1LSWA

Crystal structure of the ferrous bjfixl heme domain
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
117
structure length
117
Chain Sequence
DAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRYRTTSDPHIIGIGRIVTGKRRDGTTFPMHLSIGEMQSGGEPYFTGFVRDLTEHQQTQARLQELQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sensor protein FixL
publication title Structure-based mechanism of O2 sensing and ligand discrimination by the FixL heme domain of Bradyrhizobium japonicum
pubmed doi rcsb
source organism Bradyrhizobium japonicum
molecule tags Transferase
total genus 31
structure length 117
sequence length 117
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2002-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1lswA00
1XJ3A 3CAXA 1G28A 4XT2B 2L4RA 1S4SA 2ZOIA 3C8CA 1UGUA 4R70A 5HDCA 3A0SA 1JNUA 3EWKA 3NJAA 3FC7A 4I39A 2QJ5A 3F1OA 3K3DA 3H82B 4R3AA 4B9OA 3LIEA 1LT0A 2YKHA 1EW0A 2VV7A 5IS1A 2OWHA 4PKYG 2ZBBA 4HOIA 1KOUA 1N9OA 5KIZA 1XFNA 3B33A 2K7SA 1NWZA 3F1OB 2H28A 4KUOA 3LIAA 4NXEA 3GECA 4HP9A 2A24A 5I5LA 1OTBA 4HQAA 3H7WA 1OT9A 3UMEA 3IS2A 2VEAA 3ZQ5A 2PR6A 2PD7A 3KX0X 1XJ4A 2QHKA 2WKQA 4I3IA 3BY9A 1OTIA 4NXFA 4EEUA 2CMNA 4I3AA 4K08A 3MQQA 3LICA 1BYWA 4EXOA 2ZOHA 4HP4A 1LSWA 2A24B 5DJTA 1OJ5A 3FG8A 4HH3A 4HJ3A 3H7WB 4HNBA 4I38A 3IBRA 1OTEA 2VV6A 3NHQA 1MZUA 4F3LA 1DP9A 4HH2A 2L0WA 4MN5A 4E04A 4JGOA 2QKPA 4HJ4A 2JHEA 1N9NA 5F68A 1S1YA 5IU1A 1TS0A 2OWJA 5G4YA 4BBTA 3OLOA 4GS9B 4EESA 1T1AA 4GHIA 4H6JA 4HI4A 2W0NA 5HWVA 2KX6A 2Z6DA 5HSQA 2INWA 3MQOA 1VB6A 2VLGA 4BBUA 1T1CA 4EETB 3MXQA 1LSXA 5F5YA 3NOUC 3LIBA 1DP6A 2GJ3A 2HV1A 4LRZE 1F98A 4NXBA 4I3JA 2PR5A 5HDSA 2BASA 2W27A 3GDIA 3PHYA 1UWNX 1D7EA 2QWSA 3A0VA 3BY8A 2V1AA 3HJIA 2WKPA 4GHIB 4JGPA 2I9VA 3UB9A 2OOLA 1T19A 3LIFA 3NOTC 4WUJA 1P0ZA 5DJUA 4NXGA 3VE3A 5HDDA 3G6OA 3EEHA 3E4PA 3LYXA 3LUQA 3A0RA 2V0WA 2M1CA 2KDKA 3CWFA 2L1MA 3K3CA 1V9YA 1V9ZA 4GCZA 1S67L 4LLOB 1S66L 3T50A 2PDRA 4XT2A 2B02A 4L9GA 2QJ7A 5DKLA 1WA9A 4L9EA 3IS2B 1GSWA 5J4EA 1D06A 4HJ6A 3CLOA 1T1BA 2D02A 2EA9A 5EFWA 1S4RA 5HZHA 4L9FA 4LPZA 3NOPC 3VE4A 3H82A 2V9AA 3RH8B 1LSVA 1LL8A 4GW9A 5J3WA 5J7EA 3RTYA 2D01A 3D72A 5TBMA 4HY8A 1N9LA 3SW1A 4BBVA 3UMDA 4WL9A 2Z6CA 2YKFA 2PYPA 4F3LB 4HIAA 4WLAA 3F1PA 2PHYA 4JGRA 1ODVA 4EQ1A 2V0UA 1T18A 4JGQA 5DKKA 4RQ9A 3UE6A 5TBMB 4LRYC 3LI8A 1UWPX 4KUKA 3MR0A 4YWZA 3HJKA 3LIDA 3LI9A 1OTDA 2WKRA 3VOLA 2R78A 2J80A 4H6JB 2PYRA 3UB7A 1DP8A 3ICYA 1OTAA 4EW7A 5HD3A 1OJGA 2P7JA 3UB8A 3H9WA 1TS7A 3P7NA 5A8BA 3F1NA 1XFQA 1P97A 3E4QA 3F1PB 4M4XA 3E4OA 1XJ2A 5HWWA 1X0OA 3C2WA 4HHDA 4EERA 4DJ2A 1TS6A 4WN5A 3ULFA 4R6LA 1S1ZA 5HWTA 1XJ6A 1GSXA 5AVEA 2V1BA 3BWLA 4DJ3A 2JN7A 3UB6A 1F9IA 4R38A 2VV8A 1GSVA 1TS8A 5AVFA 3F1NB 4KQDA 4PKYA 3PYPA 1DRMA 3MJQA 3MFXA 2PD8A 5G4ZA 4MN6A 4WF0A 1Y28A 4I5SA 5HD5A 5F6AA 4LRXC 1OT6A 5F69A 4EEPA 4GS9A
chains in the Genus database with same CATH superfamily
2P08A 1NY0A 2G2UA 4KZ3A 3G30A 1YLZA 3CAXA 1ZG6A 4XT2B 5A93A 1STZA 3C8CA 3BFEA 4S2NA 5HDCA 3LY4A 2H0TA 4K0XA 1H8MA 3MMHA 2QJ5A 1QMEA 3CITA 5DTSA 3KSGA 4C3QA 1FCNA 3EQVA 2IWBA 2W3GA 1HTZA 3NULA 3IBJA 4K0WA 4XXRA 2VV7A 3CPTB 1YLWA 5E2GA 4KG2A 4XUXA 3HUNA 2WZXA 5FEFA 1CI9A 1L0GA 1XFNA 1FSWA 1K56D 5FDSA 4JF5A 1KVLA 4PMAA 5EVLA 4MEZA 4A5RA 3OZHA 1NWZA 3F1OB 4GB7A 4AFIA 3BJNA 2ZC4B 1CF0A 3D9YA 3V3SA 3QP6A 4MCWA 1CI8A 3NY4A 3OPPA 4RYEA 1AWIA 3KO6A 3VFHA 1OT9A 4DMZA 4X1LA 3BQAA 1L0EA 2R9WA 2Y4AA 3K2NA 3SH7A 1XJ4A 1K57C 2ZQAA 3HLDA 1JTDA 2A49A 3E0YA 4LCMA 3IHAA 1PZOA 3CZDA 5K5BA 1ERQA 4NXFA 2K2NA 4E3LA 4JKTA 1VETB 3B42A 5IHVA 2FFYA 3TSGA 2V2FF 4I3AA 4K08A 5E43A 4GD6A 1CEFA 3V67A 4M3KA 5DJTA 1I2SA 4HH3A 2O9CA 1Q2QA 1TVFA 4R3JA 1MKMA 3D3OA 5KSHA 4CLCB 3OBFA 4PM9A 4ARZA 2J9OA 1XX2A 5FEGA 2WGWB 3T4TA 1H0MA 1ES5A 4ZDXA 2EX9A 1WYCA 2L0WA 3EGXC 4GLQA 1Y54A 2B18A 4OP8A 2JHEA 5F68A 3ZVWA 1RCJA 2VJWA 2O0YA 5U47A 4EV4A 1SZVA 2OWJA 2W1TA 3NC8A 3PTEA 3HCYA 2Y59A 1GCEA 4GS9B 4HBUA 3QNBA 3HL9A 4H6JA 3HLGA 1ZHHB 3AGDA 3MQOA 5GLBA 1VB6A 3G35A 3V50A 4CLCD 1T1CA 5G18A 4CLCC 5F5YA 1DP6A 2HV1A 1F98A 2PR5A 1O7EA 3NBLA 3S22A 1D7EA 2EWWA 2UWXA 2QWSA 3Q82A 1EROA 3BY8A 2V1AA 5TJJA 2H5SA 2HZ5A 3BFGA 5HARA 2A3UA 4WUJA 5EECA 2W3FA 1P0ZA 1RGYA 5HDDA 4N92A 2HF6A 4ZAMA 4KZ7A 1G5UA 4JBFA 3GRJA 3IF6B 1ESIA 4R4SA 2V0WA 1YLYA 4D60A 2XRNA 3FV7A 2I72A 4EBNA 3R7WA 2PU2A 3EGDC 1ONHA 1S67L 3E98A 5DFXA 5DF7A 4R3BA 1BT5A 3T50A 2PDRA 2ZMAA 3VP3A 4XT2A 4IVIA 1K56A 2B02A 1ES4A 3FZCA 4IBRA 1AXBA 2J3TD 2VZWA 1MY8A 1KGFA 4Q0HA 1WA9A 2J3TC 3MBZA 1KVMA 3T1RA 3NCKA 3AGFA 3N7WA 4HJ6A 4JXSA 1PRQA 3VE4A 2DRWA 3UNWA 1NYMA 4OQGA 5MC7A 2V1ZA 3NDGA 2XDMA 2Y2PA 3ZYTA 3V3RA 1LSVA 2EX2A 2FZ0A 3LR0A 3IF6C 5HAPA 4MBHA 2ZL1B 2D01A 3D72A 3BYDA 4H8RA 3UDIA 3PAEA 2CC1A 2XF3A 1PI5A 1NLZA 5A92A 1NXYA 4BJPA 1WE4A 2Y2HA 2PYPA 4KZ9A 2JBFA 1MWTA 3G2YA 4WLAA 2Y55A 1XPBA 3F1PA 2BG1A 1P9WA 4EQ1A 5DKKA 3S7NA 3UE6A 1SKOB 3LI8A 4O7DA 3HJKA 3FYZA 1MXOA 1E3UD 1HD8A 4NETA 3UB7A 1DP8A 5EVEA 1W79A 3IH8A 4EW7A 2AVXA 2JKRM 5CHJA 5HD3A 4KZ4A 4Q0IA 5A8BA 3P7NA 3S7QA 3F1NA 1F2KA 1HLUP 4QJGA 1XFQA 4X56A 2K31A 5CGXA 3E4QA 1KE0A 4IUHA 2RCXA 3E4OA 5EVIB 1X0OA 3FWLA 3IX8A 4HHDA 4WN5A 4EQIA 4R6LA 5IT5A 1XGIA 4CLCA 4WZ5A 4LCLA 2Q9NA 5HWTA 1PW1A 2VGJA 2WGWA 1KE4A 4GNUA 4IUKA 3BWLA 1TDGA 3P01A 2JN7A 3UB6A 3KSHA 3M2JA 3G31A 1GSVA 4DE0A 3LR3A 4PKYA 3ZG0A 5GL9A 3G4PA 4MBKA 3FKVA 1N4OA 1G68A 1W63Q 5GHZA 1OT6A 4PM7A 5EM0A 2PBYA 4GS9A 3UY6A 1OPXA 5EVID 1H8YA 1K4EA 2LB9A 3BFCA 4YINA 2L4RA 1VHMA 5DF8A 4DE2A 1W63M 4X69A 3UE0A 4R70A 3A0SA 3DTKA 4S2LA 5HPIA 5AQAA 3LO7A 2WYXA 4BWIA 1BLHA 4D2OA 3T4OA 2ZMVA 3SS3A 2X71A 4R3AA 5A90A 2H0YA 3DWKA 1EW0A 5FQQA 5FI6A 3HLWA 3P98A 1PNEA 3C30A 2NUTC 1K54A 3PBOA 4L0LA 4Y15A 1TF1A 3C38A 3UO9A 4S2KA 3IF6A 1JVJA 5GLCA 1K4FA 4OPZA 1XA1A 3Q81A 2K7SA 4JXGA 2GDNA 1FCMA 4OPQA 3N4IA 3LIAA 1YSQA 4NXEA 3ISGA 3GECA 3W8KA 5FI2A 4HP9A 3AGEA 1IFQA 3VP1A 2Q0OA 2WAFA 2A24A 3MQ0A 5J8XA 3VOYA 1OTBA 1GHIA 4HQAA 1MPLA 3H7WA 1S0WA 1FIKA 1H8ZA 4DN0A 3FPVA 3ZQ5A 2PR6A 2IWDA 1Z6FA 5CTMA 4WELA 2X02A 3BLSA 2J3WA 2J9PA 4EEUA 2EFUA 3GTCA 5EOEA 2CMNA 2XA7M 3W4PA 4X1MA 2VX8A 4EXOA 1HVBA 1E3UA 4X53A 3BECA 2ZL1A 1P9RA 4HJ3A 4P85A 4UEYA 2P9VB 5TFQA 3CUEA 1FCOA 4Y7PA 3SZTA 4I38A 3IBRA 2JKTM 1OTEA 3A3JA 4KG5A 2VV6A 3NHQA 1YMXA 1MZUA 1S6RA 4U0XA 4KG6A 3LEZA 4UQIM 3VSLA 3JYIA 1SDNA 4JGOA 3RXXA 1G6AA 3JVVA 2XD5A 2OSUA 3DW0A 5C5KA 1YLJA 4MNRA 5IU1A 3N8RA 1SKOA 4ESPA 1K55C 2ZQ9A 5F83A 3OLOA 2V8FA 4HBTA 1BTLA 1T1AA 3PBNA 4O8GA 1IOUA 1NRJA 5HSQA 2Z6DA 3IXDA 1W5DA 2VLGA 4BBUA 5HL6A 1LSXA 4G3KA 3QP1A 3NOUC 3C4PA 3MZDA 2GJ3A 4NXBA 2Y91A 5EVIA 1A0KA 2BASA 3ITAA 4OOLA 2W27A 3GDIA 4BENA 1K6SA 4OQHA 1IYOA 4EWFA 1XXMA 3GSGA 4LV1A 1PWGA 5FAOA 5TR7A 2X01A 4GHIB 4OOMA 3E2KA 3Q07A 4Y3IA 2OOLA 2PRFA 3LIFA 3M6HA 5GLAA 1PFLA 3NOTC 4QHCA 3Q1FA 3IHBA 4NXGA 3SS5A 3G6OA 4FOFA 2ZQCA 1CQAA 4GKUA 3VV4A 4WYYA 1MWUA 1VEUA 1MBLA 3A0RA 3HLFA 4B88A 3S4XA 2KOIA 4O0PA 4Z9QA 4IHQA 1L0FA 1NRFA 3K3CA 1V9ZA 5DF9A 3G32A 3ZCZA 4LLOB 5CHUA 4BL2A 3GVBA 4E3MA 1JWZA 2XEPA 3O3VA 3C4OA 3OCNA 4O01A 4X25A 1FOFA 4L9EA 1RGZA 2PAVP 5J4EA 2XGNA 4UA7A 1XP4A 3WRTA 3IX3A 3CLOA 3VP4A 5DTKA 4P6ZM 3QNCA 4HEFA 1ONGA 5HZHA 1IELA 4LPZA 4JLFA 1L3LA 5HPFA 2V9AA 3QP4A 5FI7A 4ME4A 3RTYA 5CRFA 5TBMA 4DXCA 1LHYA 5F82A 2Z2MB 2Z6CA 5DVAA 2YKFA 3MKFA 1BZAA 4DXBA 2Y2QA 3MSHA 4F3LB 1W7FA 4UAAA 2ZD8A 1F5MA 4JGRA 1ODVA 2DNSA 1NZOA 2V0UA 1FR6A 1T18A 4JGQA 4JXVA 2W3HA 2LB5A 3U4LP 2VA0A 3ZHHA 4FSFA 4ZBEA 2VGLM 3LIDA 3LI9A 3WRZA 1OTDA 1DY6A 3CG5A 2MJ6A 2P74A 2WKRA 2GZAA 3IXGA 4ID4A 3T4LA 2H10A 1Z09A 2J80A 4PHTA 2PYRA 2V8CA 3ICYA 1CK3A 2OAQ1 1OJGA 1BLPA 2P7JA 3UB8A 3BFDA 3KYZA 3WS2A 4ETZA 5CERA 1P97A 2E8JA 3S1YA 3IXHA 2WKHA 1ZG4A 1KDWA 1TS6A 5FQIA 2EFXA 3ULFA 1S1ZA 2ZC3B 5L2FA 1Q2PA 4S2PA 3DTEA 1L0DA 1GSXA 1BUEA 5AVEA 2C5WB 4DJ3A 1ES3A 4II7A 3W4QA 5BOHA 2VV8A 1TS8A 3A3DA 3OPLA 1K38A 3PYPA 5L8MA 3IXBA 5G4ZA 5CEBA 4MN6A 3MFDA 4KZ5A 4R0QA 4I5SA 5HD5A 5F6AA 4LRXC 3WS5A 1K57A 2VGLS 5AQ9A 3GQZA 4QD4A 4Y0UA 3QP5A 1G28A 3BFFA 1ERMA 3CPTA 1M40A 4BLMA 1S4SA 2ZOIA 4NK3A 1UGUA 1OMEA 4Y5FA 2WGIA 2ZC7A 3T1SA 3EWKA 5JYPA 3NJAA 3CI6A 4BMWA 4KENB 3FC7A 1FSYA 4IJGA 3IWOA 4X55A 4N1XA 3F1OA 3H82B 4KQQA 1LI0A 4S2JA 3PAGA 2HJ9C 4UA6A 2OWHA 1IYPA 3P09A 3VFFA 1KOUA 3OPRA 1N9OA 5KIZA 5CTNA 4OLDA 4FCFA 1VETA 1VM1A 2R9XA 1IKGA 1HZOA 4UA9A 3DTIA 4DE1A 2H28A 3MF0A 4GDBA 3HLCA 5E2HA 3T1QB 5TGFA 2WKIA 5I5LA 1NZUA 4EU0A 3T4SA 4QY6A 1MWSA 2GX5A 2FH5A 4NG2A 3UMEA 3NECA 3KYQA 2Y2LA 5FQKA 3UB5P 2PD7A 2W3EA 1XA7A 2QHKA 2WKQA 4BQMA 3VMAA 1OTIA 2JKRI 1LI9A 4WZ4A 3LCEA 1YSPA 2W3DA 2VKSA 1MWRA 2XQZA 1VQQA 3ZDJA 3LICA 5CHMA 2HPBA 2ZQ7A 1BYWA 5GLDA 2XK1A 2Y8HA 2ZOHA 1LSWA 1N9BA 3IT9A 3MZFA 1ZC2A 4EUZA 2ZC5B 2Z2LB 5L07A 1TDLA 3IF5A 4HNBA 1FR1A 4N9LA 4GN2A 3VP2A 2QYBA 4Y0TA 2O9BA 1YAXA 3LGOA 4WBGA 1SKFA 2HDUA 4F3LA 1DP9A 4HH2A 4MN5A 4E04A 2WZZA 1RP5A 2HJEA 4ZJ3A 2QKPA 1JWVA 4HJ4A 1N9NA 3ZG7B 1GA0A 1PI4A 1K6RA 4R4RA 1TS0A 4BBTA 3CHWP 4EESA 3UE3A 1SHVA 2JKFA 4HI4A 1YT4A 5HWVA 3O5YA 2INWA 2ZM8A 1QMFA 3NIAA 4K91A 4IBXA 1YMSA 4E3JA 2ZJ9A 3HLEA 4LRZE 4I3JA 2WUQA 5KZHA 5HDSA 3CJMA 3W2ZA 3N8SA 3A0VA 4Z1WA 2W1TB 2FFFB 4Q0JA 2Y2GA 4CPKA 4ZTKA 1I2WA 4LGWA 4CLCE 5M1AA 5E2FA 2NUPC 3V39A 3GMWA 3LEQA 4MLLA 1M6KA 5DJUA 2V20A 4S2OA 3E4PA 3LYXA 4R23A 5FL3A 4OKPA 3LUQA 4FH4A 1JTGA 2G7UA 4P0MA 1XKZA 4RX2A 1GHMA 4DDSA 1E4DA 2GNXA 5FATA 3LR4A 2KDKA 3CWFA 5KSCA 2Y2JA 3MXRA 4GCZA 4LV0A 1S66L 2ZM0A 4YOFA 4S2MA 4Y13A 4E3NA 4KZBA 2A2LA 3WS1A 3MKEA 4WEJA 1O07A 3EEAA 4L9GA 1SCWA 3IS2B 2HP5A 1BSGA 2B5RA 1D06A 3KYEA 3OC2A 5FQJA 4CQHA 4EBPA 5HAQA 5AJGA 5EFWA 3TE8A 4FH2A 3H82A 3D4FA 3S7PA 5GHYA 5FAQA 4MBFA 3ZNTA 5EPHA 4IVKA 1LL8A 3GV9A 4YFMA 2ZQDA 5J3WA 3TOIA 5AQBA 1PWCA 4N1HA 4RX3A 4QB8A 4KQOA 3WWXA 4HY8A 1N9LA 3BEBA 4BBVA 4E6XA 1TD5A 4GJ4A 2JKTI 3W4OA 3VP0A 4C6YA 4F94A 3CMZA 4B93A 4HIAA 2XA7S 3G2ZA 4PM6A 5L10A 1K25A 2G2WA 1IYSA 3O86A 3ITBA 4RQ9A 3UDFA 3N8LA 4YWZA 3SS4A 1ES2A 2EXBA 3ZG9B 2IA2A 2R78A 1DJBA 4OQIA 4MDZA 1OTAA 3QHYA 3DTMA 3H9WA 3KSIA 4PM8A 3SH9A 5FQMA 2B95A 5AQ7A 1LL5A 3F1PB 4UQIS 2XFTA 5FASA 2PU4A 1XJ2A 5HWWA 4DJ2A 1BULA 1YPRA 4OPYA 1W8YA 3BRMA 4OP5A 3Q7VB 3O88A 1XJ6A 3U2AA 2XLNA 4OLGA 2V1BA 4GZBA 1PW8A 5EM1A 2XFSA 3DWZA 4R38A 2BTFP 3UPOA 2QMIA 5AVFA 3F1NB 4QY5A 2WGVA 5CEDA 4KQDA 1LL9A 1DRMA 3MFXA 2VK3A 2E8IA 1TEMA 4X68A 3L9KA 2DCFA 1Y28A 3TRCA 2OLUA 4WEKA 1J9MA 4DRTA 4EEPA 1DJAA 3E2LA 2KLIA 1J3WA 1YM1A 5EOOA 4B4XA 1XJ3A 4WMCD 4GD8A 5E2EA 4C75A 4E3IA 3UDXA 1FILA 1XGJA 4ZJ1A 1JNUA 3T12B 1DJCA 2WADA 1SDEA 3DAVA 2UV0E 4QU3A 4I39A 3ZG5A 3T4QA 3K3DA 2JKGA 5FA7A 3TJZC 3B3XA 4B9OA 3UN7A 3SH8A 3LIEA 3M2KA 1LT0A 2YKHA 1WYBA 5FQ9A 2J7VA 1PIOA 4NEED 2XSSA 3MS6A 3M6BA 1JWPA 5IS1A 1NLYA 3C5AA 4PKYG 2ZBBA 4WZ5C 4HOIA 1FQGA 4JPMA 4PPRA 3B33A 3UPPA 3UE1A 3HREA 1KGEA 3PBSA 1KE3A 4P6ZS 5CGSA 1K55A 4KUOA 2RL3A 2C6WB 3IWQA 1ALQA 2M7VA 3L7HA 1ZTUA 5HW3A 4KZ8A 3V5MA 3NI9A 1CJFA 1YQSA 3KSFA 2EWVA 2P9VA 3VOZA 3HUMA 2DMWA 3IS2A 2VEAA 3KX0X 2Y79A 1PYYA 2XH9A 2ACGA 2O99A 4I3IA 3LY3A 3BY9A 4LENA 3T4KA 4Q8IA 3MQQA 4UHUA 1CEGA 3PBQA 1Y4OA 4NKPA 3PBRA 4HP4A 4MMNA 5D3OA 4RVAA 2A24B 3PR6A 1OJ5A 3FG8A 4OH0A 1GA9A 5GHXA 4KZAA 3H7WB 3HUOA 2WKEA 3NDEA 4LFUA 4ETXA 3C7UA 2PBDP 5EV0A 1ESUA 2OAP1 3T1XA 3EQUA 3JPUA 5L09A 2XROA 1YLPA 1G6OA 3PBTA 2ZLYA 4BD0A 3RJUA 3MXSA 5JYOA 1LLBA 1K54C 2XD1A 4CJNA 5LBRA 5CECA 3QP8A 3O87A 4EBLA 3SOIA 4X6TA 2XR0A 1S1YA 4WM9A 5DFYA 4N9KA 4FTXA 1ACFA 5G4YA 2JCHA 4DDYA 4PM5A 3HLBA 4GHIA 3TW8A 5HAIA 2EX8A 2IWCA 2W0NA 2KX6A 2JC7A 3BM6A 4EETB 3MXQA 1NJ4A 3VSKA 3IX4A 5HFOA 4FUWA 3LIBA 3MZEA 3T4JA 1KGGA 3C7VA 4WMCA 3ZVTA 5HL1A 3PHYA 1UWNX 3N6IA 2ZC6B 3HVFA 4OOYA 4Y17A 2M7UA 3Q7VA 1IKIA 1D1JA 2OV5A 3HJIA 2WKPA 4OVDA 4HESA 4JGPA 5KMWA 2W1RA 2I9VA 1EI5A 3UB9A 1YLTA 3FKWA 1T19A 3FPWA 3ZFZA 1YKDA 3JVUA 3VE3A 1H5XA 4MN7A 2OLVA 3EEHA 1C3BA 3B47A 2ZMFA 3CUEC 4U0TA 5CXWA 5FAPA 2ZQ8A 4Y2FA 2HP6A 2M1CA 4YNRA 1L2SA 4S2NC 2L1MA 4LV2A 2WAEA 1V9YA 4JXWA 3A3EA 3S7OA 2EXAA 4GOGA 3WS0A 4QPRA 4U3TA 5M19A 4G3VA 3EOIA 2O9AA 2HDRA 2Q9MA 1K0KA 2P04A 5CGWA 3RFBA 2QJ7A 5DKLA 5A91A 1GSWA 4S2IA 3BW6A 4KQRA 1I5QA 1T1BA 5F1GA 1U60A 1VEUB 1GHPA 2D02A 2EA9A 4KZ6A 1S4RA 3OOVA 1W8QA 1E25A 4L9FA 3NOPC 1H3QA 4LV3A 4JF6A 3UPNA 3RH8B 5EUAA 5F1FA 4GW9A 3HBRA 4FD8A 4E6WA 5EVIC 5J7EA 1BLCA 2WK0A 3LR5A 2ZM2A 3RXWA 1KDSA 3SW1A 3DBAA 3UMDA 4WL9A 3QP2A 2PT7A 4OQ0A 3GR2A 4ARZB 3G34A 4OPRA 4E3OA 3OCLA 2EX6A 1EWZA 3IQAA 2HDSA 3ZG8B 5DTTA 1ZKJA 2HDQA 4DE3A 2HGVA 4R1GA 5CX7A 5FSRA 4DKIA 2PHYA 2JE5A 4JF4A 4OONA 5M18A 2Y2NA 3WS4A 1IEMA 2QZ6A 3TG9A 5TBMB 4LRYC 1UWPX 3A3IA 4KUKA 3MR0A 2VGKA 4EUVA 3Q7ZA 1MKIA 5FDHA 3VOLA 4G3WA 1BLSA 3A3FA 1PWDA 4H6JB 3OPHA 5I94A 4E3KA 4PAUA 4P87A 1TS7A 4IEDA 4GDNA 3LFVA 3BQ8A 4ZJ2A 4QWOA 4BD1A 3ZNYA 2Y2MA 5EE8A 4M4XA 2Y2OA 2HP9A 1MC0A 3C2WA 4EERA 3ZGAB 2Y2KA 4P6BA 4ZRRA 4RA7A 4Y0OA 1IYQA 3IWIA 2Y2IA 4XUZA 1F9IA 1PZPA 3BLMA 1NYYA 4B4ZA 4BL3A 5HX9A 3MJQA 2PD8A 2BLSA 3IH9A 2J8YA 3PXPA 4WF0A 3I7JA 2QPNA 3R7WB 3R4KA 5F69A 4DF6A
chains in the Genus database with same CATH topology
1OPXA 2P08A 2KLIA 2LB9A 1XJ3A 3CAXA 1G28A 4XT2B 2L4RA 1STZA 1S4SA 1VHMA 2ZOIA 3C8CA 1W63M 1UGUA 4R70A 5HDCA 4Y5FA 3A0SA 1JNUA 5HPIA 3EWKA 1H8MA 3NJAA 3CI6A 4BMWA 3FC7A 3MMHA 4BWIA 4I39A 4IJGA 3T4QA 2QJ5A 3F1OA 3K3DA 3H82B 3CITA 3T4OA 3TJZC 2ZMVA 4R3AA 3KSGA 4B9OA 3EQVA 3LIEA 1LT0A 2YKHA 2W3GA 1EW0A 2HJ9C 4NEED 2XSSA 3IBJA 2VV7A 3C30A 5IS1A 1NLYA 2OWHA 2NUTC 4PKYG 4L0LA 3PBOA 2ZBBA 4HOIA 1TF1A 1KOUA 3C38A 1N9OA 5KIZA 1XFNA 3B33A 2K7SA 3PBSA 1NWZA 3F1OB 4P6ZS 2H28A 4KUOA 3MF0A 3LIAA 1YSQA 4NXEA 4AFIA 3GECA 3BJNA 4HP9A 1IFQA 2M7VA 1ZTUA 2A24A 3MQ0A 5I5LA 4MCWA 4EU0A 3T4SA 1OTBA 4HQAA 3KO6A 3H7WA 1OT9A 2EWVA 3KSFA 4DMZA 2GX5A 2FH5A 3UMEA 2DMWA 3BQAA 3IS2A 3KYQA 4DN0A 2VEAA 3FPVA 3ZQ5A 2PR6A 3K2NA 2PD7A 3KX0X 2Y79A 1XJ4A 2W3EA 2QHKA 4WELA 2WKQA 2O99A 4I3IA 3E0YA 3BY9A 5K5BA 1OTIA 2JKRI 4NXFA 3T4KA 2J3WA 4EEUA 2W3DA 1YSPA 2K2NA 3B42A 2VKSA 2CMNA 4I3AA 2XA7M 4K08A 3MQQA 3LICA 3PBQA 1BYWA 2VX8A 4EXOA 4NKPA 3PBRA 2Y8HA 2ZOHA 4HP4A 4MMNA 3V67A 1LSWA 2A24B 5DJTA 3PR6A 1OJ5A 3FG8A 4HH3A 2O9CA 1P9RA 4HJ3A 3H7WB 4UEYA 4HNBA 4ETXA 1MKMA 3D3OA 5KSHA 4CLCB 3OBFA 3CUEA 4I38A 3IBRA 2QYBA 4ARZA 2JKTM 1OTEA 2O9BA 2OAP1 1YAXA 2VV6A 3EQUA 3T4TA 3NHQA 1MZUA 4F3LA 2XROA 1DP9A 4HH2A 1G6OA 2L0WA 3PBTA 4MN5A 4E04A 4UQIM 2HJEA 3EGXC 4JGOA 2QKPA 4GLQA 5LBRA 2B18A 3JVVA 4HJ4A 2JHEA 5C5KA 1N9NA 5F68A 1S1YA 5IU1A 2VJWA 2O0YA 5DFYA 1TS0A 2OWJA 5G4YA 4BBTA 2W1TA 3HCYA 3OLOA 4GS9B 4EESA 1T1AA 3UE3A 4GHIA 3PBNA 4O8GA 4H6JA 3TW8A 1IOUA 4HI4A 1NRJA 2W0NA 2KX6A 2Z6DA 5HWVA 5HSQA 1ZHHB 3O5YA 2INWA 3MQOA 1VB6A 2VLGA 4CLCD 4BBUA 1T1CA 4EETB 4CLCC 5HL6A 3MXQA 1LSXA 4G3KA 5F5YA 3NOUC 3LIBA 3T4JA 1DP6A 2GJ3A 2HV1A 4LRZE 1F98A 4NXBA 4I3JA 2PR5A 5HDSA 2BASA 4OOLA 2W27A 3GDIA 3W2ZA 3PHYA 1UWNX 1D7EA 2EWWA 2QWSA 3A0VA 4Z1WA 2W1TB 2M7UA 3BY8A 2V1AA 5TJJA 3HJIA 4Q0JA 2WKPA 4GHIB 4OOMA 4JGPA 2W1RA 2I9VA 4Y3IA 3UB9A 2OOLA 1T19A 3LIFA 4CLCE 3FPWA 2NUPC 3NOTC 4WUJA 2W3FA 1P0ZA 5DJUA 4NXGA 1YKDA 3JVUA 3VE3A 4MN7A 5HDDA 3G6OA 2HF6A 3EEHA 4FOFA 3B47A 2ZMFA 3CUEC 3VV4A 3E4PA 3LYXA 5FL3A 3LUQA 3A0RA 2V0WA 2G7UA 2XRNA 2KOIA 4Y2FA 2M1CA 4O0PA 2GNXA 4YNRA 3LR4A 4IHQA 3R7WA 2KDKA 3CWFA 2L1MA 3K3CA 3EGDC 1V9YA 1V9ZA 5DF9A 3S7OA 4GCZA 1S67L 4LLOB 3E98A 1S66L 5DFXA 4YOFA 4QPRA 3T50A 2PDRA 2A2LA 4G3VA 3EOIA 2O9AA 4XT2A 2B02A 2P04A 4WEJA 3EEAA 4L9GA 2J3TD 2VZWA 3OCNA 3RFBA 4O01A 2QJ7A 4Q0HA 1WA9A 2J3TC 5DKLA 4L9EA 3IS2B 1GSWA 5J4EA 3BW6A 1D06A 3OC2A 4CQHA 4HJ6A 3CLOA 1T1BA 4P6ZM 2D02A 2EA9A 5AJGA 5EFWA 1S4RA 3TE8A 3OOVA 5HZHA 4L9FA 4LPZA 3NOPC 3VE4A 3H82A 3S7PA 5MC7A 5HPFA 1H3QA 2V9AA 3ZYTA 3RH8B 1LSVA 3LR0A 2FZ0A 1LL8A 4GW9A 4ME4A 5J3WA 5J7EA 3RTYA 2D01A 3D72A 3LR5A 4HY8A 4KQOA 5TBMA 1N9LA 3SW1A 3DBAA 3UMDA 4BBVA 4WL9A 2Z6CA 2PT7A 1TD5A 4GJ4A 1NLZA 4ARZB 2YKFA 4BJPA 2JKTI 2PYPA 3OCLA 4F3LB 4B93A 4HIAA 4WLAA 2HGVA 5CX7A 3F1PA 2XA7S 1F5MA 2PHYA 4JGRA 1ODVA 1P9WA 4EQ1A 2V0UA 1T18A 4JGQA 5DKKA 2W3HA 3S7NA 2LB5A 4RQ9A 2VA0A 3UE6A 5TBMB 4FSFA 3LI8A 4LRYC 1UWPX 2VGLM 4KUKA 3MR0A 4YWZA 3HJKA 3LIDA 3LI9A 4EUVA 1OTDA 2MJ6A 2WKRA 2GZAA 3VOLA 4G3WA 3T4LA 2IA2A 2R78A 2J80A 4PHTA 4H6JB 2PYRA 3UB7A 1DP8A 3ICYA 4MDZA 1OTAA 4EW7A 2JKRM 2OAQ1 5HD3A 1OJGA 2P7JA 3UB8A 4PAUA 3H9WA 4Q0IA 3KSIA 3KYZA 1TS7A 3P7NA 3S7QA 3F1NA 5A8BA 1XFQA 4ETZA 2K31A 3LFVA 1P97A 3BQ8A 3E4QA 3F1PB 4UQIS 4IUHA 4M4XA 3E4OA 1XJ2A 5HWWA 1X0OA 1MC0A 3C2WA 4HHDA 4EERA 4DJ2A 1TS6A 4WN5A 3ULFA 4R6LA 1S1ZA 5IT5A 4CLCA 5HWTA 1XJ6A 3U2AA 4ZRRA 1GSXA 5AVEA 2V1BA 4IUKA 3BWLA 3P01A 4DJ3A 2JN7A 3UB6A 4II7A 3KSHA 1F9IA 4R38A 2VV8A 1GSVA 1TS8A 5AVFA 3F1NB 3LR3A 4KQDA 4PKYA 3PYPA 5L8MA 1DRMA 3MJQA 3MFXA 2PD8A 5G4ZA 4MN6A 3PXPA 4WF0A 1Y28A 4I5SA 5HD5A 5F6AA 1W63Q 3TRCA 3R7WB 4WEKA 4LRXC 1OT6A 3R4KA 5F69A 2VGLS 4EEPA 4GS9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XJ3 A;  3CAX A;  1G28 A;  4XT2 B;  2L4R A;  1S4S A;  2ZOI A;  3C8C A;  1UGU A;  4R70 A;  5HDC A;  3A0S A;  1JNU A;  3EWK A;  3NJA A;  3FC7 A;  4I39 A;  2QJ5 A;  3F1O A;  3K3D A;  3H82 B;  4R3A A;  4B9O A;  3LIE A;  1LT0 A;  2YKH A;  1EW0 A;  2VV7 A;  5IS1 A;  2OWH A;  4PKY G;  2ZBB A;  4HOI A;  1KOU A;  1N9O A;  5KIZ A;  1XFN A;  3B33 A;  2K7S A;  1NWZ A;  3F1O B;  2H28 A;  4KUO A;  3LIA A;  4NXE A;  3GEC A;  4HP9 A;  2A24 A;  5I5L A;  1OTB A;  4HQA A;  3H7W A;  1OT9 A;  3UME A;  3IS2 A;  2VEA A;  3ZQ5 A;  2PR6 A;  2PD7 A;  3KX0 X;  1XJ4 A;  2QHK A;  2WKQ A;  4I3I A;  3BY9 A;  1OTI A;  4NXF A;  4EEU A;  2CMN A;  4I3A A;  4K08 A;  3MQQ A;  3LIC A;  1BYW A;  4EXO A;  2ZOH A;  4HP4 A;  1LSW A;  2A24 B;  5DJT A;  1OJ5 A;  3FG8 A;  4HH3 A;  4HJ3 A;  3H7W B;  4HNB A;  4I38 A;  3IBR A;  1OTE A;  2VV6 A;  3NHQ A;  1MZU A;  4F3L A;  1DP9 A;  4HH2 A;  2L0W A;  4MN5 A;  4E04 A;  4JGO A;  2QKP A;  4HJ4 A;  2JHE A;  1N9N A;  5F68 A;  1S1Y A;  5IU1 A;  1TS0 A;  2OWJ A;  5G4Y A;  4BBT A;  3OLO A;  4GS9 B;  4EES A;  1T1A A;  4GHI A;  4H6J A;  4HI4 A;  2W0N A;  5HWV A;  2KX6 A;  2Z6D A;  5HSQ A;  2INW A;  3MQO A;  1VB6 A;  2VLG A;  4BBU A;  1T1C A;  4EET B;  3MXQ A;  1LSX A;  5F5Y A;  3NOU C;  3LIB A;  1DP6 A;  2GJ3 A;  2HV1 A;  4LRZ E;  1F98 A;  4NXB A;  4I3J A;  2PR5 A;  5HDS A;  2BAS A;  2W27 A;  3GDI A;  3PHY A;  1UWN X;  1D7E A;  2QWS A;  3A0V A;  3BY8 A;  2V1A A;  3HJI A;  2WKP A;  4GHI B;  4JGP A;  2I9V A;  3UB9 A;  2OOL A;  1T19 A;  3LIF A;  3NOT C;  4WUJ A;  1P0Z A;  5DJU A;  4NXG A;  3VE3 A;  5HDD A;  3G6O A;  3EEH A;  3E4P A;  3LYX A;  3LUQ A;  3A0R A;  2V0W A;  2M1C A;  2KDK A;  3CWF A;  2L1M A;  3K3C A;  1V9Y A;  1V9Z A;  4GCZ A;  1S67 L;  4LLO B;  1S66 L;  3T50 A;  2PDR A;  4XT2 A;  2B02 A;  4L9G A;  2QJ7 A;  5DKL A;  1WA9 A;  4L9E A;  3IS2 B;  1GSW A;  5J4E A;  1D06 A;  4HJ6 A;  3CLO A;  1T1B A;  2D02 A;  2EA9 A;  5EFW A;  1S4R A;  5HZH A;  4L9F A;  4LPZ A;  3NOP C;  3VE4 A;  3H82 A;  2V9A A;  3RH8 B;  1LSV A;  1LL8 A;  4GW9 A;  5J3W A;  5J7E A;  3RTY A;  2D01 A;  3D72 A;  5TBM A;  4HY8 A;  1N9L A;  3SW1 A;  4BBV A;  3UMD A;  4WL9 A;  2Z6C A;  2YKF A;  2PYP A;  4F3L B;  4HIA A;  4WLA A;  3F1P A;  2PHY A;  4JGR A;  1ODV A;  4EQ1 A;  2V0U A;  1T18 A;  4JGQ A;  5DKK A;  4RQ9 A;  3UE6 A;  5TBM B;  4LRY C;  3LI8 A;  1UWP X;  4KUK A;  3MR0 A;  4YWZ A;  3HJK A;  3LID A;  3LI9 A;  1OTD A;  2WKR A;  3VOL A;  2R78 A;  2J80 A;  4H6J B;  2PYR A;  3UB7 A;  1DP8 A;  3ICY A;  1OTA A;  4EW7 A;  5HD3 A;  1OJG A;  2P7J A;  3UB8 A;  3H9W A;  1TS7 A;  3P7N A;  5A8B A;  3F1N A;  1XFQ A;  1P97 A;  3E4Q A;  3F1P B;  4M4X A;  3E4O A;  1XJ2 A;  5HWW A;  1X0O A;  3C2W A;  4HHD A;  4EER A;  4DJ2 A;  1TS6 A;  4WN5 A;  3ULF A;  4R6L A;  1S1Z A;  5HWT A;  1XJ6 A;  1GSX A;  5AVE A;  2V1B A;  3BWL A;  4DJ3 A;  2JN7 A;  3UB6 A;  1F9I A;  4R38 A;  2VV8 A;  1GSV A;  1TS8 A;  5AVF A;  3F1N B;  4KQD A;  4PKY A;  3PYP A;  1DRM A;  3MJQ A;  3MFX A;  2PD8 A;  5G4Z A;  4MN6 A;  4WF0 A;  1Y28 A;  4I5S A;  5HD5 A;  5F6A A;  4LRX C;  1OT6 A;  5F69 A;  4EEP A;  4GS9 A; 
#chains in the Genus database with same CATH topology
 2P08 A;  1NY0 A;  2G2U A;  4KZ3 A;  3G30 A;  1YLZ A;  3CAX A;  1ZG6 A;  4XT2 B;  5A93 A;  1STZ A;  3C8C A;  3BFE A;  4S2N A;  5HDC A;  3LY4 A;  2H0T A;  4K0X A;  1H8M A;  3MMH A;  2QJ5 A;  1QME A;  3CIT A;  5DTS A;  3KSG A;  4C3Q A;  1FCN A;  3EQV A;  2IWB A;  2W3G A;  1HTZ A;  3NUL A;  3IBJ A;  4K0W A;  4XXR A;  2VV7 A;  3CPT B;  1YLW A;  5E2G A;  4KG2 A;  4XUX A;  3HUN A;  2WZX A;  5FEF A;  1CI9 A;  1L0G A;  1XFN A;  1FSW A;  1K56 D;  5FDS A;  4JF5 A;  1KVL A;  4PMA A;  5EVL A;  4MEZ A;  4A5R A;  3OZH A;  1NWZ A;  3F1O B;  4GB7 A;  4AFI A;  3BJN A;  2ZC4 B;  1CF0 A;  3D9Y A;  3V3S A;  3QP6 A;  4MCW A;  1CI8 A;  3NY4 A;  3OPP A;  4RYE A;  1AWI A;  3KO6 A;  3VFH A;  1OT9 A;  4DMZ A;  4X1L A;  3BQA A;  1L0E A;  2R9W A;  2Y4A A;  3K2N A;  3SH7 A;  1XJ4 A;  1K57 C;  2ZQA A;  3HLD A;  1JTD A;  2A49 A;  3E0Y A;  4LCM A;  3IHA A;  1PZO A;  3CZD A;  5K5B A;  1ERQ A;  4NXF A;  2K2N A;  4E3L A;  4JKT A;  1VET B;  3B42 A;  5IHV A;  2FFY A;  3TSG A;  2V2F F;  4I3A A;  4K08 A;  5E43 A;  4GD6 A;  1CEF A;  3V67 A;  4M3K A;  5DJT A;  1I2S A;  4HH3 A;  2O9C A;  1Q2Q A;  1TVF A;  4R3J A;  1MKM A;  3D3O A;  5KSH A;  4CLC B;  3OBF A;  4PM9 A;  4ARZ A;  2J9O A;  1XX2 A;  5FEG A;  2WGW B;  3T4T A;  1H0M A;  1ES5 A;  4ZDX A;  2EX9 A;  1WYC A;  2L0W A;  3EGX C;  4GLQ A;  1Y54 A;  2B18 A;  4OP8 A;  2JHE A;  5F68 A;  3ZVW A;  1RCJ A;  2VJW A;  2O0Y A;  5U47 A;  4EV4 A;  1SZV A;  2OWJ A;  2W1T A;  3NC8 A;  3PTE A;  3HCY A;  2Y59 A;  1GCE A;  4GS9 B;  4HBU A;  3QNB A;  3HL9 A;  4H6J A;  3HLG A;  1ZHH B;  3AGD A;  3MQO A;  5GLB A;  1VB6 A;  3G35 A;  3V50 A;  4CLC D;  1T1C A;  5G18 A;  4CLC C;  5F5Y A;  1DP6 A;  2HV1 A;  1F98 A;  2PR5 A;  1O7E A;  3NBL A;  3S22 A;  1D7E A;  2EWW A;  2UWX A;  2QWS A;  3Q82 A;  1ERO A;  3BY8 A;  2V1A A;  5TJJ A;  2H5S A;  2HZ5 A;  3BFG A;  5HAR A;  2A3U A;  4WUJ A;  5EEC A;  2W3F A;  1P0Z A;  1RGY A;  5HDD A;  4N92 A;  2HF6 A;  4ZAM A;  4KZ7 A;  1G5U A;  4JBF A;  3GRJ A;  3IF6 B;  1ESI A;  4R4S A;  2V0W A;  1YLY A;  4D60 A;  2XRN A;  3FV7 A;  2I72 A;  4EBN A;  3R7W A;  2PU2 A;  3EGD C;  1ONH A;  1S67 L;  3E98 A;  5DFX A;  5DF7 A;  4R3B A;  1BT5 A;  3T50 A;  2PDR A;  2ZMA A;  3VP3 A;  4XT2 A;  4IVI A;  1K56 A;  2B02 A;  1ES4 A;  3FZC A;  4IBR A;  1AXB A;  2J3T D;  2VZW A;  1MY8 A;  1KGF A;  4Q0H A;  1WA9 A;  2J3T C;  3MBZ A;  1KVM A;  3T1R A;  3NCK A;  3AGF A;  3N7W A;  4HJ6 A;  4JXS A;  1PRQ A;  3VE4 A;  2DRW A;  3UNW A;  1NYM A;  4OQG A;  5MC7 A;  2V1Z A;  3NDG A;  2XDM A;  2Y2P A;  3ZYT A;  3V3R A;  1LSV A;  2EX2 A;  2FZ0 A;  3LR0 A;  3IF6 C;  5HAP A;  4MBH A;  2ZL1 B;  2D01 A;  3D72 A;  3BYD A;  4H8R A;  3UDI A;  3PAE A;  2CC1 A;  2XF3 A;  1PI5 A;  1NLZ A;  5A92 A;  1NXY A;  4BJP A;  1WE4 A;  2Y2H A;  2PYP A;  4KZ9 A;  2JBF A;  1MWT A;  3G2Y A;  4WLA A;  2Y55 A;  1XPB A;  3F1P A;  2BG1 A;  1P9W A;  4EQ1 A;  5DKK A;  3S7N A;  3UE6 A;  1SKO B;  3LI8 A;  4O7D A;  3HJK A;  3FYZ A;  1MXO A;  1E3U D;  1HD8 A;  4NET A;  3UB7 A;  1DP8 A;  5EVE A;  1W79 A;  3IH8 A;  4EW7 A;  2AVX A;  2JKR M;  5CHJ A;  5HD3 A;  4KZ4 A;  4Q0I A;  5A8B A;  3P7N A;  3S7Q A;  3F1N A;  1F2K A;  1HLU P;  4QJG A;  1XFQ A;  4X56 A;  2K31 A;  5CGX A;  3E4Q A;  1KE0 A;  4IUH A;  2RCX A;  3E4O A;  5EVI B;  1X0O A;  3FWL A;  3IX8 A;  4HHD A;  4WN5 A;  4EQI A;  4R6L A;  5IT5 A;  1XGI A;  4CLC A;  4WZ5 A;  4LCL A;  2Q9N A;  5HWT A;  1PW1 A;  2VGJ A;  2WGW A;  1KE4 A;  4GNU A;  4IUK A;  3BWL A;  1TDG A;  3P01 A;  2JN7 A;  3UB6 A;  3KSH A;  3M2J A;  3G31 A;  1GSV A;  4DE0 A;  3LR3 A;  4PKY A;  3ZG0 A;  5GL9 A;  3G4P A;  4MBK A;  3FKV A;  1N4O A;  1G68 A;  1W63 Q;  5GHZ A;  1OT6 A;  4PM7 A;  5EM0 A;  2PBY A;  4GS9 A;  3UY6 A;  1OPX A;  5EVI D;  1H8Y A;  1K4E A;  2LB9 A;  3BFC A;  4YIN A;  2L4R A;  1VHM A;  5DF8 A;  4DE2 A;  1W63 M;  4X69 A;  3UE0 A;  4R70 A;  3A0S A;  3DTK A;  4S2L A;  5HPI A;  5AQA A;  3LO7 A;  2WYX A;  4BWI A;  1BLH A;  4D2O A;  3T4O A;  2ZMV A;  3SS3 A;  2X71 A;  4R3A A;  5A90 A;  2H0Y A;  3DWK A;  1EW0 A;  5FQQ A;  5FI6 A;  3HLW A;  3P98 A;  1PNE A;  3C30 A;  2NUT C;  1K54 A;  3PBO A;  4L0L A;  4Y15 A;  1TF1 A;  3C38 A;  3UO9 A;  4S2K A;  3IF6 A;  1JVJ A;  5GLC A;  1K4F A;  4OPZ A;  1XA1 A;  3Q81 A;  2K7S A;  4JXG A;  2GDN A;  1FCM A;  4OPQ A;  3N4I A;  3LIA A;  1YSQ A;  4NXE A;  3ISG A;  3GEC A;  3W8K A;  5FI2 A;  4HP9 A;  3AGE A;  1IFQ A;  3VP1 A;  2Q0O A;  2WAF A;  2A24 A;  3MQ0 A;  5J8X A;  3VOY A;  1OTB A;  1GHI A;  4HQA A;  1MPL A;  3H7W A;  1S0W A;  1FIK A;  1H8Z A;  4DN0 A;  3FPV A;  3ZQ5 A;  2PR6 A;  2IWD A;  1Z6F A;  5CTM A;  4WEL A;  2X02 A;  3BLS A;  2J3W A;  2J9P A;  4EEU A;  2EFU A;  3GTC A;  5EOE A;  2CMN A;  2XA7 M;  3W4P A;  4X1M A;  2VX8 A;  4EXO A;  1HVB A;  1E3U A;  4X53 A;  3BEC A;  2ZL1 A;  1P9R A;  4HJ3 A;  4P85 A;  4UEY A;  2P9V B;  5TFQ A;  3CUE A;  1FCO A;  4Y7P A;  3SZT A;  4I38 A;  3IBR A;  2JKT M;  1OTE A;  3A3J A;  4KG5 A;  2VV6 A;  3NHQ A;  1YMX A;  1MZU A;  1S6R A;  4U0X A;  4KG6 A;  3LEZ A;  4UQI M;  3VSL A;  3JYI A;  1SDN A;  4JGO A;  3RXX A;  1G6A A;  3JVV A;  2XD5 A;  2OSU A;  3DW0 A;  5C5K A;  1YLJ A;  4MNR A;  5IU1 A;  3N8R A;  1SKO A;  4ESP A;  1K55 C;  2ZQ9 A;  5F83 A;  3OLO A;  2V8F A;  4HBT A;  1BTL A;  1T1A A;  3PBN A;  4O8G A;  1IOU A;  1NRJ A;  5HSQ A;  2Z6D A;  3IXD A;  1W5D A;  2VLG A;  4BBU A;  5HL6 A;  1LSX A;  4G3K A;  3QP1 A;  3NOU C;  3C4P A;  3MZD A;  2GJ3 A;  4NXB A;  2Y91 A;  5EVI A;  1A0K A;  2BAS A;  3ITA A;  4OOL A;  2W27 A;  3GDI A;  4BEN A;  1K6S A;  4OQH A;  1IYO A;  4EWF A;  1XXM A;  3GSG A;  4LV1 A;  1PWG A;  5FAO A;  5TR7 A;  2X01 A;  4GHI B;  4OOM A;  3E2K A;  3Q07 A;  4Y3I A;  2OOL A;  2PRF A;  3LIF A;  3M6H A;  5GLA A;  1PFL A;  3NOT C;  4QHC A;  3Q1F A;  3IHB A;  4NXG A;  3SS5 A;  3G6O A;  4FOF A;  2ZQC A;  1CQA A;  4GKU A;  3VV4 A;  4WYY A;  1MWU A;  1VEU A;  1MBL A;  3A0R A;  3HLF A;  4B88 A;  3S4X A;  2KOI A;  4O0P A;  4Z9Q A;  4IHQ A;  1L0F A;  1NRF A;  3K3C A;  1V9Z A;  5DF9 A;  3G32 A;  3ZCZ A;  4LLO B;  5CHU A;  4BL2 A;  3GVB A;  4E3M A;  1JWZ A;  2XEP A;  3O3V A;  3C4O A;  3OCN A;  4O01 A;  4X25 A;  1FOF A;  4L9E A;  1RGZ A;  2PAV P;  5J4E A;  2XGN A;  4UA7 A;  1XP4 A;  3WRT A;  3IX3 A;  3CLO A;  3VP4 A;  5DTK A;  4P6Z M;  3QNC A;  4HEF A;  1ONG A;  5HZH A;  1IEL A;  4LPZ A;  4JLF A;  1L3L A;  5HPF A;  2V9A A;  3QP4 A;  5FI7 A;  4ME4 A;  3RTY A;  5CRF A;  5TBM A;  4DXC A;  1LHY A;  5F82 A;  2Z2M B;  2Z6C A;  5DVA A;  2YKF A;  3MKF A;  1BZA A;  4DXB A;  2Y2Q A;  3MSH A;  4F3L B;  1W7F A;  4UAA A;  2ZD8 A;  1F5M A;  4JGR A;  1ODV A;  2DNS A;  1NZO A;  2V0U A;  1FR6 A;  1T18 A;  4JGQ A;  4JXV A;  2W3H A;  2LB5 A;  3U4L P;  2VA0 A;  3ZHH A;  4FSF A;  4ZBE A;  2VGL M;  3LID A;  3LI9 A;  3WRZ A;  1OTD A;  1DY6 A;  3CG5 A;  2MJ6 A;  2P74 A;  2WKR A;  2GZA A;  3IXG A;  4ID4 A;  3T4L A;  2H10 A;  1Z09 A;  2J80 A;  4PHT A;  2PYR A;  2V8C A;  3ICY A;  1CK3 A;  2OAQ 1;  1OJG A;  1BLP A;  2P7J A;  3UB8 A;  3BFD A;  3KYZ A;  3WS2 A;  4ETZ A;  5CER A;  1P97 A;  2E8J A;  3S1Y A;  3IXH A;  2WKH A;  1ZG4 A;  1KDW A;  1TS6 A;  5FQI A;  2EFX A;  3ULF A;  1S1Z A;  2ZC3 B;  5L2F A;  1Q2P A;  4S2P A;  3DTE A;  1L0D A;  1GSX A;  1BUE A;  5AVE A;  2C5W B;  4DJ3 A;  1ES3 A;  4II7 A;  3W4Q A;  5BOH A;  2VV8 A;  1TS8 A;  3A3D A;  3OPL A;  1K38 A;  3PYP A;  5L8M A;  3IXB A;  5G4Z A;  5CEB A;  4MN6 A;  3MFD A;  4KZ5 A;  4R0Q A;  4I5S A;  5HD5 A;  5F6A A;  4LRX C;  3WS5 A;  1K57 A;  2VGL S;  5AQ9 A;  3GQZ A;  4QD4 A;  4Y0U A;  3QP5 A;  1G28 A;  3BFF A;  1ERM A;  3CPT A;  1M40 A;  4BLM A;  1S4S A;  2ZOI A;  4NK3 A;  1UGU A;  1OME A;  4Y5F A;  2WGI A;  2ZC7 A;  3T1S A;  3EWK A;  5JYP A;  3NJA A;  3CI6 A;  4BMW A;  4KEN B;  3FC7 A;  1FSY A;  4IJG A;  3IWO A;  4X55 A;  4N1X A;  3F1O A;  3H82 B;  4KQQ A;  1LI0 A;  4S2J A;  3PAG A;  2HJ9 C;  4UA6 A;  2OWH A;  1IYP A;  3P09 A;  3VFF A;  1KOU A;  3OPR A;  1N9O A;  5KIZ A;  5CTN A;  4OLD A;  4FCF A;  1VET A;  1VM1 A;  2R9X A;  1IKG A;  1HZO A;  4UA9 A;  3DTI A;  4DE1 A;  2H28 A;  3MF0 A;  4GDB A;  3HLC A;  5E2H A;  3T1Q B;  5TGF A;  2WKI A;  5I5L A;  1NZU A;  4EU0 A;  3T4S A;  4QY6 A;  1MWS A;  2GX5 A;  2FH5 A;  4NG2 A;  3UME A;  3NEC A;  3KYQ A;  2Y2L A;  5FQK A;  3UB5 P;  2PD7 A;  2W3E A;  1XA7 A;  2QHK A;  2WKQ A;  4BQM A;  3VMA A;  1OTI A;  2JKR I;  1LI9 A;  4WZ4 A;  3LCE A;  1YSP A;  2W3D A;  2VKS A;  1MWR A;  2XQZ A;  1VQQ A;  3ZDJ A;  3LIC A;  5CHM A;  2HPB A;  2ZQ7 A;  1BYW A;  5GLD A;  2XK1 A;  2Y8H A;  2ZOH A;  1LSW A;  1N9B A;  3IT9 A;  3MZF A;  1ZC2 A;  4EUZ A;  2ZC5 B;  2Z2L B;  5L07 A;  1TDL A;  3IF5 A;  4HNB A;  1FR1 A;  4N9L A;  4GN2 A;  3VP2 A;  2QYB A;  4Y0T A;  2O9B A;  1YAX A;  3LGO A;  4WBG A;  1SKF A;  2HDU A;  4F3L A;  1DP9 A;  4HH2 A;  4MN5 A;  4E04 A;  2WZZ A;  1RP5 A;  2HJE A;  4ZJ3 A;  2QKP A;  1JWV A;  4HJ4 A;  1N9N A;  3ZG7 B;  1GA0 A;  1PI4 A;  1K6R A;  4R4R A;  1TS0 A;  4BBT A;  3CHW P;  4EES A;  3UE3 A;  1SHV A;  2JKF A;  4HI4 A;  1YT4 A;  5HWV A;  3O5Y A;  2INW A;  2ZM8 A;  1QMF A;  3NIA A;  4K91 A;  4IBX A;  1YMS A;  4E3J A;  2ZJ9 A;  3HLE A;  4LRZ E;  4I3J A;  2WUQ A;  5KZH A;  5HDS A;  3CJM A;  3W2Z A;  3N8S A;  3A0V A;  4Z1W A;  2W1T B;  2FFF B;  4Q0J A;  2Y2G A;  4CPK A;  4ZTK A;  1I2W A;  4LGW A;  4CLC E;  5M1A A;  5E2F A;  2NUP C;  3V39 A;  3GMW A;  3LEQ A;  4MLL A;  1M6K A;  5DJU A;  2V20 A;  4S2O A;  3E4P A;  3LYX A;  4R23 A;  5FL3 A;  4OKP A;  3LUQ A;  4FH4 A;  1JTG A;  2G7U A;  4P0M A;  1XKZ A;  4RX2 A;  1GHM A;  4DDS A;  1E4D A;  2GNX A;  5FAT A;  3LR4 A;  2KDK A;  3CWF A;  5KSC A;  2Y2J A;  3MXR A;  4GCZ A;  4LV0 A;  1S66 L;  2ZM0 A;  4YOF A;  4S2M A;  4Y13 A;  4E3N A;  4KZB A;  2A2L A;  3WS1 A;  3MKE A;  4WEJ A;  1O07 A;  3EEA A;  4L9G A;  1SCW A;  3IS2 B;  2HP5 A;  1BSG A;  2B5R A;  1D06 A;  3KYE A;  3OC2 A;  5FQJ A;  4CQH A;  4EBP A;  5HAQ A;  5AJG A;  5EFW A;  3TE8 A;  4FH2 A;  3H82 A;  3D4F A;  3S7P A;  5GHY A;  5FAQ A;  4MBF A;  3ZNT A;  5EPH A;  4IVK A;  1LL8 A;  3GV9 A;  4YFM A;  2ZQD A;  5J3W A;  3TOI A;  5AQB A;  1PWC A;  4N1H A;  4RX3 A;  4QB8 A;  4KQO A;  3WWX A;  4HY8 A;  1N9L A;  3BEB A;  4BBV A;  4E6X A;  1TD5 A;  4GJ4 A;  2JKT I;  3W4O A;  3VP0 A;  4C6Y A;  4F94 A;  3CMZ A;  4B93 A;  4HIA A;  2XA7 S;  3G2Z A;  4PM6 A;  5L10 A;  1K25 A;  2G2W A;  1IYS A;  3O86 A;  3ITB A;  4RQ9 A;  3UDF A;  3N8L A;  4YWZ A;  3SS4 A;  1ES2 A;  2EXB A;  3ZG9 B;  2IA2 A;  2R78 A;  1DJB A;  4OQI A;  4MDZ A;  1OTA A;  3QHY A;  3DTM A;  3H9W A;  3KSI A;  4PM8 A;  3SH9 A;  5FQM A;  2B95 A;  5AQ7 A;  1LL5 A;  3F1P B;  4UQI S;  2XFT A;  5FAS A;  2PU4 A;  1XJ2 A;  5HWW A;  4DJ2 A;  1BUL A;  1YPR A;  4OPY A;  1W8Y A;  3BRM A;  4OP5 A;  3Q7V B;  3O88 A;  1XJ6 A;  3U2A A;  2XLN A;  4OLG A;  2V1B A;  4GZB A;  1PW8 A;  5EM1 A;  2XFS A;  3DWZ A;  4R38 A;  2BTF P;  3UPO A;  2QMI A;  5AVF A;  3F1N B;  4QY5 A;  2WGV A;  5CED A;  4KQD A;  1LL9 A;  1DRM A;  3MFX A;  2VK3 A;  2E8I A;  1TEM A;  4X68 A;  3L9K A;  2DCF A;  1Y28 A;  3TRC A;  2OLU A;  4WEK A;  1J9M A;  4DRT A;  4EEP A;  1DJA A;  3E2L A;  2KLI A;  1J3W A;  1YM1 A;  5EOO A;  4B4X A;  1XJ3 A;  4WMC D;  4GD8 A;  5E2E A;  4C75 A;  4E3I A;  3UDX A;  1FIL A;  1XGJ A;  4ZJ1 A;  1JNU A;  3T12 B;  1DJC A;  2WAD A;  1SDE A;  3DAV A;  2UV0 E;  4QU3 A;  4I39 A;  3ZG5 A;  3T4Q A;  3K3D A;  2JKG A;  5FA7 A;  3TJZ C;  3B3X A;  4B9O A;  3UN7 A;  3SH8 A;  3LIE A;  3M2K A;  1LT0 A;  2YKH A;  1WYB A;  5FQ9 A;  2J7V A;  1PIO A;  4NEE D;  2XSS A;  3MS6 A;  3M6B A;  1JWP A;  5IS1 A;  1NLY A;  3C5A A;  4PKY G;  2ZBB A;  4WZ5 C;  4HOI A;  1FQG A;  4JPM A;  4PPR A;  3B33 A;  3UPP A;  3UE1 A;  3HRE A;  1KGE A;  3PBS A;  1KE3 A;  4P6Z S;  5CGS A;  1K55 A;  4KUO A;  2RL3 A;  2C6W B;  3IWQ A;  1ALQ A;  2M7V A;  3L7H A;  1ZTU A;  5HW3 A;  4KZ8 A;  3V5M A;  3NI9 A;  1CJF A;  1YQS A;  3KSF A;  2EWV A;  2P9V A;  3VOZ A;  3HUM A;  2DMW A;  3IS2 A;  2VEA A;  3KX0 X;  2Y79 A;  1PYY A;  2XH9 A;  2ACG A;  2O99 A;  4I3I A;  3LY3 A;  3BY9 A;  4LEN A;  3T4K A;  4Q8I A;  3MQQ A;  4UHU A;  1CEG A;  3PBQ A;  1Y4O A;  4NKP A;  3PBR A;  4HP4 A;  4MMN A;  5D3O A;  4RVA A;  2A24 B;  3PR6 A;  1OJ5 A;  3FG8 A;  4OH0 A;  1GA9 A;  5GHX A;  4KZA A;  3H7W B;  3HUO A;  2WKE A;  3NDE A;  4LFU A;  4ETX A;  3C7U A;  2PBD P;  5EV0 A;  1ESU A;  2OAP 1;  3T1X A;  3EQU A;  3JPU A;  5L09 A;  2XRO A;  1YLP A;  1G6O A;  3PBT A;  2ZLY A;  4BD0 A;  3RJU A;  3MXS A;  5JYO A;  1LLB A;  1K54 C;  2XD1 A;  4CJN A;  5LBR A;  5CEC A;  3QP8 A;  3O87 A;  4EBL A;  3SOI A;  4X6T A;  2XR0 A;  1S1Y A;  4WM9 A;  5DFY A;  4N9K A;  4FTX A;  1ACF A;  5G4Y A;  2JCH A;  4DDY A;  4PM5 A;  3HLB A;  4GHI A;  3TW8 A;  5HAI A;  2EX8 A;  2IWC A;  2W0N A;  2KX6 A;  2JC7 A;  3BM6 A;  4EET B;  3MXQ A;  1NJ4 A;  3VSK A;  3IX4 A;  5HFO A;  4FUW A;  3LIB A;  3MZE A;  3T4J A;  1KGG A;  3C7V A;  4WMC A;  3ZVT A;  5HL1 A;  3PHY A;  1UWN X;  3N6I A;  2ZC6 B;  3HVF A;  4OOY A;  4Y17 A;  2M7U A;  3Q7V A;  1IKI A;  1D1J A;  2OV5 A;  3HJI A;  2WKP A;  4OVD A;  4HES A;  4JGP A;  5KMW A;  2W1R A;  2I9V A;  1EI5 A;  3UB9 A;  1YLT A;  3FKW A;  1T19 A;  3FPW A;  3ZFZ A;  1YKD A;  3JVU A;  3VE3 A;  1H5X A;  4MN7 A;  2OLV A;  3EEH A;  1C3B A;  3B47 A;  2ZMF A;  3CUE C;  4U0T A;  5CXW A;  5FAP A;  2ZQ8 A;  4Y2F A;  2HP6 A;  2M1C A;  4YNR A;  1L2S A;  4S2N C;  2L1M A;  4LV2 A;  2WAE A;  1V9Y A;  4JXW A;  3A3E A;  3S7O A;  2EXA A;  4GOG A;  3WS0 A;  4QPR A;  4U3T A;  5M19 A;  4G3V A;  3EOI A;  2O9A A;  2HDR A;  2Q9M A;  1K0K A;  2P04 A;  5CGW A;  3RFB A;  2QJ7 A;  5DKL A;  5A91 A;  1GSW A;  4S2I A;  3BW6 A;  4KQR A;  1I5Q A;  1T1B A;  5F1G A;  1U60 A;  1VEU B;  1GHP A;  2D02 A;  2EA9 A;  4KZ6 A;  1S4R A;  3OOV A;  1W8Q A;  1E25 A;  4L9F A;  3NOP C;  1H3Q A;  4LV3 A;  4JF6 A;  3UPN A;  3RH8 B;  5EUA A;  5F1F A;  4GW9 A;  3HBR A;  4FD8 A;  4E6W A;  5EVI C;  5J7E A;  1BLC A;  2WK0 A;  3LR5 A;  2ZM2 A;  3RXW A;  1KDS A;  3SW1 A;  3DBA A;  3UMD A;  4WL9 A;  3QP2 A;  2PT7 A;  4OQ0 A;  3GR2 A;  4ARZ B;  3G34 A;  4OPR A;  4E3O A;  3OCL A;  2EX6 A;  1EWZ A;  3IQA A;  2HDS A;  3ZG8 B;  5DTT A;  1ZKJ A;  2HDQ A;  4DE3 A;  2HGV A;  4R1G A;  5CX7 A;  5FSR A;  4DKI A;  2PHY A;  2JE5 A;  4JF4 A;  4OON A;  5M18 A;  2Y2N A;  3WS4 A;  1IEM A;  2QZ6 A;  3TG9 A;  5TBM B;  4LRY C;  1UWP X;  3A3I A;  4KUK A;  3MR0 A;  2VGK A;  4EUV A;  3Q7Z A;  1MKI A;  5FDH A;  3VOL A;  4G3W A;  1BLS A;  3A3F A;  1PWD A;  4H6J B;  3OPH A;  5I94 A;  4E3K A;  4PAU A;  4P87 A;  1TS7 A;  4IED A;  4GDN A;  3LFV A;  3BQ8 A;  4ZJ2 A;  4QWO A;  4BD1 A;  3ZNY A;  2Y2M A;  5EE8 A;  4M4X A;  2Y2O A;  2HP9 A;  1MC0 A;  3C2W A;  4EER A;  3ZGA B;  2Y2K A;  4P6B A;  4ZRR A;  4RA7 A;  4Y0O A;  1IYQ A;  3IWI A;  2Y2I A;  4XUZ A;  1F9I A;  1PZP A;  3BLM A;  1NYY A;  4B4Z A;  4BL3 A;  5HX9 A;  3MJQ A;  2PD8 A;  2BLS A;  3IH9 A;  2J8Y A;  3PXP A;  4WF0 A;  3I7J A;  2QPN A;  3R7W B;  3R4K A;  5F69 A;  4DF6 A; 
#chains in the Genus database with same CATH homology
 1OPX A;  2P08 A;  2KLI A;  2LB9 A;  1XJ3 A;  3CAX A;  1G28 A;  4XT2 B;  2L4R A;  1STZ A;  1S4S A;  1VHM A;  2ZOI A;  3C8C A;  1W63 M;  1UGU A;  4R70 A;  5HDC A;  4Y5F A;  3A0S A;  1JNU A;  5HPI A;  3EWK A;  1H8M A;  3NJA A;  3CI6 A;  4BMW A;  3FC7 A;  3MMH A;  4BWI A;  4I39 A;  4IJG A;  3T4Q A;  2QJ5 A;  3F1O A;  3K3D A;  3H82 B;  3CIT A;  3T4O A;  3TJZ C;  2ZMV A;  4R3A A;  3KSG A;  4B9O A;  3EQV A;  3LIE A;  1LT0 A;  2YKH A;  2W3G A;  1EW0 A;  2HJ9 C;  4NEE D;  2XSS A;  3IBJ A;  2VV7 A;  3C30 A;  5IS1 A;  1NLY A;  2OWH A;  2NUT C;  4PKY G;  4L0L A;  3PBO A;  2ZBB A;  4HOI A;  1TF1 A;  1KOU A;  3C38 A;  1N9O A;  5KIZ A;  1XFN A;  3B33 A;  2K7S A;  3PBS A;  1NWZ A;  3F1O B;  4P6Z S;  2H28 A;  4KUO A;  3MF0 A;  3LIA A;  1YSQ A;  4NXE A;  4AFI A;  3GEC A;  3BJN A;  4HP9 A;  1IFQ A;  2M7V A;  1ZTU A;  2A24 A;  3MQ0 A;  5I5L A;  4MCW A;  4EU0 A;  3T4S A;  1OTB A;  4HQA A;  3KO6 A;  3H7W A;  1OT9 A;  2EWV A;  3KSF A;  4DMZ A;  2GX5 A;  2FH5 A;  3UME A;  2DMW A;  3BQA A;  3IS2 A;  3KYQ A;  4DN0 A;  2VEA A;  3FPV A;  3ZQ5 A;  2PR6 A;  3K2N A;  2PD7 A;  3KX0 X;  2Y79 A;  1XJ4 A;  2W3E A;  2QHK A;  4WEL A;  2WKQ A;  2O99 A;  4I3I A;  3E0Y A;  3BY9 A;  5K5B A;  1OTI A;  2JKR I;  4NXF A;  3T4K A;  2J3W A;  4EEU A;  2W3D A;  1YSP A;  2K2N A;  3B42 A;  2VKS A;  2CMN A;  4I3A A;  2XA7 M;  4K08 A;  3MQQ A;  3LIC A;  3PBQ A;  1BYW A;  2VX8 A;  4EXO A;  4NKP A;  3PBR A;  2Y8H A;  2ZOH A;  4HP4 A;  4MMN A;  3V67 A;  1LSW A;  2A24 B;  5DJT A;  3PR6 A;  1OJ5 A;  3FG8 A;  4HH3 A;  2O9C A;  1P9R A;  4HJ3 A;  3H7W B;  4UEY A;  4HNB A;  4ETX A;  1MKM A;  3D3O A;  5KSH A;  4CLC B;  3OBF A;  3CUE A;  4I38 A;  3IBR A;  2QYB A;  4ARZ A;  2JKT M;  1OTE A;  2O9B A;  2OAP 1;  1YAX A;  2VV6 A;  3EQU A;  3T4T A;  3NHQ A;  1MZU A;  4F3L A;  2XRO A;  1DP9 A;  4HH2 A;  1G6O A;  2L0W A;  3PBT A;  4MN5 A;  4E04 A;  4UQI M;  2HJE A;  3EGX C;  4JGO A;  2QKP A;  4GLQ A;  5LBR A;  2B18 A;  3JVV A;  4HJ4 A;  2JHE A;  5C5K A;  1N9N A;  5F68 A;  1S1Y A;  5IU1 A;  2VJW A;  2O0Y A;  5DFY A;  1TS0 A;  2OWJ A;  5G4Y A;  4BBT A;  2W1T A;  3HCY A;  3OLO A;  4GS9 B;  4EES A;  1T1A A;  3UE3 A;  4GHI A;  3PBN A;  4O8G A;  4H6J A;  3TW8 A;  1IOU A;  4HI4 A;  1NRJ A;  2W0N A;  2KX6 A;  2Z6D A;  5HWV A;  5HSQ A;  1ZHH B;  3O5Y A;  2INW A;  3MQO A;  1VB6 A;  2VLG A;  4CLC D;  4BBU A;  1T1C A;  4EET B;  4CLC C;  5HL6 A;  3MXQ A;  1LSX A;  4G3K A;  5F5Y A;  3NOU C;  3LIB A;  3T4J A;  1DP6 A;  2GJ3 A;  2HV1 A;  4LRZ E;  1F98 A;  4NXB A;  4I3J A;  2PR5 A;  5HDS A;  2BAS A;  4OOL A;  2W27 A;  3GDI A;  3W2Z A;  3PHY A;  1UWN X;  1D7E A;  2EWW A;  2QWS A;  3A0V A;  4Z1W A;  2W1T B;  2M7U A;  3BY8 A;  2V1A A;  5TJJ A;  3HJI A;  4Q0J A;  2WKP A;  4GHI B;  4OOM A;  4JGP A;  2W1R A;  2I9V A;  4Y3I A;  3UB9 A;  2OOL A;  1T19 A;  3LIF A;  4CLC E;  3FPW A;  2NUP C;  3NOT C;  4WUJ A;  2W3F A;  1P0Z A;  5DJU A;  4NXG A;  1YKD A;  3JVU A;  3VE3 A;  4MN7 A;  5HDD A;  3G6O A;  2HF6 A;  3EEH A;  4FOF A;  3B47 A;  2ZMF A;  3CUE C;  3VV4 A;  3E4P A;  3LYX A;  5FL3 A;  3LUQ A;  3A0R A;  2V0W A;  2G7U A;  2XRN A;  2KOI A;  4Y2F A;  2M1C A;  4O0P A;  2GNX A;  4YNR A;  3LR4 A;  4IHQ A;  3R7W A;  2KDK A;  3CWF A;  2L1M A;  3K3C A;  3EGD C;  1V9Y A;  1V9Z A;  5DF9 A;  3S7O A;  4GCZ A;  1S67 L;  4LLO B;  3E98 A;  1S66 L;  5DFX A;  4YOF A;  4QPR A;  3T50 A;  2PDR A;  2A2L A;  4G3V A;  3EOI A;  2O9A A;  4XT2 A;  2B02 A;  2P04 A;  4WEJ A;  3EEA A;  4L9G A;  2J3T D;  2VZW A;  3OCN A;  3RFB A;  4O01 A;  2QJ7 A;  4Q0H A;  1WA9 A;  2J3T C;  5DKL A;  4L9E A;  3IS2 B;  1GSW A;  5J4E A;  3BW6 A;  1D06 A;  3OC2 A;  4CQH A;  4HJ6 A;  3CLO A;  1T1B A;  4P6Z M;  2D02 A;  2EA9 A;  5AJG A;  5EFW A;  1S4R A;  3TE8 A;  3OOV A;  5HZH A;  4L9F A;  4LPZ A;  3NOP C;  3VE4 A;  3H82 A;  3S7P A;  5MC7 A;  5HPF A;  1H3Q A;  2V9A A;  3ZYT A;  3RH8 B;  1LSV A;  3LR0 A;  2FZ0 A;  1LL8 A;  4GW9 A;  4ME4 A;  5J3W A;  5J7E A;  3RTY A;  2D01 A;  3D72 A;  3LR5 A;  4HY8 A;  4KQO A;  5TBM A;  1N9L A;  3SW1 A;  3DBA A;  3UMD A;  4BBV A;  4WL9 A;  2Z6C A;  2PT7 A;  1TD5 A;  4GJ4 A;  1NLZ A;  4ARZ B;  2YKF A;  4BJP A;  2JKT I;  2PYP A;  3OCL A;  4F3L B;  4B93 A;  4HIA A;  4WLA A;  2HGV A;  5CX7 A;  3F1P A;  2XA7 S;  1F5M A;  2PHY A;  4JGR A;  1ODV A;  1P9W A;  4EQ1 A;  2V0U A;  1T18 A;  4JGQ A;  5DKK A;  2W3H A;  3S7N A;  2LB5 A;  4RQ9 A;  2VA0 A;  3UE6 A;  5TBM B;  4FSF A;  3LI8 A;  4LRY C;  1UWP X;  2VGL M;  4KUK A;  3MR0 A;  4YWZ A;  3HJK A;  3LID A;  3LI9 A;  4EUV A;  1OTD A;  2MJ6 A;  2WKR A;  2GZA A;  3VOL A;  4G3W A;  3T4L A;  2IA2 A;  2R78 A;  2J80 A;  4PHT A;  4H6J B;  2PYR A;  3UB7 A;  1DP8 A;  3ICY A;  4MDZ A;  1OTA A;  4EW7 A;  2JKR M;  2OAQ 1;  5HD3 A;  1OJG A;  2P7J A;  3UB8 A;  4PAU A;  3H9W A;  4Q0I A;  3KSI A;  3KYZ A;  1TS7 A;  3P7N A;  3S7Q A;  3F1N A;  5A8B A;  1XFQ A;  4ETZ A;  2K31 A;  3LFV A;  1P97 A;  3BQ8 A;  3E4Q A;  3F1P B;  4UQI S;  4IUH A;  4M4X A;  3E4O A;  1XJ2 A;  5HWW A;  1X0O A;  1MC0 A;  3C2W A;  4HHD A;  4EER A;  4DJ2 A;  1TS6 A;  4WN5 A;  3ULF A;  4R6L A;  1S1Z A;  5IT5 A;  4CLC A;  5HWT A;  1XJ6 A;  3U2A A;  4ZRR A;  1GSX A;  5AVE A;  2V1B A;  4IUK A;  3BWL A;  3P01 A;  4DJ3 A;  2JN7 A;  3UB6 A;  4II7 A;  3KSH A;  1F9I A;  4R38 A;  2VV8 A;  1GSV A;  1TS8 A;  5AVF A;  3F1N B;  3LR3 A;  4KQD A;  4PKY A;  3PYP A;  5L8M A;  1DRM A;  3MJQ A;  3MFX A;  2PD8 A;  5G4Z A;  4MN6 A;  3PXP A;  4WF0 A;  1Y28 A;  4I5S A;  5HD5 A;  5F6A A;  1W63 Q;  3TRC A;  3R7W B;  4WEK A;  4LRX C;  1OT6 A;  3R4K A;  5F69 A;  2VGL S;  4EEP A;  4GS9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...