5L10A

Crystal structure of n-acylhomoserine lactone dependent luxr family transcriptionl factor cepr2 from burkholderia cenocepacia
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
172
structure length
172
Chain Sequence
NAMDLTILHDCFDALQRAPTAEAAFPPIAAAAAALGFRYCVYGLRRTLPLARPDMQIVGNHPREWEHRYVKFGYVTIDPIIKRVASQPRPVVWNAFDEPGDTAFWHDAACFGMRYGWSHGGYDRAGNLGVLTLVRDTTPLDADEISRLRAPCASLSHAAHAYLMPRLADPIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords N-acylhomoserine lactone dependent regulatory protein
publication title Crystal Structure of N-Acylhomoserine Lactone Dependent LuxR Family Transcriptionl Factor CepR2 from Burkholderia cenocepacia.
rcsb
source organism Burkholderia cenocepacia (strain atcc baa-245 / dsm 16553 / lmg 16656 / nctc 132
total genus 47
structure length 172
sequence length 172
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2016-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03472 Autoind_bind Autoinducer binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.80 Alpha Beta 2-Layer Sandwich Beta-Lactamase Transcription factor LuxR-like, autoinducer-binding domain 5l10A00
2AVXA 3IX8A 5L07A 1L3LA 5L09A 2UV0E 3JPUA 3QP6A 3SZTA 3QP4A 4LGWA 3QP2A 4Y13A 4NG2A 5L10A 4Y17A 2Q0OA 3QP1A 1H0MA 4Y15A 4LFUA 3IX4A 3IX3A 3QP5A 3QP8A
chains in the Genus database with same CATH superfamily
3ZQ5A 3DBAA 4GNUA 3LO7A 4ZRRA 1K54C 3NBLA 3D3OA 1MC0A 2P7JA 3E98A 1P0ZA 2V1AA 5IHVA 5DVAA 5FATA 1K38A 4WN5A 5L2FA 3G2ZA 3W2ZA 3BFDA 2WGWB 4HIAA 1FILA 1YQSA 2WZXA 3QP8A 4MN5A 4H6JA 5AQ7A 4Q8IA 3O3VA 4EUVA 2XF3A 2HP9A 3S22A 1ES4A 2XQZA 3LCEA 3V5MA 3FPVA 1XX2A 3R4KA 1IOUA 3HLCA 4XT2B 5DJUA 2I72A 2Z2LB 5U47A 5HAIA 3NOUC 2HJ9C 1OTAA 2L0WA 2Y59A 5A90A 3D9YA 3QP5A 4KG6A 2XDMA 1OTBA 5EVEA 3LGOA 3UDFA 4E6WA 1UGUA 3UMDA 4RVAA 5L09A 1P97A 1TS6A 3T1RA 1MWTA 4PHTA 4KZ7A 3SH7A 2E8JA 2P08A 1SDNA 2KDKA 5M18A 3UMEA 5CERA 3WS5A 3FKVA 1XJ3A 4FOFA 3MFXA 4MDZA 3ZHHA 4MBHA 3FYZA 2ACGA 3BYDA 4PAUA 4C3QA 3D72A 5AVEA 1P9WA 1VQQA 1FR1A 1DJAA 1K55A 3UB8A 4GDBA 5HX9A 3S7OA 4EQ1A 4NEED 4CPKA 3N8RA 1NZOA 3LICA 3TE8A 3MR0A 4R70A 3IWOA 1J3WA 4LENA 4I3AA 2QPNA 5F5YA 3ZNTA 1GHMA 1YT4A 1NXYA 4GCZA 3NI9A 1FCNA 3VP3A 4HJ3A 1JVJA 3F1OA 5KSCA 2ZL1A 1IELA 1BLPA 5EVIA 1M40A 1YLPA 4FSFA 4FUWA 3OOVA 5A91A 2ZQCA 1K55C 5BOHA 3T1QB 4X68A 1K56D 3O5YA 4HJ4A 1ACFA 5A93A 3NY4A 4ZJ3A 4QPRA 5JYOA 3DTIA 3V39A 2Y79A 4HH2A 1DJBA 3C4PA 2EFXA 5HAPA 5EVIC 2ZC4B 4ME4A 4U0TA 3L9KA 1E25A 2I9VA 4N9LA 1S6RA 4IBXA 2K7SA 4MLLA 5FSRA 4KZBA 3BM6A 2Y2GA 3FV7A 5I5LA 3BFEA 2W27A 4E3JA 2WZZA 2OWHA 3HLDA 4OLDA 4FTXA 1KE0A 1Z6FA 4QWOA 1V9YA 5EUAA 1OTEA 3BY9A 2LB5A 3V3SA 2QJ5A 4KQDA 3DAVA 2WAFA 1S0WA 3PTEA 2PBDP 3UNWA 1TS0A 3VP0A 3OCNA 2OAQ1 2WUQA 4BL2A 5CTNA 4WUJA 3T4OA 1S4RA 4BJPA 3VOYA 1YAXA 4OOYA 5FAQA 3GMWA 3KO6A 4PKYA 4O8GA 5FL3A 3RH8B 1A0KA 3A3IA 1NZUA 2V1BA 5HD3A 4R3BA 3HUOA 2VV6A 4OOLA 4WEKA 3DTEA 4JXWA 4HHDA 1BT5A 3K2NA 4OPZA 4EEPA 2FFYA 3TJZC 2PHYA 1S66L 4CLCE 2JE5A 1YM1A 2M1CA 2V8CA 2ZD8A 3WRZA 2ZJ9A 3QHYA 4UA9A 2Y2KA 1LI0A 1CI9A 1YMSA 3UPOA 4CLCA 3A3FA 3EQUA 4UHUA 5EV0A 1OJ5A 3LR0A 1QMFA 4DKIA 3PBTA 5DF9A 1ZHHB 4EWFA 3T50A 1SZVA 3CG5A 4CJNA 3LFVA 2DNSA 1IEMA 2XR0A 3HVFA 2HZ5A 1H8ZA 2ZC3B 2GDNA 2PU4A 3UPNA 4OPQA 5FA7A 1UWPX 4PM9A 2JC7A 1TVFA 2XRNA 5GLCA 3C7VA 3PBRA 4CLCC 2PR5A 3LEZA 5GHXA 5IS1A 4YFMA 3GQZA 4X56A 2XD1A 2Y55A 3NHQA 3W4OA 4E3LA 1L0EA 4X1LA 3V3RA 2Y2IA 1K57A 2B18A 1XA7A 2M7VA 3G31A 2W3EA 2IA2A 2EWVA 3LR3A 4KENB 3RTYA 4EBLA 4R3JA 2EX9A 4I39A 3IS2A 5DKKA 2OAP1 5AJGA 3HUMA 1GSWA 2GZAA 4IUKA 4Z1WA 4CLCB 4GN2A 1FOFA 3T4SA 4HNBA 1MPLA 1Y4OA 3ZG9B 3IH8A 3N6IA 3SS5A 4F3LA 5TFQA 2ZQDA 2L4RA 2XA7S 1K6RA 5J7EA 4ZTKA 3SS3A 1K57C 3TW8A 4Y5FA 4OPYA 1LL9A 1IYQA 3GDIA 4QHCA 3MJQA 1I5QA 3SS4A 4QD4A 4ZBEA 4OLGA 2HDUA 2VV7A 1VETB 3DWZA 1DP6A 2VGLS 4HP4A 5AQAA 5CEDA 5EM1A 4WBGA 5CX7A 3MS6A 4IBRA 3GRJA 4BENA 3FWLA 3MBZA 3VP1A 5CECA 2J9OA 3T1XA 3UE1A 5DTSA 4G3KA 1I2SA 2A2LA 4S2KA 3VP2A 2Y2OA 4E3OA 2R9XA 2H28A 5L8MA 3TG9A 3SZTA 3MXSA 1LT0A 3U2AA 3HLGA 1DJCA 2HV1A 3IS2B 4E3NA 5CEBA 1XJ6A 1G68A 5HWTA 2OLUA 2X02A 5DTTA 4XUXA 2Y2HA 2WGVA 3DW0A 5F1GA 4I3JA 1BZAA 4HQAA 4BLMA 3OC2A 2Y8HA 1AWIA 2DRWA 4UA7A 1ZC2A 2PD8A 1WYCA 3BLMA 3LR5A 3UDIA 4CLCD 1BTLA 4LGWA 4F3LB 2PD7A 5K5BA 2A24B 1XFQA 1FCOA 3MXRA 1GA0A 4O7DA 5HL6A 1YMXA 3C30A 1PWGA 2EXBA 3C5AA 3IBRA 1GCEA 3CI6A 5GLDA 2IWCA 4HOIA 5EVLA 4FH2A 2JKGA 3PAEA 4JGRA 2G7UA 4WF0A 2WGWA 2VGJA 3MQ0A 4Y0OA 1YLZA 4X6TA 4GZBA 4IJGA 5HW3A 2BASA 1PZOA 5E2EA 2ZQAA 4UQIS 4Y2FA 2C5WB 3ZG0A 1OMEA 4EEUA 3F1NA 2XA7M 1W8YA 2YKFA 4GD8A 4XT2A 2Y2MA 3N7WA 4NXEA 3C7UA 3MFDA 1F9IA 4HEFA 3RFBA 3T12B 1G28A 2B02A 4R23A 2X01A 1EW0A 4BQMA 4KQRA 4PM6A 1EWZA 2IWDA 3DWKA 3WWXA 5TR7A 1HLUP 4KUOA 5F82A 3PAGA 3W4PA 3UE6A 3LI8A 3ZFZA 4JBFA 3T4JA 4R38A 2VGKA 1KOUA 2XH9A 3BECA 4B4ZA 2V9AA 1RGYA 3IF6A 2PRFA 4QY5A 5FQIA 3LIBA 3EOIA 5HL1A 3M6HA 2KOIA 3OZHA 5A8BA 3SH9A 3CPTB 4KUKA 3VFFA 4NXBA 4U3TA 1BYWA 1O07A 3OPHA 4DE2A 1XJ4A 4LLOB 1CEFA 3CAXA 3PBOA 5C5KA 4LCLA 2Z2MB 2ZQ9A 3F1NB 1DP8A 4UEYA 1T18A 4NK3A 2Q0OA 2RL3A 3MKFA 4YINA 2PR6A 4KG2A 3IF6C 2K2NA 2J80A 1YSPA 3BY8A 4FD8A 2VX8A 1FIKA 4X55A 4MEZA 2WK0A 1YLTA 1OPXA 2Z6CA 2GJ3A 2XFSA 1XJ2A 5EOOA 1CF0A 2WADA 4CQHA 3H82A 4E3IA 1NJ4A 4UQIM 1LLBA 1S67L 4GHIB 4MCWA 1SHVA 3ZGAB 4QJGA 4Z9QA 3BJNA 3O87A 3IF6B 1W5DA 2CC1A 3WS1A 4FH4A 1Z09A 4LCMA 3BQAA 3NDGA 2EX2A 4H8RA 1GHPA 2HF6A 3GVBA 4U0XA 5L07A 4N9KA 2ZQ8A 1RGZA 5MC7A 1RCJA 3LR4A 2XGNA 4JXSA 3ZVTA 2J9PA 2CMNA 3IT9A 5EFWA 1CQAA 2PBYA 4GDNA 4BBTA 2XROA 2O9CA 3HLBA 3IF5A 2QJ7A 4UAAA 3PBQA 3H9WA 2Q9MA 1GHIA 3Q1FA 4ESPA 4GJ4A 1NLZA 3MZDA 1FSYA 4LRZE 5DFXA 5E43A 3WS4A 4HBTA 4I38A 3KYEA 3H82B 4MN6A 1G5UA 2QHKA 1L0GA 1FR6A 5EOEA 4MBKA 1BUEA 4S2PA 2JKTI 3UO9A 1ZG4A 1S1YA 4LV3A 3VMAA 4IEDA 4A5RA 4OVDA 3GTCA 1WA9A 2Y2LA 1ESUA 2HDQA 1ONGA 3MZEA 2W3HA 4HH3A 4B88A 5FEFA 1NYYA 3HLFA 3W4QA 1HZOA 5HAQA 4EW7A 3VV4A 1MWSA 3IXHA 4E3KA 3UE0A 1U60A 4F94A 3D4FA 2EWWA 1ZKJA 1W63Q 3SOIA 3R7WB 4EBNA 2XSSA 4EU0A 1VM1A 3V67A 3NCKA 1HD8A 5IU1A 1ONHA 5HDSA 2EX8A 5CGSA 2ZBBA 2HPBA 2V2FF 2PYPA 1PW8A 5FASA 1LI9A 1LSWA 2VEAA 4GB7A 3NIAA 3A3JA 4N1XA 2FFFB 4EUZA 3DTKA 3SH8A 1P9RA 1CEGA 3EGXC 4X69A 2B5RA 3N4IA 4S2OA 4WELA 1EROA 2FH5A 2D02A 4ETXA 3I7JA 3QP1A 2O9AA 1D06A 1J9MA 1W79A 3IX3A 4EETB 2OSUA 4Q0HA 2W1TB 3N8LA 3T4KA 3MXQA 3MZFA 3ITBA 2H0TA 1JNUA 3G30A 4K91A 4P85A 4R6LA 2J7VA 3BW6A 1MXOA 2XD5A 2QZ6A 4P87A 4ID4A 2EX6A 3T4QA 1N9BA 1NY0A 4WEJA 5EPHA 2W3FA 1KGFA 3PR6A 3G32A 3NC8A 4XUZA 1JWPA 3P98A 5KIZA 4L0LA 3ZNYA 1YLWA 4S2MA 4OKPA 1Y28A 3ULFA 1VETA 5IT5A 1PFLA 2BG1A 2Y2JA 1F5MA 2JHEA 2VA0A 3CMZA 3ZVWA 3P09A 4WMCD 3LEQA 4B9OA 3F1PA 1PYYA 2XLNA 1XA1A 4ARZA 3HJIA 4LPZA 4GKUA 4FCFA 1H3QA 2VK3A 2WKHA 4KQOA 1OT6A 2Y2NA 1N9NA 4S2NA 3S7PA 1T1BA 4S2JA 1ZTUA 1L0FA 1K4EA 3WRTA 5KZHA 1X0OA 2OLVA 1K4FA 1NYMA 4OQGA 4BBUA 1OTIA 1MBLA 2BTFP 1H8MA 3FC7A 3P7NA 2WKIA 3JPUA 4DRTA 2A24A 2H5SA 1SCWA 2JKTM 2YKHA 2VZWA 3FKWA 2JN7A 4DXBA 2INWA 3PBNA 2B95A 4S2NC 3OCLA 3Q7ZA 1YLJA 1PIOA 5CHMA 3G35A 2W1RA 4YNRA 4NETA 4OPRA 1CK3A 2D01A 2WKPA 2PT7A 4NG2A 4OONA 4DDSA 3CUEA 3QNCA 3HUNA 5HDCA 1LSVA 3V50A 3KSIA 4I5SA 5DF7A 3F1PB 2AVXA 5E2HA 2H0YA 4ARZB 1TS7A 5GLAA 2OV5A 1GA9A 2J3TD 5HDDA 1K25A 2ZMVA 1ES5A 3VOZA 3PXPA 1XGJA 1T19A 1KDSA 3A0VA 2P9VA 1IKGA 5FQMA 1TDGA 4LFUA 3K3DA 3EQVA 3HREA 2V8FA 5M19A 4IVKA 4WYYA 4KZ6A 5AQBA 2HP5A 3WS2A 4QY6A 3LYXA 2H10A 5FI6A 3A0SA 4E04A 1BULA 4EBPA 3BRMA 3ZG5A 3UPPA 1NLYA 1KE4A 3CUEC 5KMWA 3MSHA 4HP9A 4WM9A 3OPLA 4DXCA 5DTKA 4JF6A 3HLWA 4NKPA 3UB7A 5D3OA 4B4XA 1VB6A 4JKTA 3IWIA 4ZJ1A 3E4QA 3EEHA 3T4TA 3NDEA 3E4OA 3EGDC 2WKQA 1OJGA 4PMAA 1UWNX 2V1ZA 1SKFA 3CPTA 3NECA 4KZ5A 1KGEA 2MJ6A 1V9ZA 1PWCA 1E3UA 5GLBA 2JCHA 1XXMA 4DMZA 4JLFA 5CHUA 2M7UA 2V0WA 5FQJA 5F6AA 3HCYA 3KSHA 4LRXC 5CGWA 3QP6A 1BLSA 3SW1A 3ISGA 3QNBA 4DJ2A 4K0XA 4PM8A 3QP2A 4Y13A 5AQ9A 2Y2QA 4P6ZM 4P6BA 1VHMA 5TGFA 1K6SA 1G6AA 1YKDA 2P9VB 5HFOA 3G4PA 3VE3A 3B3XA 4R0QA 1W7FA 3IBJA 4C6YA 3G2YA 4Y0TA 5TJJA 4EQIA 1PW1A 1D1JA 3Q7VA 1VEUA 4GS9B 2PDRA 3CITA 1N4OA 4GHIA 3HLEA 2WGIA 2ZMAA 1KE3A 5G18A 5G4ZA 2HDSA 3BWLA 4R4SA 1XKZA 2DMWA 3L7HA 3UB6A 1C3BA 3UB5P 4BD0A 3C8CA 1H0MA 4LV0A 4M3KA 4RX2A 3GECA 4DF6A 1YPRA 5CHJA 1IKIA 1I2WA 3MQQA 1BSGA 3UB9A 5F69A 4G3VA 5CXWA 3BLSA 4GOGA 1LSXA 3C4OA 1LHYA 3GV9A 4S2IA 1IFQA 1MY8A 4MMNA 1PI4A 1GSXA 1CI8A 3FG8A 4RQ9A 4WL9A 1AXBA 3RXXA 4Y7PA 3RJUA 5J8XA 5FQ9A 2OOLA 4O0PA 2XFTA 4OP8A 4ETZA 2ZMFA 4E3MA 3O88A 5AVFA 3TSGA 3E2LA 3Q7VB 3BFGA 1TS8A 1VEUB 3ZCZA 1MKMA 4N1HA 3CWFA 4Y3IA 3E2KA 3IQAA 5HZHA 5FEGA 3VFHA 1OT9A 1ESIA 1H5XA 5HARA 3IXGA 4PPRA 5FI2A 4DDYA 3OPRA 3Q07A 3LIDA 3N8SA 3B47A 2JKRI 2L1MA 5F1FA 4R4RA 2EA9A 2QMIA 5FI7A 4UA6A 3EEAA 3BEBA 3MKEA 4I3IA 1E3UD 4WZ4A 5HWWA 2FZ0A 5I94A 3IXBA 1ERMA 4BL3A 1F2KA 1SDEA 4DN0A 1ERQA 4Q0JA 2R9WA 3R7WA 2GX5A 3OBFA 2A3UA 1RP5A 1TDLA 1MKIA 5F68A 3LIFA 3GSGA 4NXFA 2WAEA 3JYIA 1TF1A 1MZUA 5LBRA 4Q0IA 3E0YA 4H6JB 1L3LA 4WZ5A 4HJ6A 2ZC6B 1LL5A 3S7NA 4OQHA 5FAPA 3JVUA 4E6XA 5EECA 4WMCA 1FCMA 2ZC5B 2E8IA 5EE8A 2WKRA 3U4LP 4Y0UA 3NOPC 4XXRA 2RCXA 3NULA 2ZM8A 4KZ3A 3QP4A 1JTDA 1TEMA 3NOTC 4GW9A 5J3WA 4KZ8A 3KX0X 1ZG6A 2NUTC 1W63M 5FQQA 3FPWA 4WZ5C 2K31A 2V0UA 5A92A 3O86A 4L9EA 1KVMA 3HJKA 2W1TA 3WS0A 1EI5A 4JXGA 1L2SA 1IYPA 5M1AA 3LY4A 2ZOHA 3UE3A 4DE1A 4HI4A 5GL9A 2O9BA 4HY8A 3ZG8B 1ODVA 4D60A 4JGOA 3T1SA 3DTMA 2J3WA 3A0RA 3PHYA 4GLQA 2ZQ7A 1KGGA 2DCFA 1S1ZA 5F83A 1HVBA 4S2LA 4DE0A 4IVIA 2VKSA 2O99A 3LIAA 3M2KA 2NUPC 1NWZA 2Z6DA 2KX6A 3H7WA 4JGPA 1XPBA 4ZJ2A 4C75A 5GHYA 3F1OB 1KVLA 2ZL1B 5CRFA 1Q2PA 3FZCA 5EVIB 4P0MA 3E4PA 3LY3A 2QWSA 3KYZA 1IYSA 3BFFA 2JBFA 4OH0A 4IHQA 5HSQA 5TBMA 3TRCA 1YLYA 1JTGA 3OPPA 2R78A 2ZOIA 3ICYA 1NRFA 1CJFA 5FQKA 4LV1A 4WLAA 5E2FA 3K3CA 3S1YA 3LUQA 4QU3A 3OLOA 2ZC7A 3UN7A 4IUHA 4BD1A 1F98A 1HTZA 1XFNA 4KZAA 3B42A 4YWZA 3ZG7B 2Q9NA 3CHWP 1DP9A 2J3TC 1W8QA 4ZAMA 1ES3A 2Y91A 3ZYTA 3IWQA 1N9LA 2HDRA 3CJMA 3LIEA 2VV8A 5E2GA 2JKRM 4Y17A 1QMEA 2PU2A 3H7WB 3A3DA 3PBSA 2O0YA 1KDWA 3GR2A 1MWUA 2XEPA 2XK1A 5EVID 5DF8A 4BBVA 5L10A 4KZ9A 5TBMB 5HPFA 4BWIA 3VSKA 1XGIA 4D2OA 4N92A 3M6BA 1OTDA 2UV0E 4PKYG 4OOMA 3JVVA 3IH9A 4RA7A 2EXAA 4JGQA 2W0NA 2PAVP 1PWDA 1WE4A 4DE3A 3M2JA 3A3EA 2OWJA 4LRYC 3KSFA 3NJAA 4EV4A 2W3GA 4K08A 1ES2A 1WYBA 2P04A 3P01A 1G6OA 1FSWA 4HESA 5DKLA 2QKPA 1Q2QA 5DFYA 1TD5A 4EERA 2W3DA 2WYXA 4M4XA 4P6ZS 2ZM0A 4GD6A 2VJWA 5G4YA 5HD5A 2EFUA 3B33A 1SKOA 5JYPA 3IHBA 4JF4A 3HL9A 5FDSA 2UWXA 2A49A 2IWBA 2HGVA 4NXGA 1MWRA 1GSVA 4R1GA 3AGDA 4KG5A 3BQ8A 3HBRA 3IHAA 4HBUA 5FAOA 3EWKA 4DJ3A 2J8YA 1Y54A 3IX8A 3MMHA 1FQGA 4JXVA 4X53A 3S4XA 1BLCA 4MBFA 4PM5A 5CGXA 1STZA 3KSGA 4EXOA 1IYOA 4B93A 3Q81A 2Y4AA 3VOLA 4Y15A 5CTMA 3ZDJA 2VLGA 1M6KA 4BMWA 3PYPA 5GHZA 3C38A 1XP4A 2Y2PA 2WKEA 3MF0A 2ZLYA 3BFCA 4JPMA 4GS9A 3TOIA 4L9FA 2HJEA 4JF5A 1T1CA 4K0WA 1DRMA 2BLSA 4L9GA 3S7QA 2PYRA 2LB9A 1S4SA 4MNRA 2QYBA 1SKOB 3T4LA 1YSQA 4O01A 3RXWA 1ALQA 4RX3A 4X25A 1PRQA 3UY6A 2G2UA 4LV2A 5FDHA 3VE4A 3G34A 3IX4A 4OP5A 4II7A 3W8KA 1PNEA 1E4DA 2KLIA 1PZPA 3C2WA 3VP4A 3G6OA 4PM7A 5DJTA 1JWVA 3UDXA 1LL8A 1N9OA 1O7EA 5HWVA 3Q82A 4KZ4A 2JKFA 2V20A 4AFIA 1D7EA 4OQ0A 4X1MA 3VSLA 1BLHA 5KSHA 3MQOA 4RYEA 2HP6A 5J4EA 1JWZA 1K54A 4EESA 4QB8A 5EM0A 1T1AA 2ZM2A 1K56A 1L0DA 4YOFA 1K0KA 3KYQA 5HPIA 2VGLM 4R3AA 3IXDA 3LI9A 2G2WA 4MN7A 4ZDXA 1NRJA 2P74A 3ITAA 2GNXA 2X71A 1DY6A 3AGEA 3AGFA 3CLOA 4OQIA 1PI5A 2C6WB 3CZDA 1H8YA 4G3WA 4KQQA
chains in the Genus database with same CATH topology
2AVXA 3IX8A 5L07A 1L3LA 5L09A 2UV0E 3JPUA 3QP6A 3SZTA 3QP4A 4LGWA 3QP2A 4Y13A 4NG2A 5L10A 4Y17A 2Q0OA 3QP1A 1H0MA 4Y15A 4LFUA 3IX4A 3IX3A 3QP5A 3QP8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AVX A;  3IX8 A;  5L07 A;  1L3L A;  5L09 A;  2UV0 E;  3JPU A;  3QP6 A;  3SZT A;  3QP4 A;  4LGW A;  3QP2 A;  4Y13 A;  4NG2 A;  5L10 A;  4Y17 A;  2Q0O A;  3QP1 A;  1H0M A;  4Y15 A;  4LFU A;  3IX4 A;  3IX3 A;  3QP5 A;  3QP8 A; 
#chains in the Genus database with same CATH topology
 3ZQ5 A;  3DBA A;  4GNU A;  3LO7 A;  4ZRR A;  1K54 C;  3NBL A;  3D3O A;  1MC0 A;  2P7J A;  3E98 A;  1P0Z A;  2V1A A;  5IHV A;  5DVA A;  5FAT A;  1K38 A;  4WN5 A;  5L2F A;  3G2Z A;  3W2Z A;  3BFD A;  2WGW B;  4HIA A;  1FIL A;  1YQS A;  2WZX A;  3QP8 A;  4MN5 A;  4H6J A;  5AQ7 A;  4Q8I A;  3O3V A;  4EUV A;  2XF3 A;  2HP9 A;  3S22 A;  1ES4 A;  2XQZ A;  3LCE A;  3V5M A;  3FPV A;  1XX2 A;  3R4K A;  1IOU A;  3HLC A;  4XT2 B;  5DJU A;  2I72 A;  2Z2L B;  5U47 A;  5HAI A;  3NOU C;  2HJ9 C;  1OTA A;  2L0W A;  2Y59 A;  5A90 A;  3D9Y A;  3QP5 A;  4KG6 A;  2XDM A;  1OTB A;  5EVE A;  3LGO A;  3UDF A;  4E6W A;  1UGU A;  3UMD A;  4RVA A;  5L09 A;  1P97 A;  1TS6 A;  3T1R A;  1MWT A;  4PHT A;  4KZ7 A;  3SH7 A;  2E8J A;  2P08 A;  1SDN A;  2KDK A;  5M18 A;  3UME A;  5CER A;  3WS5 A;  3FKV A;  1XJ3 A;  4FOF A;  3MFX A;  4MDZ A;  3ZHH A;  4MBH A;  3FYZ A;  2ACG A;  3BYD A;  4PAU A;  4C3Q A;  3D72 A;  5AVE A;  1P9W A;  1VQQ A;  1FR1 A;  1DJA A;  1K55 A;  3UB8 A;  4GDB A;  5HX9 A;  3S7O A;  4EQ1 A;  4NEE D;  4CPK A;  3N8R A;  1NZO A;  3LIC A;  3TE8 A;  3MR0 A;  4R70 A;  3IWO A;  1J3W A;  4LEN A;  4I3A A;  2QPN A;  5F5Y A;  3ZNT A;  1GHM A;  1YT4 A;  1NXY A;  4GCZ A;  3NI9 A;  1FCN A;  3VP3 A;  4HJ3 A;  1JVJ A;  3F1O A;  5KSC A;  2ZL1 A;  1IEL A;  1BLP A;  5EVI A;  1M40 A;  1YLP A;  4FSF A;  4FUW A;  3OOV A;  5A91 A;  2ZQC A;  1K55 C;  5BOH A;  3T1Q B;  4X68 A;  1K56 D;  3O5Y A;  4HJ4 A;  1ACF A;  5A93 A;  3NY4 A;  4ZJ3 A;  4QPR A;  5JYO A;  3DTI A;  3V39 A;  2Y79 A;  4HH2 A;  1DJB A;  3C4P A;  2EFX A;  5HAP A;  5EVI C;  2ZC4 B;  4ME4 A;  4U0T A;  3L9K A;  1E25 A;  2I9V A;  4N9L A;  1S6R A;  4IBX A;  2K7S A;  4MLL A;  5FSR A;  4KZB A;  3BM6 A;  2Y2G A;  3FV7 A;  5I5L A;  3BFE A;  2W27 A;  4E3J A;  2WZZ A;  2OWH A;  3HLD A;  4OLD A;  4FTX A;  1KE0 A;  1Z6F A;  4QWO A;  1V9Y A;  5EUA A;  1OTE A;  3BY9 A;  2LB5 A;  3V3S A;  2QJ5 A;  4KQD A;  3DAV A;  2WAF A;  1S0W A;  3PTE A;  2PBD P;  3UNW A;  1TS0 A;  3VP0 A;  3OCN A;  2OAQ 1;  2WUQ A;  4BL2 A;  5CTN A;  4WUJ A;  3T4O A;  1S4R A;  4BJP A;  3VOY A;  1YAX A;  4OOY A;  5FAQ A;  3GMW A;  3KO6 A;  4PKY A;  4O8G A;  5FL3 A;  3RH8 B;  1A0K A;  3A3I A;  1NZU A;  2V1B A;  5HD3 A;  4R3B A;  3HUO A;  2VV6 A;  4OOL A;  4WEK A;  3DTE A;  4JXW A;  4HHD A;  1BT5 A;  3K2N A;  4OPZ A;  4EEP A;  2FFY A;  3TJZ C;  2PHY A;  1S66 L;  4CLC E;  2JE5 A;  1YM1 A;  2M1C A;  2V8C A;  2ZD8 A;  3WRZ A;  2ZJ9 A;  3QHY A;  4UA9 A;  2Y2K A;  1LI0 A;  1CI9 A;  1YMS A;  3UPO A;  4CLC A;  3A3F A;  3EQU A;  4UHU A;  5EV0 A;  1OJ5 A;  3LR0 A;  1QMF A;  4DKI A;  3PBT A;  5DF9 A;  1ZHH B;  4EWF A;  3T50 A;  1SZV A;  3CG5 A;  4CJN A;  3LFV A;  2DNS A;  1IEM A;  2XR0 A;  3HVF A;  2HZ5 A;  1H8Z A;  2ZC3 B;  2GDN A;  2PU4 A;  3UPN A;  4OPQ A;  5FA7 A;  1UWP X;  4PM9 A;  2JC7 A;  1TVF A;  2XRN A;  5GLC A;  3C7V A;  3PBR A;  4CLC C;  2PR5 A;  3LEZ A;  5GHX A;  5IS1 A;  4YFM A;  3GQZ A;  4X56 A;  2XD1 A;  2Y55 A;  3NHQ A;  3W4O A;  4E3L A;  1L0E A;  4X1L A;  3V3R A;  2Y2I A;  1K57 A;  2B18 A;  1XA7 A;  2M7V A;  3G31 A;  2W3E A;  2IA2 A;  2EWV A;  3LR3 A;  4KEN B;  3RTY A;  4EBL A;  4R3J A;  2EX9 A;  4I39 A;  3IS2 A;  5DKK A;  2OAP 1;  5AJG A;  3HUM A;  1GSW A;  2GZA A;  4IUK A;  4Z1W A;  4CLC B;  4GN2 A;  1FOF A;  3T4S A;  4HNB A;  1MPL A;  1Y4O A;  3ZG9 B;  3IH8 A;  3N6I A;  3SS5 A;  4F3L A;  5TFQ A;  2ZQD A;  2L4R A;  2XA7 S;  1K6R A;  5J7E A;  4ZTK A;  3SS3 A;  1K57 C;  3TW8 A;  4Y5F A;  4OPY A;  1LL9 A;  1IYQ A;  3GDI A;  4QHC A;  3MJQ A;  1I5Q A;  3SS4 A;  4QD4 A;  4ZBE A;  4OLG A;  2HDU A;  2VV7 A;  1VET B;  3DWZ A;  1DP6 A;  2VGL S;  4HP4 A;  5AQA A;  5CED A;  5EM1 A;  4WBG A;  5CX7 A;  3MS6 A;  4IBR A;  3GRJ A;  4BEN A;  3FWL A;  3MBZ A;  3VP1 A;  5CEC A;  2J9O A;  3T1X A;  3UE1 A;  5DTS A;  4G3K A;  1I2S A;  2A2L A;  4S2K A;  3VP2 A;  2Y2O A;  4E3O A;  2R9X A;  2H28 A;  5L8M A;  3TG9 A;  3SZT A;  3MXS A;  1LT0 A;  3U2A A;  3HLG A;  1DJC A;  2HV1 A;  3IS2 B;  4E3N A;  5CEB A;  1XJ6 A;  1G68 A;  5HWT A;  2OLU A;  2X02 A;  5DTT A;  4XUX A;  2Y2H A;  2WGV A;  3DW0 A;  5F1G A;  4I3J A;  1BZA A;  4HQA A;  4BLM A;  3OC2 A;  2Y8H A;  1AWI A;  2DRW A;  4UA7 A;  1ZC2 A;  2PD8 A;  1WYC A;  3BLM A;  3LR5 A;  3UDI A;  4CLC D;  1BTL A;  4LGW A;  4F3L B;  2PD7 A;  5K5B A;  2A24 B;  1XFQ A;  1FCO A;  3MXR A;  1GA0 A;  4O7D A;  5HL6 A;  1YMX A;  3C30 A;  1PWG A;  2EXB A;  3C5A A;  3IBR A;  1GCE A;  3CI6 A;  5GLD A;  2IWC A;  4HOI A;  5EVL A;  4FH2 A;  2JKG A;  3PAE A;  4JGR A;  2G7U A;  4WF0 A;  2WGW A;  2VGJ A;  3MQ0 A;  4Y0O A;  1YLZ A;  4X6T A;  4GZB A;  4IJG A;  5HW3 A;  2BAS A;  1PZO A;  5E2E A;  2ZQA A;  4UQI S;  4Y2F A;  2C5W B;  3ZG0 A;  1OME A;  4EEU A;  3F1N A;  2XA7 M;  1W8Y A;  2YKF A;  4GD8 A;  4XT2 A;  2Y2M A;  3N7W A;  4NXE A;  3C7U A;  3MFD A;  1F9I A;  4HEF A;  3RFB A;  3T12 B;  1G28 A;  2B02 A;  4R23 A;  2X01 A;  1EW0 A;  4BQM A;  4KQR A;  4PM6 A;  1EWZ A;  2IWD A;  3DWK A;  3WWX A;  5TR7 A;  1HLU P;  4KUO A;  5F82 A;  3PAG A;  3W4P A;  3UE6 A;  3LI8 A;  3ZFZ A;  4JBF A;  3T4J A;  4R38 A;  2VGK A;  1KOU A;  2XH9 A;  3BEC A;  4B4Z A;  2V9A A;  1RGY A;  3IF6 A;  2PRF A;  4QY5 A;  5FQI A;  3LIB A;  3EOI A;  5HL1 A;  3M6H A;  2KOI A;  3OZH A;  5A8B A;  3SH9 A;  3CPT B;  4KUK A;  3VFF A;  4NXB A;  4U3T A;  1BYW A;  1O07 A;  3OPH A;  4DE2 A;  1XJ4 A;  4LLO B;  1CEF A;  3CAX A;  3PBO A;  5C5K A;  4LCL A;  2Z2M B;  2ZQ9 A;  3F1N B;  1DP8 A;  4UEY A;  1T18 A;  4NK3 A;  2Q0O A;  2RL3 A;  3MKF A;  4YIN A;  2PR6 A;  4KG2 A;  3IF6 C;  2K2N A;  2J80 A;  1YSP A;  3BY8 A;  4FD8 A;  2VX8 A;  1FIK A;  4X55 A;  4MEZ A;  2WK0 A;  1YLT A;  1OPX A;  2Z6C A;  2GJ3 A;  2XFS A;  1XJ2 A;  5EOO A;  1CF0 A;  2WAD A;  4CQH A;  3H82 A;  4E3I A;  1NJ4 A;  4UQI M;  1LLB A;  1S67 L;  4GHI B;  4MCW A;  1SHV A;  3ZGA B;  4QJG A;  4Z9Q A;  3BJN A;  3O87 A;  3IF6 B;  1W5D A;  2CC1 A;  3WS1 A;  4FH4 A;  1Z09 A;  4LCM A;  3BQA A;  3NDG A;  2EX2 A;  4H8R A;  1GHP A;  2HF6 A;  3GVB A;  4U0X A;  5L07 A;  4N9K A;  2ZQ8 A;  1RGZ A;  5MC7 A;  1RCJ A;  3LR4 A;  2XGN A;  4JXS A;  3ZVT A;  2J9P A;  2CMN A;  3IT9 A;  5EFW A;  1CQA A;  2PBY A;  4GDN A;  4BBT A;  2XRO A;  2O9C A;  3HLB A;  3IF5 A;  2QJ7 A;  4UAA A;  3PBQ A;  3H9W A;  2Q9M A;  1GHI A;  3Q1F A;  4ESP A;  4GJ4 A;  1NLZ A;  3MZD A;  1FSY A;  4LRZ E;  5DFX A;  5E43 A;  3WS4 A;  4HBT A;  4I38 A;  3KYE A;  3H82 B;  4MN6 A;  1G5U A;  2QHK A;  1L0G A;  1FR6 A;  5EOE A;  4MBK A;  1BUE A;  4S2P A;  2JKT I;  3UO9 A;  1ZG4 A;  1S1Y A;  4LV3 A;  3VMA A;  4IED A;  4A5R A;  4OVD A;  3GTC A;  1WA9 A;  2Y2L A;  1ESU A;  2HDQ A;  1ONG A;  3MZE A;  2W3H A;  4HH3 A;  4B88 A;  5FEF A;  1NYY A;  3HLF A;  3W4Q A;  1HZO A;  5HAQ A;  4EW7 A;  3VV4 A;  1MWS A;  3IXH A;  4E3K A;  3UE0 A;  1U60 A;  4F94 A;  3D4F A;  2EWW A;  1ZKJ A;  1W63 Q;  3SOI A;  3R7W B;  4EBN A;  2XSS A;  4EU0 A;  1VM1 A;  3V67 A;  3NCK A;  1HD8 A;  5IU1 A;  1ONH A;  5HDS A;  2EX8 A;  5CGS A;  2ZBB A;  2HPB A;  2V2F F;  2PYP A;  1PW8 A;  5FAS A;  1LI9 A;  1LSW A;  2VEA A;  4GB7 A;  3NIA A;  3A3J A;  4N1X A;  2FFF B;  4EUZ A;  3DTK A;  3SH8 A;  1P9R A;  1CEG A;  3EGX C;  4X69 A;  2B5R A;  3N4I A;  4S2O A;  4WEL A;  1ERO A;  2FH5 A;  2D02 A;  4ETX A;  3I7J A;  3QP1 A;  2O9A A;  1D06 A;  1J9M A;  1W79 A;  3IX3 A;  4EET B;  2OSU A;  4Q0H A;  2W1T B;  3N8L A;  3T4K A;  3MXQ A;  3MZF A;  3ITB A;  2H0T A;  1JNU A;  3G30 A;  4K91 A;  4P85 A;  4R6L A;  2J7V A;  3BW6 A;  1MXO A;  2XD5 A;  2QZ6 A;  4P87 A;  4ID4 A;  2EX6 A;  3T4Q A;  1N9B A;  1NY0 A;  4WEJ A;  5EPH A;  2W3F A;  1KGF A;  3PR6 A;  3G32 A;  3NC8 A;  4XUZ A;  1JWP A;  3P98 A;  5KIZ A;  4L0L A;  3ZNY A;  1YLW A;  4S2M A;  4OKP A;  1Y28 A;  3ULF A;  1VET A;  5IT5 A;  1PFL A;  2BG1 A;  2Y2J A;  1F5M A;  2JHE A;  2VA0 A;  3CMZ A;  3ZVW A;  3P09 A;  4WMC D;  3LEQ A;  4B9O A;  3F1P A;  1PYY A;  2XLN A;  1XA1 A;  4ARZ A;  3HJI A;  4LPZ A;  4GKU A;  4FCF A;  1H3Q A;  2VK3 A;  2WKH A;  4KQO A;  1OT6 A;  2Y2N A;  1N9N A;  4S2N A;  3S7P A;  1T1B A;  4S2J A;  1ZTU A;  1L0F A;  1K4E A;  3WRT A;  5KZH A;  1X0O A;  2OLV A;  1K4F A;  1NYM A;  4OQG A;  4BBU A;  1OTI A;  1MBL A;  2BTF P;  1H8M A;  3FC7 A;  3P7N A;  2WKI A;  3JPU A;  4DRT A;  2A24 A;  2H5S A;  1SCW A;  2JKT M;  2YKH A;  2VZW A;  3FKW A;  2JN7 A;  4DXB A;  2INW A;  3PBN A;  2B95 A;  4S2N C;  3OCL A;  3Q7Z A;  1YLJ A;  1PIO A;  5CHM A;  3G35 A;  2W1R A;  4YNR A;  4NET A;  4OPR A;  1CK3 A;  2D01 A;  2WKP A;  2PT7 A;  4NG2 A;  4OON A;  4DDS A;  3CUE A;  3QNC A;  3HUN A;  5HDC A;  1LSV A;  3V50 A;  3KSI A;  4I5S A;  5DF7 A;  3F1P B;  2AVX A;  5E2H A;  2H0Y A;  4ARZ B;  1TS7 A;  5GLA A;  2OV5 A;  1GA9 A;  2J3T D;  5HDD A;  1K25 A;  2ZMV A;  1ES5 A;  3VOZ A;  3PXP A;  1XGJ A;  1T19 A;  1KDS A;  3A0V A;  2P9V A;  1IKG A;  5FQM A;  1TDG A;  4LFU A;  3K3D A;  3EQV A;  3HRE A;  2V8F A;  5M19 A;  4IVK A;  4WYY A;  4KZ6 A;  5AQB A;  2HP5 A;  3WS2 A;  4QY6 A;  3LYX A;  2H10 A;  5FI6 A;  3A0S A;  4E04 A;  1BUL A;  4EBP A;  3BRM A;  3ZG5 A;  3UPP A;  1NLY A;  1KE4 A;  3CUE C;  5KMW A;  3MSH A;  4HP9 A;  4WM9 A;  3OPL A;  4DXC A;  5DTK A;  4JF6 A;  3HLW A;  4NKP A;  3UB7 A;  5D3O A;  4B4X A;  1VB6 A;  4JKT A;  3IWI A;  4ZJ1 A;  3E4Q A;  3EEH A;  3T4T A;  3NDE A;  3E4O A;  3EGD C;  2WKQ A;  1OJG A;  4PMA A;  1UWN X;  2V1Z A;  1SKF A;  3CPT A;  3NEC A;  4KZ5 A;  1KGE A;  2MJ6 A;  1V9Z A;  1PWC A;  1E3U A;  5GLB A;  2JCH A;  1XXM A;  4DMZ A;  4JLF A;  5CHU A;  2M7U A;  2V0W A;  5FQJ A;  5F6A A;  3HCY A;  3KSH A;  4LRX C;  5CGW A;  3QP6 A;  1BLS A;  3SW1 A;  3ISG A;  3QNB A;  4DJ2 A;  4K0X A;  4PM8 A;  3QP2 A;  4Y13 A;  5AQ9 A;  2Y2Q A;  4P6Z M;  4P6B A;  1VHM A;  5TGF A;  1K6S A;  1G6A A;  1YKD A;  2P9V B;  5HFO A;  3G4P A;  3VE3 A;  3B3X A;  4R0Q A;  1W7F A;  3IBJ A;  4C6Y A;  3G2Y A;  4Y0T A;  5TJJ A;  4EQI A;  1PW1 A;  1D1J A;  3Q7V A;  1VEU A;  4GS9 B;  2PDR A;  3CIT A;  1N4O A;  4GHI A;  3HLE A;  2WGI A;  2ZMA A;  1KE3 A;  5G18 A;  5G4Z A;  2HDS A;  3BWL A;  4R4S A;  1XKZ A;  2DMW A;  3L7H A;  3UB6 A;  1C3B A;  3UB5 P;  4BD0 A;  3C8C A;  1H0M A;  4LV0 A;  4M3K A;  4RX2 A;  3GEC A;  4DF6 A;  1YPR A;  5CHJ A;  1IKI A;  1I2W A;  3MQQ A;  1BSG A;  3UB9 A;  5F69 A;  4G3V A;  5CXW A;  3BLS A;  4GOG A;  1LSX A;  3C4O A;  1LHY A;  3GV9 A;  4S2I A;  1IFQ A;  1MY8 A;  4MMN A;  1PI4 A;  1GSX A;  1CI8 A;  3FG8 A;  4RQ9 A;  4WL9 A;  1AXB A;  3RXX A;  4Y7P A;  3RJU A;  5J8X A;  5FQ9 A;  2OOL A;  4O0P A;  2XFT A;  4OP8 A;  4ETZ A;  2ZMF A;  4E3M A;  3O88 A;  5AVF A;  3TSG A;  3E2L A;  3Q7V B;  3BFG A;  1TS8 A;  1VEU B;  3ZCZ A;  1MKM A;  4N1H A;  3CWF A;  4Y3I A;  3E2K A;  3IQA A;  5HZH A;  5FEG A;  3VFH A;  1OT9 A;  1ESI A;  1H5X A;  5HAR A;  3IXG A;  4PPR A;  5FI2 A;  4DDY A;  3OPR A;  3Q07 A;  3LID A;  3N8S A;  3B47 A;  2JKR I;  2L1M A;  5F1F A;  4R4R A;  2EA9 A;  2QMI A;  5FI7 A;  4UA6 A;  3EEA A;  3BEB A;  3MKE A;  4I3I A;  1E3U D;  4WZ4 A;  5HWW A;  2FZ0 A;  5I94 A;  3IXB A;  1ERM A;  4BL3 A;  1F2K A;  1SDE A;  4DN0 A;  1ERQ A;  4Q0J A;  2R9W A;  3R7W A;  2GX5 A;  3OBF A;  2A3U A;  1RP5 A;  1TDL A;  1MKI A;  5F68 A;  3LIF A;  3GSG A;  4NXF A;  2WAE A;  3JYI A;  1TF1 A;  1MZU A;  5LBR A;  4Q0I A;  3E0Y A;  4H6J B;  1L3L A;  4WZ5 A;  4HJ6 A;  2ZC6 B;  1LL5 A;  3S7N A;  4OQH A;  5FAP A;  3JVU A;  4E6X A;  5EEC A;  4WMC A;  1FCM A;  2ZC5 B;  2E8I A;  5EE8 A;  2WKR A;  3U4L P;  4Y0U A;  3NOP C;  4XXR A;  2RCX A;  3NUL A;  2ZM8 A;  4KZ3 A;  3QP4 A;  1JTD A;  1TEM A;  3NOT C;  4GW9 A;  5J3W A;  4KZ8 A;  3KX0 X;  1ZG6 A;  2NUT C;  1W63 M;  5FQQ A;  3FPW A;  4WZ5 C;  2K31 A;  2V0U A;  5A92 A;  3O86 A;  4L9E A;  1KVM A;  3HJK A;  2W1T A;  3WS0 A;  1EI5 A;  4JXG A;  1L2S A;  1IYP A;  5M1A A;  3LY4 A;  2ZOH A;  3UE3 A;  4DE1 A;  4HI4 A;  5GL9 A;  2O9B A;  4HY8 A;  3ZG8 B;  1ODV A;  4D60 A;  4JGO A;  3T1S A;  3DTM A;  2J3W A;  3A0R A;  3PHY A;  4GLQ A;  2ZQ7 A;  1KGG A;  2DCF A;  1S1Z A;  5F83 A;  1HVB A;  4S2L A;  4DE0 A;  4IVI A;  2VKS A;  2O99 A;  3LIA A;  3M2K A;  2NUP C;  1NWZ A;  2Z6D A;  2KX6 A;  3H7W A;  4JGP A;  1XPB A;  4ZJ2 A;  4C75 A;  5GHY A;  3F1O B;  1KVL A;  2ZL1 B;  5CRF A;  1Q2P A;  3FZC A;  5EVI B;  4P0M A;  3E4P A;  3LY3 A;  2QWS A;  3KYZ A;  1IYS A;  3BFF A;  2JBF A;  4OH0 A;  4IHQ A;  5HSQ A;  5TBM A;  3TRC A;  1YLY A;  1JTG A;  3OPP A;  2R78 A;  2ZOI A;  3ICY A;  1NRF A;  1CJF A;  5FQK A;  4LV1 A;  4WLA A;  5E2F A;  3K3C A;  3S1Y A;  3LUQ A;  4QU3 A;  3OLO A;  2ZC7 A;  3UN7 A;  4IUH A;  4BD1 A;  1F98 A;  1HTZ A;  1XFN A;  4KZA A;  3B42 A;  4YWZ A;  3ZG7 B;  2Q9N A;  3CHW P;  1DP9 A;  2J3T C;  1W8Q A;  4ZAM A;  1ES3 A;  2Y91 A;  3ZYT A;  3IWQ A;  1N9L A;  2HDR A;  3CJM A;  3LIE A;  2VV8 A;  5E2G A;  2JKR M;  4Y17 A;  1QME A;  2PU2 A;  3H7W B;  3A3D A;  3PBS A;  2O0Y A;  1KDW A;  3GR2 A;  1MWU A;  2XEP A;  2XK1 A;  5EVI D;  5DF8 A;  4BBV A;  5L10 A;  4KZ9 A;  5TBM B;  5HPF A;  4BWI A;  3VSK A;  1XGI A;  4D2O A;  4N92 A;  3M6B A;  1OTD A;  2UV0 E;  4PKY G;  4OOM A;  3JVV A;  3IH9 A;  4RA7 A;  2EXA A;  4JGQ A;  2W0N A;  2PAV P;  1PWD A;  1WE4 A;  4DE3 A;  3M2J A;  3A3E A;  2OWJ A;  4LRY C;  3KSF A;  3NJA A;  4EV4 A;  2W3G A;  4K08 A;  1ES2 A;  1WYB A;  2P04 A;  3P01 A;  1G6O A;  1FSW A;  4HES A;  5DKL A;  2QKP A;  1Q2Q A;  5DFY A;  1TD5 A;  4EER A;  2W3D A;  2WYX A;  4M4X A;  4P6Z S;  2ZM0 A;  4GD6 A;  2VJW A;  5G4Y A;  5HD5 A;  2EFU A;  3B33 A;  1SKO A;  5JYP A;  3IHB A;  4JF4 A;  3HL9 A;  5FDS A;  2UWX A;  2A49 A;  2IWB A;  2HGV A;  4NXG A;  1MWR A;  1GSV A;  4R1G A;  3AGD A;  4KG5 A;  3BQ8 A;  3HBR A;  3IHA A;  4HBU A;  5FAO A;  3EWK A;  4DJ3 A;  2J8Y A;  1Y54 A;  3IX8 A;  3MMH A;  1FQG A;  4JXV A;  4X53 A;  3S4X A;  1BLC A;  4MBF A;  4PM5 A;  5CGX A;  1STZ A;  3KSG A;  4EXO A;  1IYO A;  4B93 A;  3Q81 A;  2Y4A A;  3VOL A;  4Y15 A;  5CTM A;  3ZDJ A;  2VLG A;  1M6K A;  4BMW A;  3PYP A;  5GHZ A;  3C38 A;  1XP4 A;  2Y2P A;  2WKE A;  3MF0 A;  2ZLY A;  3BFC A;  4JPM A;  4GS9 A;  3TOI A;  4L9F A;  2HJE A;  4JF5 A;  1T1C A;  4K0W A;  1DRM A;  2BLS A;  4L9G A;  3S7Q A;  2PYR A;  2LB9 A;  1S4S A;  4MNR A;  2QYB A;  1SKO B;  3T4L A;  1YSQ A;  4O01 A;  3RXW A;  1ALQ A;  4RX3 A;  4X25 A;  1PRQ A;  3UY6 A;  2G2U A;  4LV2 A;  5FDH A;  3VE4 A;  3G34 A;  3IX4 A;  4OP5 A;  4II7 A;  3W8K A;  1PNE A;  1E4D A;  2KLI A;  1PZP A;  3C2W A;  3VP4 A;  3G6O A;  4PM7 A;  5DJT A;  1JWV A;  3UDX A;  1LL8 A;  1N9O A;  1O7E A;  5HWV A;  3Q82 A;  4KZ4 A;  2JKF A;  2V20 A;  4AFI A;  1D7E A;  4OQ0 A;  4X1M A;  3VSL A;  1BLH A;  5KSH A;  3MQO A;  4RYE A;  2HP6 A;  5J4E A;  1JWZ A;  1K54 A;  4EES A;  4QB8 A;  5EM0 A;  1T1A A;  2ZM2 A;  1K56 A;  1L0D A;  4YOF A;  1K0K A;  3KYQ A;  5HPI A;  2VGL M;  4R3A A;  3IXD A;  3LI9 A;  2G2W A;  4MN7 A;  4ZDX A;  1NRJ A;  2P74 A;  3ITA A;  2GNX A;  2X71 A;  1DY6 A;  3AGE A;  3AGF A;  3CLO A;  4OQI A;  1PI5 A;  2C6W B;  3CZD A;  1H8Y A;  4G3W A;  4KQQ A; 
#chains in the Genus database with same CATH homology
 2AVX A;  3IX8 A;  5L07 A;  1L3L A;  5L09 A;  2UV0 E;  3JPU A;  3QP6 A;  3SZT A;  3QP4 A;  4LGW A;  3QP2 A;  4Y13 A;  4NG2 A;  5L10 A;  4Y17 A;  2Q0O A;  3QP1 A;  1H0M A;  4Y15 A;  4LFU A;  3IX4 A;  3IX3 A;  3QP5 A;  3QP8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...