LA 4PM7A 4X25A 2H5SA 5HX9A 1NZOA 2QPNA 5J3WA 2J9OA 3VE3A 3WS2A 1T1CA 1FCNA 1VM1A 4XT2A 1OTDA 4S2LA 4ZAMA 4OH0A 4NETA 2ZM8A 3NIAA 4E6WA 2BG1A 2Y2IA 2LB9A 2M1CA 5FDSA 3FKVA 2JBFA 1JWVA 4EEPA 1FR6A 4JPMA 4IVKA 3MKEA 1PWCA 2OLVA 2OAQ1 1N9OA 4DKIA 2V0WA 3G31A 1RGZA 3AGDA 3E4QA 2LB5A 1OTBA 5GLBA 1MXOA 3GSGA 2Y2LA 3LI9A 5F68A 4C6YA 3SS4A 2Q9MA 2XGNA 3GVBA 3UNWA 1WE4A 4Y2FA 3PBTA 3CUEC 5DTSA 3FWLA 3V3SA 4NG2A 2G2WA 5EVIC 3V39A 3O3VA 3N6IA 4BD0A 3IXBA 1XJ4A 2P9VA 3NULA 3R7WA 2BLSA 3QHYA 4S2MA 5CHUA 1NZUA 2GDNA 3KSGA 3IH9A 3NOPC 4EBNA 3VMAA 3A0RA 3WS4A 3IS2B 4LCMA 1HVBA 3BQ8A 3D9YA 3VV4A 5FDHA 2QZ6A 4DRTA 5GHZA 3OOVA 1FIKA 2DRWA 2VV8A 3Q07A 3SH7A 2W27A 1ZG6A 3MFXA 2A24A 3Q1FA 2JKFA 2OLUA 5CGWA 3HLGA 5CXWA 4HH2A 5IHVA 4EXOA 2XA7M 3BYDA 4O01A 5HPIA 1IFQA 1MPLA 2O9BA 1DJBA 1YLPA 2JE5A 4OQIA 3OPPA 4ZJ1A 5DJTA 4L0LA 3OBFA 4PAUA 4B4XA 4HNBA 4MEZA 1K55C 5DKLA 2Y2OA 3BJNA 4DXCA 4Y0TA 3OC2A 1E25A 4CLCC 1DP8A 4S2PA 3LUQA 4R6LA 2B5RA 3Q81A 5K5BA 3LIFA 4JGOA 2HP5A 3DAVA 4MDZA 1NLZA 4R23A 4NXBA 4KQRA 2Y2KA 2B02A 1L0EA 4EETB 3KYEA 3UDFA 3IF6A 2ZMVA 2V1BA 4GD8A 1OTAA 3RJUA 3E2LA 2BASA 5JYOA 1CI9A 1KVLA 2L0WA 4L9EA 3LR4A 1I2SA 3WRTA 4A5RA 4Y3IA 2Y4AA 4YNRA 2JKTM 2G7UA 3LR0A 5EM1A 2ZC7A 5CRFA 5AJGA 2WYXA 3BECA 5HWWA 3UDIA 2XRNA 3BRMA 1LT0A 1S67L 2EX2A 2O99A 4Q0IA 1LI9A 4KG2A 4BBUA 4B4ZA 3PBQA 5CEBA 3UB7A 2XF3A 4HP9A 4UA9A 4R4RA 5G4YA 4B93A 3RH8B 4IVIA 3MR0A 2NUPC 1H3QA 3C7VA 3UB5P 3B42A 4WF0A 4DE1A 5HDSA 2W3DA 4LRYC 2BTFP 3A3IA 3PXPA 4CLCE 4X69A 5IT5A 1MKMA 5EECA 3C5AA 2JHEA 3U4LP 5TBMA 5FQ9A 3DWZA 3SH9A 4DMZA 3FG8A 1IYPA 5FASA 5CHMA 5L10A 3D4FA 2XSSA 1XA7A 2Q0OA 1IKIA 4H8RA 1VEUB 2Y79A 1CJFA 1T18A 3H7WA 2FZ0A 2FFYA 1IEMA 4WN5A 1JWPA 1NWZA 4E3MA 5KSHA 3KYQA 4JF6A 1K6SA 4Q8IA 2Y91A 4EW7A 1PZOA 4IUKA 3IWQA 3ZYTA 5CGXA 2M7VA 5LBRA 1ONHA 5DF9A 1JNUA 3EGXC 1J3WA 2VX8A 1SKOB 2H0YA 3KSIA 4KZ6A 4L9FA 1P0ZA 2YKFA 3ITAA 3S4XA 4BBVA 1XGIA 2K7SA 2NUTC 4DE0A 4EV4A 1GHPA 4HJ3A 1YT4A 4QY5A 3IX8A 3MS6A 4GCZA 4GB7A 3PHYA 4HP4A 3ICYA 4MMNA 4HJ6A 2XD5A 1K6RA 2V0UA 3LFVA 3HUMA 4U0XA 3FV7A 3EEHA 3UPPA 4GJ4A 3H9WA 5F1GA 1LSVA 1ZC2A 4Y7PA 4B9OA 2Y2GA 3CMZA 3O5YA 1VB6A 2HDSA 4GD6A 3MQOA 3M2KA 3S7QA 4R4SA 1XFNA 3TSGA 3TE8A 3GMWA 3G2ZA 2WAFA 4KZ9A 1XJ3A 4BL3A 3BEBA 2J7VA 5EVIA 2JKGA 4LENA 1L0DA 4GW9A 3WS0A 5L2FA 3T4LA 5M18A 4GS9B 1VHMA 5I94A 1KE3A 5EE8A 2Y2MA 1CF0A 5DTKA 2XEPA 5L09A 3HBRA 3M2JA 4NKPA 1NRFA 3C4PA 3LGOA 3LEZA 1RP5A 1S66L 5HWTA 3T4OA 1LI0A 3BFDA 2QWSA 2Y59A 5GLDA 1K54A 4QY6A 4CLCB 3P09A 4ESPA 1HLUP 1GA9A 3GV9A 2JKRM 3D72A 3IF6C 1NLYA 3MSHA 3C8CA 2PD7A 4MNRA 3IH8A 1MC0A 4LV2A 3T1XA 4R1GA 2FH5A 2VGJA 4HOIA 3FKWA 3NECA 2Z6CA 1UGUA 3CITA 2V1ZA 4GDNA 3T1RA 1H8MA 1JWZA 5L8MA 4I39A 4NXEA 2W1TB 3QP1A 1YLJA 4KENB 3H82A 4BMWA 3RXWA 4PM9A 3UMDA 4HEFA 4KUKA 2EXBA 4MBKA 4JF4A 4U0TA 1GHIA 3UPNA 4PKYA 3DTEA 2EA9A 1ERQA 2C6WB 3AGFA 4S2KA 1JTDA 3W4PA 2Y2QA 3MF0A 4JXGA 1SDNA 1BSGA 2XA7S 5HD5A 3P98A 3BWLA 1W5DA 4JXWA 1DRMA 1H5XA 2W0NA 1LL8A 5FI7A 4WL9A 2JKTI 4OQHA 1BZAA 4E3OA 3VSKA 3AGEA 1DY6A 3N8SA 1LSXA 4YINA 3F1OA 3PTEA 5DF8A 4R70A 3G2YA 4ID4A 4ZTKA 4K91A 3WWXA 3DTIA 4JKTA 2J8YA 4HQAA 4Q0HA 4WZ4A 5HAIA 3CPTA 3HLEA 1XP4A 4EQIA 1BLPA 3IHAA 1G28A 1XXMA 1Q2PA 1YQSA 4XT2B 1WA9A 3C4OA 4I3IA 3CAXA 3BFCA 1ERMA 4GN2A 4UA7A 4FD8A 3W2ZA 5IU1A 4CPKA 4XXRA 4KZBA 5EFWA 2XFTA 2ZC4B 2VEAA 4BBTA 2PU2A 5EUAA 2UV0E 3DBAA 2JN7A 2XK1A 2PBYA 3HLCA 1VETA 3E4OA 3F1PA 4S2IA 3KYZA 3NBLA 3IXHA 1PFLA 4BL2A 2JC7A 5HPFA 1S1ZA 4X1MA 5HWVA 2ZC6B 1GHMA 3MJQA 3K3CA 3LIDA 3V67A 2QHKA 2IA2A 2J9PA 2P9VB 4S2OA 5FQJA 2O9AA 2EX9A 2P74A 4O8GA 4GZBA 1YLTA 2X01A 4P85A 1T1BA 4GHIA 1LL9A 4JBFA 2FFFB 5HDDA 1EROA 3JVVA 5FI6A 1SZVA 1CK3A 3CI6A 1PWDA 4LCLA 3QP4A 2M7UA 1ZKJA 1ZHHB 1MWSA 3UN7A 1ES5A 4F3LA 3CWFA 3TOIA 1P9RA 2A24B 3HLDA 4FUWA 4G3KA 5FI2A 3GR2A 3U2AA 3G34A 1YLYA 1OTEA 2ZQAA 5E2GA 4R3AA 5FAOA 1Q2QA 3KX0X 4PM8A 2PHYA 2WGWA 3MXQA 4OLGA 5KIZA 2J3WA 1MWRA 2WKQA 5FQKA 3PR6A 2WADA 1FOFA 1K56D 2I9VA 1K54C 2L1MA 1FCMA 1XPBA 1N4OA 1X0OA 2VGLS 1ES2A 2ZQDA 1PWGA 3V3RA 5HAQA 1T19A 2Y55A 4DF6A 2H10A 5TGFA 4S2JA 4JF5A 3Q82A 5KZHA 2UWXA 3T4TA 2HZ5A 3UMEA 3ZDJA 3Q7ZA 2ZBBA 5F5YA 2E8IA 1TDLA 2O9CA 4O0PA 4PM5A 2EXAA 4YFMA 2V1AA 5G4ZA 3JPUA 4R3BA 1YKDA 4EERA 5GHYA 4MLLA 4QB8A 3IF5A 3NY4A 2B95A 1GCEA 4NEED 1IELA 4GOGA 1LHYA 4Q0JA 4E04A 4D2OA 4WUJA 2P08A 3IX3A 5FEGA 3UO9A 3HUNA 4KQQA 1K4FA 1U60A 2AVXA 2JKRI 1Y54A 3O87A 4WMCD 5C5KA 2EFXA 1SHVA 3VOZA 1UWPX 4P0MA 1PZPA 3UDXA 4QD4A 4DE2A 3NCKA 2PU4A 4KQDA 1Y28A 1BLHA 3IX4A 5HL6A 1I5QA 4WEJA 2R78A 1ES3A 1OTIA 1G6AA 3BFFA 4N9KA 3TG9A 3HLWA 3C38A 1STZA 1TVFA 3MXRA 3QNCA 1N9BA 5U47A 3PBRA 4ZJ2A 3M6HA 4FCFA 1K57A 5CHJA 3O86A 3IT9A 4KG6A 4BQMA 2VK3A 5F82A 4EU0A 1D7EA 3A3DA 2I72A 2DCFA 3HUOA 3ZG0A 3K2NA 5DTTA 4XUZA 5BOHA 3H7WB 3EGDC 2PR6A 4R3JA 1QMEA 1E3UD 4DJ3A 4ME4A 2O0YA 2P04A 2WKHA 3GRJA 3BFGA 3MZEA 4UEYA 3UB9A 2L4RA 2GJ3A 1GSXA 1F5MA 3LICA 2KDKA 3ITBA 1KE4A 2HF6A 1OMEA 2EWVA 4ARZA 4FOFA 3ZCZA 1V9ZA 2JCHA 1YSQA 3RFBA 4E3NA 3B3XA 5I5LA 1GSWA 2ZL1A 4H6JA 3PBSA 4BENA 5FA7A 1L3LA 5EM0A 1TS6A 3IWOA 1XJ2A 2V2FF 4P6ZS 2XROA 3BY8A 2XH9A 4LRZE 3T50A 3ZG9B 4N1XA 4X56A 3LO7A 3G30A 2VGLM 4LFUA 4DE3A 4G3WA 3A3FA 2PRFA 3EQVA 2K2NA 3VP4A 3JVUA 2OOLA 3E4PA 3LR5A 5FSRA 5TJJA 2XFSA 4HBTA 4CLCD 3MBZA 1J9MA 4OPYA 3SOIA 2WZZA 2ZMAA 4ETZA 3MQQA 1VEUA 3A3JA 2Y2PA 4PM6A 5EVIB 3G4PA 3UY6A 4IHQA 2H28A 2HGVA 3T4JA 1TS8A 3NOTC 1ONGA 4I5SA 5IS1A 1Z09A 4JGQA 1YPRA 1H8YA 3B33A 4PKYG 5D3OA 1PI4A 3ZNYA 2C5WB 1PYYA 3QP5A 3HJIA 1MY8A 2WZXA 5HW3A 1MWUA 2QKPA 4OOLA 5F6AA 2HV1A 1CI8A 2PT7A 3MKFA 3PAGA 2VKSA 2V8CA 4MN6A 2WGVA 4UA6A 4L9GA 3NDGA 1O7EA 1F98A 4OKPA 2PYRA 4XUXA 5KSCA 1H8ZA 2XLNA 1UWNX 2Q9NA 1Z6FA 1Y4OA 3Q7VA 4HI4A 4E3JA 5HZHA 1TDGA 3BFEA 4N1HA 3FPWA 1ES4A 3T4QA 4PMAA 5G18A 1L2SA 4MCWA 4G3VA 1PW1A 4K0WA 3F1NB 4PPRA 5A92A 3LIAA 5TR7A 2J3TC 1OJ5A 2D02A 2ZLYA 1IYSA 4X55A 5HAPA 1ACFA 3CG5A 1MWTA 2DNSA 3OZHA 4QHCA 1C3BA 2KLIA 5EOEA 1NY0A 3UE1A 3V5MA 4BLMA 5FAQA 3IHBA 3GQZA 2GNXA 4WZ5C 1YLWA 3BM6A 2VZWA 4ZJ3A 2HJ9C 1DJCA 1K57C 3DTMA 4GS9A 3GTCA 3C30A 3BW6A 5L07A 5GL9A 3N4IA 4PHTA 1S4SA 3C2WA 4Y0UA 3IBJA 3F1OB 4KZ8A 1W8YA 5E2HA 3HLBA 4OQ0A 3NC8A 5M19A 3QP8A 2ZQ9A 2ZQ7A 4GKUA 3IXGA 2HDRA 3VFHA 4EEUA 2VV7A 3N8RA 4P6ZM 1D06A 1T1AA 3UB6A 4K08A 1L0GA 5CECA 3G6OA 5J7EA 2QJ5A 3IQAA 1WYBA 3W4OA 2YKHA 4KUOA 5DF7A 4B88A 1AWIA 4LLOB 1XKZA 3IBRA 4GDBA 3E0YA 5HFOA 4MN7A 1BYWA 3PBOA 2H0TA 3S1YA 4II7A 2WKEA 3F1PB 3HL9A 4ZRRA 4RYEA 4MBHA 3EOIA 4Y17A 3UPOA 4E3IA 2OV5A 5GHXA 4N92A 2INWA 4WEKA 4HBUA 1DJAA 3W8KA 1P97A 5AQBA 1H0MA 3RXXA 5EVEA 2ZOIA 2W3GA 2WAEA 4X1LA 1FILA 3QP6A 4DDYA 2WK0A 3WS5A 4I38A 3G32A 4GHIB 2R9XA 1NRJA 2G2UA 3ZG5A 4FH2A 5A8BA 3S22A 4WBGA 3SS5A 4RQ9A 1KVMA 5F83A 4JLFA 1PNEA 4IBXA 4UAAA 3T1SA 1FQGA 3DTKA 4KZ3A 5TFQA 3S7PA 1HD8A 2ZQ8A 2EX6A 2E8JA 3JYIA 3QP2A 1RCJA 2QMIA 2PR5A 5DFYA 2PD8A 5AQ7A 3R7WB 3SW1A 4OPQA 1HZOA 2PBDP 1P9WA 3OLOA 3LEQA 5A93A 2ZM2A 2X71A 4IEDA 2XDMA 4QJGA 2ZC3B 2OWJA 4BJPA 2WGWB 4HHDA 2HDQA 4HIAA 4YOFA 5EV0A 4S2NC 1MKIA 4DDSA 4NXFA 5DJUA 5CEDA 4Z1WA 3I7JA 3FC7A 4RX2A 4EBLA 4U3TA 2OAP1 3E98A 1VQQA 2XR0A 3BLMA 2RCXA 3MZDA 4QU3A 3VP3A 2HP6A 3A0SA 1FR1A 3ISGA 1ESUA 1M6KA 1TS7A 2IWCA 1YMSA 4O7DA 2V20A 4NK3A 4OOMA 3UE6A 3PYPA 4X68A 1LLBA 4Y0OA 1JTGA 3ZG7B 2IWDA 1AXBA 3TW8A 1NJ4A 4ZDXA 2ZOHA 3ZQ5A 2PYPA 5CTMA 2VGKA 4M4XA 4RVAA 1KDWA 4D60A 1MZUA 1NYMA 4EQ1A 4R0QA 3IF6B 3OPHA 3B47A 3BY9A 3ZVTA 3MQ0A 3MMHA 1LL5A 2QJ7A 3T1QB 2ZMFA 4ETXA 2XD1A 4KQOA 3GECA 4WELA 4KZ4A 1BLSA 4IJGA 1KE0A 3N8LA 2A49A 4OLDA 3ZNTA 3IS2A 1V9YA 2KOIA 4JGRA 1D1JA 3VP0A 2Y2HA 4OVDA 3HLFA 1K0KA 2W3FA 4LGWA 3VOLA 1XX2A 2PDRA 1YMXA 4RA7A 1W63M 3IXDA 4P87A 4BWIA 4FH4A 5FL3A 2EFUA 5CTNA 5EOOA 4WZ5A 4OP8A 5FQIA 3NI9A 1IYQA 1BLCA 1L0FA 1QMFA 2ZM0A 3ZVWA 1DP9A 1FCOA 3LY3A 1NXYA 5TBMB 5HSQA 3DWKA 4GLQA 1W79A 2PAVP 4FSFA 4RX3A 1OT6A 1S4RA 4Z9QA 2QYBA 1EW0A 4QPRA 3LCEA 1W63Q 4K0XA 2W3EA 4ARZB 5AQAA 3TJZC 1YSPA 1F2KA 3SH8A 2ZL1B 1SKFA 4H6JB 2VJWA 2MJ6A 5EVID 4EUZA 4LV1A 1CEFA 2A2LA 1GSVA 3A0VA 3O88A 5CERA 3S7OA 3KSHA 1KOUA 1K56A 2OWHA 1CQAA 4OP5A 5FQQA 1YM1A 1SCWA 3FZCA 5F69A 4ZBEA 3VP2A 2R9WA 4UHUA 1OJGA 4IBRA 1YLZA 4F94A 1O07A 1ESIA 1FSYA 4E6XA 3FYZA 1LSWA 4GNUA 1ZTUA 1K4EA 1PIOA 1M40A 3S7NA 4HY8A 2HP9A 4KZ7A 3T4KA 2HPBA 5EVLA 3SS3A 1XA1A 3MXSA 4HJ4A 4DN0A 3MZFA 4EBPA 2GZAA 2ACGA 1E4DA 3NJAA 4X6TA 3D3OA 3C7UA 4AFIA 3UB8A 5FEFA 5AVFA 2HJEA 3WS1A 4WMCA 5CX7A 4EESA 5GLAA 2Y8HA 3P01A 3CZDA 5FATA 1S1YA 3OCLA 3LY4A 1JVJA 2ZC5B 3LIBA 3HCYA 3V50A 3NHQA 3VE4A 3VOYA 5HDCA 1IYOA 4YWZA 1ODVA 1TS0A 2J80A 3Q7VB 4OQGA 2Z6DA 5AQ9A 3EWKA 5E43A 3M6BA 2WKPA 2ZQCA 1S6RA 3CHWP 3P7NA 2K31A 3LI8A 1TEMA 2B18A 2DMWA 4EWFA 5E2FA 3GDIA 2OSUA 4IUHA 1PRQA 1EI5A 1TF1A 3DW0A 4Y15A 1K38A 4S2NA 4UQIS 3UE3A 3WRZA 5J4EA 5MC7A 1SKOA 2A3UA 4OPRA 1ZG4A 3PAEA 1KGFA 2RL3A 5GLCA 4WLAA 3KSFA 5DFXA 1E3UA 3CUEA 3T4SA 1S0WA 3G35A 4BD1A 3PBNA 1I2WA 4JXVA 1DP6A 4JGPA 4Y5FA 1A0KA 1TD5A 2P7JA 2Y2JA 4DJ2A 1XJ6A 3H82B 3A3EA 3ULFA 1BULA 5DKKA 4HESA 5FQMA 2Y2NA 1BT5A 1WYCA 3SZTA 4LPZA 1CEGA 1GA0A 1BTLA 4WYYA 1SDEA 4KG5A 1YAXA 4I3JA 4DXBA 1K25A 2Z2LB 3EEAA 2CC1A 4LRXC 3BQAA 5HARA 3ZG8B 2V9AA 3UE0A 1G6OA 2VLGA 4MBFA 2EWWA 5KMWA 1W7FA 1PW8A 1N9LA 4OOYA 4LV0A 5J8XA 4E3LA 4P6BA 5CGSA 1OPXA 4X53A 5A91A 3F1NA 4FTXA 4E3KA 1K55A 3BLSA 4QWOA 2VV6A 1G68A 1RGYA 3LIEA 4Y13A 2VA0A 1KDSA 4CLCA 1NYYA 2KX6A 3CPTB 3NDEA 4MN5A 2W3HA 2ZJ9A 3HVFA 3CJMA 5A90A 1XGJA 2Z2MB 3IWIA 3VP1A 1W8QA 2WKRA 2D01A 4OPZA 3HREA 1KGGA 1G5UA 1IKGA 2CMNA 3MFDA 1ALQA 4M3KA 5FAPA 2WUQA 3EQUA 3N7WA 1BUEA 4CJNA 3E2KA 5F1FA 1VETB 4CQHA 1KGEA 2W1TA 1HTZA 3OCNA 3CLOA 2W1RA 5M1AA 3L7HA 1MBLA 3R4KA 4NXGA 3T12B 1F9IA 2WKIA 1OT9A 4KZ5A 3ZGAB 3VFFA 3FPVA 2WGIA 2EX8A 4EUVA 2ZD8A 3OPRA 3QNBA 4OONA 3ZFZA 3W4QA 1N9NA 5HD3A 1EWZA 4HH3A 3LR3A 2GX5A 3OPLA 2IWBA 3TRCA 5AVEA 3RTYA 2XQZA 3LYXA 3K3DA 5E2EA 4I3AA 5EPHA 1PI5A 5JYPA 1FSWA 4R38A 4WM9A 4KZAA 4UQIM 3ZHHA 3HJKA 4LV3A 3NOUC 5DVAA 2V8FA 1XFQA 3L9KA 2X02A 4C75A 3VSLA 4JXSA 2HDUA 1IOUA 5HL1A 2J3TD
chains in the Genus database with same CATH topology
3IX8A 2AVXA 3QP2A 3QP4A 5L07A 4LGWA 1H0MA 4LFUA 3QP5A 4NG2A 3IX3A 5L10A 3IX4A 4Y13A 3JPUA 3QP6A 3QP8A 1L3LA 4Y15A 3SZTA 2Q0OA 5L09A 2UV0E 3QP1A 4Y17A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IX8 A;  2AVX A;  3QP2 A;  3QP4 A;  5L07 A;  4LGW A;  1H0M A;  4LFU A;  3QP5 A;  4NG2 A;  3IX3 A;  5L10 A;  3IX4 A;  4Y13 A;  3JPU A;  3QP6 A;  3QP8 A;  1L3L A;  4Y15 A;  3SZT A;  2Q0O A;  5L09 A;  2UV0 E;  3QP1 A;  4Y17 A; 
#chains in the Genus database with same CATH topology
 3KO6 A;  4F3L B;  4C3Q A;  4N9L A;  4PM7 A;  4X25 A;  2H5S A;  5HX9 A;  1NZO A;  2QPN A;  5J3W A;  2J9O A;  3VE3 A;  3WS2 A;  1T1C A;  1FCN A;  1VM1 A;  4XT2 A;  1OTD A;  4S2L A;  4ZAM A;  4OH0 A;  4NET A;  2ZM8 A;  3NIA A;  4E6W A;  2BG1 A;  2Y2I A;  2LB9 A;  2M1C A;  5FDS A;  3FKV A;  2JBF A;  1JWV A;  4EEP A;  1FR6 A;  4JPM A;  4IVK A;  3MKE A;  1PWC A;  2OLV A;  2OAQ 1;  1N9O A;  4DKI A;  2V0W A;  3G31 A;  1RGZ A;  3AGD A;  3E4Q A;  2LB5 A;  1OTB A;  5GLB A;  1MXO A;  3GSG A;  2Y2L A;  3LI9 A;  5F68 A;  4C6Y A;  3SS4 A;  2Q9M A;  2XGN A;  3GVB A;  3UNW A;  1WE4 A;  4Y2F A;  3PBT A;  3CUE C;  5DTS A;  3FWL A;  3V3S A;  4NG2 A;  2G2W A;  5EVI C;  3V39 A;  3O3V A;  3N6I A;  4BD0 A;  3IXB A;  1XJ4 A;  2P9V A;  3NUL A;  3R7W A;  2BLS A;  3QHY A;  4S2M A;  5CHU A;  1NZU A;  2GDN A;  3KSG A;  3IH9 A;  3NOP C;  4EBN A;  3VMA A;  3A0R A;  3WS4 A;  3IS2 B;  4LCM A;  1HVB A;  3BQ8 A;  3D9Y A;  3VV4 A;  5FDH A;  2QZ6 A;  4DRT A;  5GHZ A;  3OOV A;  1FIK A;  2DRW A;  2VV8 A;  3Q07 A;  3SH7 A;  2W27 A;  1ZG6 A;  3MFX A;  2A24 A;  3Q1F A;  2JKF A;  2OLU A;  5CGW A;  3HLG A;  5CXW A;  4HH2 A;  5IHV A;  4EXO A;  2XA7 M;  3BYD A;  4O01 A;  5HPI A;  1IFQ A;  1MPL A;  2O9B A;  1DJB A;  1YLP A;  2JE5 A;  4OQI A;  3OPP A;  4ZJ1 A;  5DJT A;  4L0L A;  3OBF A;  4PAU A;  4B4X A;  4HNB A;  4MEZ A;  1K55 C;  5DKL A;  2Y2O A;  3BJN A;  4DXC A;  4Y0T A;  3OC2 A;  1E25 A;  4CLC C;  1DP8 A;  4S2P A;  3LUQ A;  4R6L A;  2B5R A;  3Q81 A;  5K5B A;  3LIF A;  4JGO A;  2HP5 A;  3DAV A;  4MDZ A;  1NLZ A;  4R23 A;  4NXB A;  4KQR A;  2Y2K A;  2B02 A;  1L0E A;  4EET B;  3KYE A;  3UDF A;  3IF6 A;  2ZMV A;  2V1B A;  4GD8 A;  1OTA A;  3RJU A;  3E2L A;  2BAS A;  5JYO A;  1CI9 A;  1KVL A;  2L0W A;  4L9E A;  3LR4 A;  1I2S A;  3WRT A;  4A5R A;  4Y3I A;  2Y4A A;  4YNR A;  2JKT M;  2G7U A;  3LR0 A;  5EM1 A;  2ZC7 A;  5CRF A;  5AJG A;  2WYX A;  3BEC A;  5HWW A;  3UDI A;  2XRN A;  3BRM A;  1LT0 A;  1S67 L;  2EX2 A;  2O99 A;  4Q0I A;  1LI9 A;  4KG2 A;  4BBU A;  4B4Z A;  3PBQ A;  5CEB A;  3UB7 A;  2XF3 A;  4HP9 A;  4UA9 A;  4R4R A;  5G4Y A;  4B93 A;  3RH8 B;  4IVI A;  3MR0 A;  2NUP C;  1H3Q A;  3C7V A;  3UB5 P;  3B42 A;  4WF0 A;  4DE1 A;  5HDS A;  2W3D A;  4LRY C;  2BTF P;  3A3I A;  3PXP A;  4CLC E;  4X69 A;  5IT5 A;  1MKM A;  5EEC A;  3C5A A;  2JHE A;  3U4L P;  5TBM A;  5FQ9 A;  3DWZ A;  3SH9 A;  4DMZ A;  3FG8 A;  1IYP A;  5FAS A;  5CHM A;  5L10 A;  3D4F A;  2XSS A;  1XA7 A;  2Q0O A;  1IKI A;  4H8R A;  1VEU B;  2Y79 A;  1CJF A;  1T18 A;  3H7W A;  2FZ0 A;  2FFY A;  1IEM A;  4WN5 A;  1JWP A;  1NWZ A;  4E3M A;  5KSH A;  3KYQ A;  4JF6 A;  1K6S A;  4Q8I A;  2Y91 A;  4EW7 A;  1PZO A;  4IUK A;  3IWQ A;  3ZYT A;  5CGX A;  2M7V A;  5LBR A;  1ONH A;  5DF9 A;  1JNU A;  3EGX C;  1J3W A;  2VX8 A;  1SKO B;  2H0Y A;  3KSI A;  4KZ6 A;  4L9F A;  1P0Z A;  2YKF A;  3ITA A;  3S4X A;  4BBV A;  1XGI A;  2K7S A;  2NUT C;  4DE0 A;  4EV4 A;  1GHP A;  4HJ3 A;  1YT4 A;  4QY5 A;  3IX8 A;  3MS6 A;  4GCZ A;  4GB7 A;  3PHY A;  4HP4 A;  3ICY A;  4MMN A;  4HJ6 A;  2XD5 A;  1K6R A;  2V0U A;  3LFV A;  3HUM A;  4U0X A;  3FV7 A;  3EEH A;  3UPP A;  4GJ4 A;  3H9W A;  5F1G A;  1LSV A;  1ZC2 A;  4Y7P A;  4B9O A;  2Y2G A;  3CMZ A;  3O5Y A;  1VB6 A;  2HDS A;  4GD6 A;  3MQO A;  3M2K A;  3S7Q A;  4R4S A;  1XFN A;  3TSG A;  3TE8 A;  3GMW A;  3G2Z A;  2WAF A;  4KZ9 A;  1XJ3 A;  4BL3 A;  3BEB A;  2J7V A;  5EVI A;  2JKG A;  4LEN A;  1L0D A;  4GW9 A;  3WS0 A;  5L2F A;  3T4L A;  5M18 A;  4GS9 B;  1VHM A;  5I94 A;  1KE3 A;  5EE8 A;  2Y2M A;  1CF0 A;  5DTK A;  2XEP A;  5L09 A;  3HBR A;  3M2J A;  4NKP A;  1NRF A;  3C4P A;  3LGO A;  3LEZ A;  1RP5 A;  1S66 L;  5HWT A;  3T4O A;  1LI0 A;  3BFD A;  2QWS A;  2Y59 A;  5GLD A;  1K54 A;  4QY6 A;  4CLC B;  3P09 A;  4ESP A;  1HLU P;  1GA9 A;  3GV9 A;  2JKR M;  3D72 A;  3IF6 C;  1NLY A;  3MSH A;  3C8C A;  2PD7 A;  4MNR A;  3IH8 A;  1MC0 A;  4LV2 A;  3T1X A;  4R1G A;  2FH5 A;  2VGJ A;  4HOI A;  3FKW A;  3NEC A;  2Z6C A;  1UGU A;  3CIT A;  2V1Z A;  4GDN A;  3T1R A;  1H8M A;  1JWZ A;  5L8M A;  4I39 A;  4NXE A;  2W1T B;  3QP1 A;  1YLJ A;  4KEN B;  3H82 A;  4BMW A;  3RXW A;  4PM9 A;  3UMD A;  4HEF A;  4KUK A;  2EXB A;  4MBK A;  4JF4 A;  4U0T A;  1GHI A;  3UPN A;  4PKY A;  3DTE A;  2EA9 A;  1ERQ A;  2C6W B;  3AGF A;  4S2K A;  1JTD A;  3W4P A;  2Y2Q A;  3MF0 A;  4JXG A;  1SDN A;  1BSG A;  2XA7 S;  5HD5 A;  3P98 A;  3BWL A;  1W5D A;  4JXW A;  1DRM A;  1H5X A;  2W0N A;  1LL8 A;  5FI7 A;  4WL9 A;  2JKT I;  4OQH A;  1BZA A;  4E3O A;  3VSK A;  3AGE A;  1DY6 A;  3N8S A;  1LSX A;  4YIN A;  3F1O A;  3PTE A;  5DF8 A;  4R70 A;  3G2Y A;  4ID4 A;  4ZTK A;  4K91 A;  3WWX A;  3DTI A;  4JKT A;  2J8Y A;  4HQA A;  4Q0H A;  4WZ4 A;  5HAI A;  3CPT A;  3HLE A;  1XP4 A;  4EQI A;  1BLP A;  3IHA A;  1G28 A;  1XXM A;  1Q2P A;  1YQS A;  4XT2 B;  1WA9 A;  3C4O A;  4I3I A;  3CAX A;  3BFC A;  1ERM A;  4GN2 A;  4UA7 A;  4FD8 A;  3W2Z A;  5IU1 A;  4CPK A;  4XXR A;  4KZB A;  5EFW A;  2XFT A;  2ZC4 B;  2VEA A;  4BBT A;  2PU2 A;  5EUA A;  2UV0 E;  3DBA A;  2JN7 A;  2XK1 A;  2PBY A;  3HLC A;  1VET A;  3E4O A;  3F1P A;  4S2I A;  3KYZ A;  3NBL A;  3IXH A;  1PFL A;  4BL2 A;  2JC7 A;  5HPF A;  1S1Z A;  4X1M A;  5HWV A;  2ZC6 B;  1GHM A;  3MJQ A;  3K3C A;  3LID A;  3V67 A;  2QHK A;  2IA2 A;  2J9P A;  2P9V B;  4S2O A;  5FQJ A;  2O9A A;  2EX9 A;  2P74 A;  4O8G A;  4GZB A;  1YLT A;  2X01 A;  4P85 A;  1T1B A;  4GHI A;  1LL9 A;  4JBF A;  2FFF B;  5HDD A;  1ERO A;  3JVV A;  5FI6 A;  1SZV A;  1CK3 A;  3CI6 A;  1PWD A;  4LCL A;  3QP4 A;  2M7U A;  1ZKJ A;  1ZHH B;  1MWS A;  3UN7 A;  1ES5 A;  4F3L A;  3CWF A;  3TOI A;  1P9R A;  2A24 B;  3HLD A;  4FUW A;  4G3K A;  5FI2 A;  3GR2 A;  3U2A A;  3G34 A;  1YLY A;  1OTE A;  2ZQA A;  5E2G A;  4R3A A;  5FAO A;  1Q2Q A;  3KX0 X;  4PM8 A;  2PHY A;  2WGW A;  3MXQ A;  4OLG A;  5KIZ A;  2J3W A;  1MWR A;  2WKQ A;  5FQK A;  3PR6 A;  2WAD A;  1FOF A;  1K56 D;  2I9V A;  1K54 C;  2L1M A;  1FCM A;  1XPB A;  1N4O A;  1X0O A;  2VGL S;  1ES2 A;  2ZQD A;  1PWG A;  3V3R A;  5HAQ A;  1T19 A;  2Y55 A;  4DF6 A;  2H10 A;  5TGF A;  4S2J A;  4JF5 A;  3Q82 A;  5KZH A;  2UWX A;  3T4T A;  2HZ5 A;  3UME A;  3ZDJ A;  3Q7Z A;  2ZBB A;  5F5Y A;  2E8I A;  1TDL A;  2O9C A;  4O0P A;  4PM5 A;  2EXA A;  4YFM A;  2V1A A;  5G4Z A;  3JPU A;  4R3B A;  1YKD A;  4EER A;  5GHY A;  4MLL A;  4QB8 A;  3IF5 A;  3NY4 A;  2B95 A;  1GCE A;  4NEE D;  1IEL A;  4GOG A;  1LHY A;  4Q0J A;  4E04 A;  4D2O A;  4WUJ A;  2P08 A;  3IX3 A;  5FEG A;  3UO9 A;  3HUN A;  4KQQ A;  1K4F A;  1U60 A;  2AVX A;  2JKR I;  1Y54 A;  3O87 A;  4WMC D;  5C5K A;  2EFX A;  1SHV A;  3VOZ A;  1UWP X;  4P0M A;  1PZP A;  3UDX A;  4QD4 A;  4DE2 A;  3NCK A;  2PU4 A;  4KQD A;  1Y28 A;  1BLH A;  3IX4 A;  5HL6 A;  1I5Q A;  4WEJ A;  2R78 A;  1ES3 A;  1OTI A;  1G6A A;  3BFF A;  4N9K A;  3TG9 A;  3HLW A;  3C38 A;  1STZ A;  1TVF A;  3MXR A;  3QNC A;  1N9B A;  5U47 A;  3PBR A;  4ZJ2 A;  3M6H A;  4FCF A;  1K57 A;  5CHJ A;  3O86 A;  3IT9 A;  4KG6 A;  4BQM A;  2VK3 A;  5F82 A;  4EU0 A;  1D7E A;  3A3D A;  2I72 A;  2DCF A;  3HUO A;  3ZG0 A;  3K2N A;  5DTT A;  4XUZ A;  5BOH A;  3H7W B;  3EGD C;  2PR6 A;  4R3J A;  1QME A;  1E3U D;  4DJ3 A;  4ME4 A;  2O0Y A;  2P04 A;  2WKH A;  3GRJ A;  3BFG A;  3MZE A;  4UEY A;  3UB9 A;  2L4R A;  2GJ3 A;  1GSX A;  1F5M A;  3LIC A;  2KDK A;  3ITB A;  1KE4 A;  2HF6 A;  1OME A;  2EWV A;  4ARZ A;  4FOF A;  3ZCZ A;  1V9Z A;  2JCH A;  1YSQ A;  3RFB A;  4E3N A;  3B3X A;  5I5L A;  1GSW A;  2ZL1 A;  4H6J A;  3PBS A;  4BEN A;  5FA7 A;  1L3L A;  5EM0 A;  1TS6 A;  3IWO A;  1XJ2 A;  2V2F F;  4P6Z S;  2XRO A;  3BY8 A;  2XH9 A;  4LRZ E;  3T50 A;  3ZG9 B;  4N1X A;  4X56 A;  3LO7 A;  3G30 A;  2VGL M;  4LFU A;  4DE3 A;  4G3W A;  3A3F A;  2PRF A;  3EQV A;  2K2N A;  3VP4 A;  3JVU A;  2OOL A;  3E4P A;  3LR5 A;  5FSR A;  5TJJ A;  2XFS A;  4HBT A;  4CLC D;  3MBZ A;  1J9M A;  4OPY A;  3SOI A;  2WZZ A;  2ZMA A;  4ETZ A;  3MQQ A;  1VEU A;  3A3J A;  2Y2P A;  4PM6 A;  5EVI B;  3G4P A;  3UY6 A;  4IHQ A;  2H28 A;  2HGV A;  3T4J A;  1TS8 A;  3NOT C;  1ONG A;  4I5S A;  5IS1 A;  1Z09 A;  4JGQ A;  1YPR A;  1H8Y A;  3B33 A;  4PKY G;  5D3O A;  1PI4 A;  3ZNY A;  2C5W B;  1PYY A;  3QP5 A;  3HJI A;  1MY8 A;  2WZX A;  5HW3 A;  1MWU A;  2QKP A;  4OOL A;  5F6A A;  2HV1 A;  1CI8 A;  2PT7 A;  3MKF A;  3PAG A;  2VKS A;  2V8C A;  4MN6 A;  2WGV A;  4UA6 A;  4L9G A;  3NDG A;  1O7E A;  1F98 A;  4OKP A;  2PYR A;  4XUX A;  5KSC A;  1H8Z A;  2XLN A;  1UWN X;  2Q9N A;  1Z6F A;  1Y4O A;  3Q7V A;  4HI4 A;  4E3J A;  5HZH A;  1TDG A;  3BFE A;  4N1H A;  3FPW A;  1ES4 A;  3T4Q A;  4PMA A;  5G18 A;  1L2S A;  4MCW A;  4G3V A;  1PW1 A;  4K0W A;  3F1N B;  4PPR A;  5A92 A;  3LIA A;  5TR7 A;  2J3T C;  1OJ5 A;  2D02 A;  2ZLY A;  1IYS A;  4X55 A;  5HAP A;  1ACF A;  3CG5 A;  1MWT A;  2DNS A;  3OZH A;  4QHC A;  1C3B A;  2KLI A;  5EOE A;  1NY0 A;  3UE1 A;  3V5M A;  4BLM A;  5FAQ A;  3IHB A;  3GQZ A;  2GNX A;  4WZ5 C;  1YLW A;  3BM6 A;  2VZW A;  4ZJ3 A;  2HJ9 C;  1DJC A;  1K57 C;  3DTM A;  4GS9 A;  3GTC A;  3C30 A;  3BW6 A;  5L07 A;  5GL9 A;  3N4I A;  4PHT A;  1S4S A;  3C2W A;  4Y0U A;  3IBJ A;  3F1O B;  4KZ8 A;  1W8Y A;  5E2H A;  3HLB A;  4OQ0 A;  3NC8 A;  5M19 A;  3QP8 A;  2ZQ9 A;  2ZQ7 A;  4GKU A;  3IXG A;  2HDR A;  3VFH A;  4EEU A;  2VV7 A;  3N8R A;  4P6Z M;  1D06 A;  1T1A A;  3UB6 A;  4K08 A;  1L0G A;  5CEC A;  3G6O A;  5J7E A;  2QJ5 A;  3IQA A;  1WYB A;  3W4O A;  2YKH A;  4KUO A;  5DF7 A;  4B88 A;  1AWI A;  4LLO B;  1XKZ A;  3IBR A;  4GDB A;  3E0Y A;  5HFO A;  4MN7 A;  1BYW A;  3PBO A;  2H0T A;  3S1Y A;  4II7 A;  2WKE A;  3F1P B;  3HL9 A;  4ZRR A;  4RYE A;  4MBH A;  3EOI A;  4Y17 A;  3UPO A;  4E3I A;  2OV5 A;  5GHX A;  4N92 A;  2INW A;  4WEK A;  4HBU A;  1DJA A;  3W8K A;  1P97 A;  5AQB A;  1H0M A;  3RXX A;  5EVE A;  2ZOI A;  2W3G A;  2WAE A;  4X1L A;  1FIL A;  3QP6 A;  4DDY A;  2WK0 A;  3WS5 A;  4I38 A;  3G32 A;  4GHI B;  2R9X A;  1NRJ A;  2G2U A;  3ZG5 A;  4FH2 A;  5A8B A;  3S22 A;  4WBG A;  3SS5 A;  4RQ9 A;  1KVM A;  5F83 A;  4JLF A;  1PNE A;  4IBX A;  4UAA A;  3T1S A;  1FQG A;  3DTK A;  4KZ3 A;  5TFQ A;  3S7P A;  1HD8 A;  2ZQ8 A;  2EX6 A;  2E8J A;  3JYI A;  3QP2 A;  1RCJ A;  2QMI A;  2PR5 A;  5DFY A;  2PD8 A;  5AQ7 A;  3R7W B;  3SW1 A;  4OPQ A;  1HZO A;  2PBD P;  1P9W A;  3OLO A;  3LEQ A;  5A93 A;  2ZM2 A;  2X71 A;  4IED A;  2XDM A;  4QJG A;  2ZC3 B;  2OWJ A;  4BJP A;  2WGW B;  4HHD A;  2HDQ A;  4HIA A;  4YOF A;  5EV0 A;  4S2N C;  1MKI A;  4DDS A;  4NXF A;  5DJU A;  5CED A;  4Z1W A;  3I7J A;  3FC7 A;  4RX2 A;  4EBL A;  4U3T A;  2OAP 1;  3E98 A;  1VQQ A;  2XR0 A;  3BLM A;  2RCX A;  3MZD A;  4QU3 A;  3VP3 A;  2HP6 A;  3A0S A;  1FR1 A;  3ISG A;  1ESU A;  1M6K A;  1TS7 A;  2IWC A;  1YMS A;  4O7D A;  2V20 A;  4NK3 A;  4OOM A;  3UE6 A;  3PYP A;  4X68 A;  1LLB A;  4Y0O A;  1JTG A;  3ZG7 B;  2IWD A;  1AXB A;  3TW8 A;  1NJ4 A;  4ZDX A;  2ZOH A;  3ZQ5 A;  2PYP A;  5CTM A;  2VGK A;  4M4X A;  4RVA A;  1KDW A;  4D60 A;  1MZU A;  1NYM A;  4EQ1 A;  4R0Q A;  3IF6 B;  3OPH A;  3B47 A;  3BY9 A;  3ZVT A;  3MQ0 A;  3MMH A;  1LL5 A;  2QJ7 A;  3T1Q B;  2ZMF A;  4ETX A;  2XD1 A;  4KQO A;  3GEC A;  4WEL A;  4KZ4 A;  1BLS A;  4IJG A;  1KE0 A;  3N8L A;  2A49 A;  4OLD A;  3ZNT A;  3IS2 A;  1V9Y A;  2KOI A;  4JGR A;  1D1J A;  3VP0 A;  2Y2H A;  4OVD A;  3HLF A;  1K0K A;  2W3F A;  4LGW A;  3VOL A;  1XX2 A;  2PDR A;  1YMX A;  4RA7 A;  1W63 M;  3IXD A;  4P87 A;  4BWI A;  4FH4 A;  5FL3 A;  2EFU A;  5CTN A;  5EOO A;  4WZ5 A;  4OP8 A;  5FQI A;  3NI9 A;  1IYQ A;  1BLC A;  1L0F A;  1QMF A;  2ZM0 A;  3ZVW A;  1DP9 A;  1FCO A;  3LY3 A;  1NXY A;  5TBM B;  5HSQ A;  3DWK A;  4GLQ A;  1W79 A;  2PAV P;  4FSF A;  4RX3 A;  1OT6 A;  1S4R A;  4Z9Q A;  2QYB A;  1EW0 A;  4QPR A;  3LCE A;  1W63 Q;  4K0X A;  2W3E A;  4ARZ B;  5AQA A;  3TJZ C;  1YSP A;  1F2K A;  3SH8 A;  2ZL1 B;  1SKF A;  4H6J B;  2VJW A;  2MJ6 A;  5EVI D;  4EUZ A;  4LV1 A;  1CEF A;  2A2L A;  1GSV A;  3A0V A;  3O88 A;  5CER A;  3S7O A;  3KSH A;  1KOU A;  1K56 A;  2OWH A;  1CQA A;  4OP5 A;  5FQQ A;  1YM1 A;  1SCW A;  3FZC A;  5F69 A;  4ZBE A;  3VP2 A;  2R9W A;  4UHU A;  1OJG A;  4IBR A;  1YLZ A;  4F94 A;  1O07 A;  1ESI A;  1FSY A;  4E6X A;  3FYZ A;  1LSW A;  4GNU A;  1ZTU A;  1K4E A;  1PIO A;  1M40 A;  3S7N A;  4HY8 A;  2HP9 A;  4KZ7 A;  3T4K A;  2HPB A;  5EVL A;  3SS3 A;  1XA1 A;  3MXS A;  4HJ4 A;  4DN0 A;  3MZF A;  4EBP A;  2GZA A;  2ACG A;  1E4D A;  3NJA A;  4X6T A;  3D3O A;  3C7U A;  4AFI A;  3UB8 A;  5FEF A;  5AVF A;  2HJE A;  3WS1 A;  4WMC A;  5CX7 A;  4EES A;  5GLA A;  2Y8H A;  3P01 A;  3CZD A;  5FAT A;  1S1Y A;  3OCL A;  3LY4 A;  1JVJ A;  2ZC5 B;  3LIB A;  3HCY A;  3V50 A;  3NHQ A;  3VE4 A;  3VOY A;  5HDC A;  1IYO A;  4YWZ A;  1ODV A;  1TS0 A;  2J80 A;  3Q7V B;  4OQG A;  2Z6D A;  5AQ9 A;  3EWK A;  5E43 A;  3M6B A;  2WKP A;  2ZQC A;  1S6R A;  3CHW P;  3P7N A;  2K31 A;  3LI8 A;  1TEM A;  2B18 A;  2DMW A;  4EWF A;  5E2F A;  3GDI A;  2OSU A;  4IUH A;  1PRQ A;  1EI5 A;  1TF1 A;  3DW0 A;  4Y15 A;  1K38 A;  4S2N A;  4UQI S;  3UE3 A;  3WRZ A;  5J4E A;  5MC7 A;  1SKO A;  2A3U A;  4OPR A;  1ZG4 A;  3PAE A;  1KGF A;  2RL3 A;  5GLC A;  4WLA A;  3KSF A;  5DFX A;  1E3U A;  3CUE A;  3T4S A;  1S0W A;  3G35 A;  4BD1 A;  3PBN A;  1I2W A;  4JXV A;  1DP6 A;  4JGP A;  4Y5F A;  1A0K A;  1TD5 A;  2P7J A;  2Y2J A;  4DJ2 A;  1XJ6 A;  3H82 B;  3A3E A;  3ULF A;  1BUL A;  5DKK A;  4HES A;  5FQM A;  2Y2N A;  1BT5 A;  1WYC A;  3SZT A;  4LPZ A;  1CEG A;  1GA0 A;  1BTL A;  4WYY A;  1SDE A;  4KG5 A;  1YAX A;  4I3J A;  4DXB A;  1K25 A;  2Z2L B;  3EEA A;  2CC1 A;  4LRX C;  3BQA A;  5HAR A;  3ZG8 B;  2V9A A;  3UE0 A;  1G6O A;  2VLG A;  4MBF A;  2EWW A;  5KMW A;  1W7F A;  1PW8 A;  1N9L A;  4OOY A;  4LV0 A;  5J8X A;  4E3L A;  4P6B A;  5CGS A;  1OPX A;  4X53 A;  5A91 A;  3F1N A;  4FTX A;  4E3K A;  1K55 A;  3BLS A;  4QWO A;  2VV6 A;  1G68 A;  1RGY A;  3LIE A;  4Y13 A;  2VA0 A;  1KDS A;  4CLC A;  1NYY A;  2KX6 A;  3CPT B;  3NDE A;  4MN5 A;  2W3H A;  2ZJ9 A;  3HVF A;  3CJM A;  5A90 A;  1XGJ A;  2Z2M B;  3IWI A;  3VP1 A;  1W8Q A;  2WKR A;  2D01 A;  4OPZ A;  3HRE A;  1KGG A;  1G5U A;  1IKG A;  2CMN A;  3MFD A;  1ALQ A;  4M3K A;  5FAP A;  2WUQ A;  3EQU A;  3N7W A;  1BUE A;  4CJN A;  3E2K A;  5F1F A;  1VET B;  4CQH A;  1KGE A;  2W1T A;  1HTZ A;  3OCN A;  3CLO A;  2W1R A;  5M1A A;  3L7H A;  1MBL A;  3R4K A;  4NXG A;  3T12 B;  1F9I A;  2WKI A;  1OT9 A;  4KZ5 A;  3ZGA B;  3VFF A;  3FPV A;  2WGI A;  2EX8 A;  4EUV A;  2ZD8 A;  3OPR A;  3QNB A;  4OON A;  3ZFZ A;  3W4Q A;  1N9N A;  5HD3 A;  1EWZ A;  4HH3 A;  3LR3 A;  2GX5 A;  3OPL A;  2IWB A;  3TRC A;  5AVE A;  3RTY A;  2XQZ A;  3LYX A;  3K3D A;  5E2E A;  4I3A A;  5EPH A;  1PI5 A;  5JYP A;  1FSW A;  4R38 A;  4WM9 A;  4KZA A;  4UQI M;  3ZHH A;  3HJK A;  4LV3 A;  3NOU C;  5DVA A;  2V8F A;  1XFQ A;  3L9K A;  2X02 A;  4C75 A;  3VSL A;  4JXS A;  2HDU A;  1IOU A;  5HL1 A;  2J3T D; 
#chains in the Genus database with same CATH homology
 3IX8 A;  2AVX A;  3QP2 A;  3QP4 A;  5L07 A;  4LGW A;  1H0M A;  4LFU A;  3QP5 A;  4NG2 A;  3IX3 A;  5L10 A;  3IX4 A;  4Y13 A;  3JPU A;  3QP6 A;  3QP8 A;  1L3L A;  4Y15 A;  3SZT A;  2Q0O A;  5L09 A;  2UV0 E;  3QP1 A;  4Y17 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...