1LSWA

Crystal structure of the ferrous bjfixl heme domain
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
117
structure length
117
Chain Sequence
DAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRYRTTSDPHIIGIGRIVTGKRRDGTTFPMHLSIGEMQSGGEPYFTGFVRDLTEHQQTQARLQELQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Sensor protein FixL
publication title Structure-based mechanism of O2 sensing and ligand discrimination by the FixL heme domain of Bradyrhizobium japonicum
pubmed doi rcsb
source organism Bradyrhizobium japonicum
total genus 31
structure length 117
sequence length 117
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2002-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1lswA00
3LIFA 1XJ6A 1OTBA 2ZBBA 4NXGA 4M4XA 4NXEA 3UB6A 2QHKA 2INWA 1XJ2A 1OJ5A 3HJIA 4I3JA 2W0NA 3NJAA 4BBVA 4EQ1A 1F9IA 5HD3A 3MJQA 1GSWA 2W27A 2PD7A 1S1ZA 4LRXC 3C2WA 1OT6A 4YWZA 4I39A 4I3IA 4JGOA 3A0RA 4XT2B 4B9OA 1LT0A 3LIDA 3PYPA 4WN5A 2V1BA 4GS9B 1UGUA 4I38A 4HJ4A 4EXOA 5DJUA 4HY8A 3IBRA 4I3AA 4HIAA 1OTAA 4R70A 3RH8B 4GW9A 2V1AA 3UMEA 4LPZA 1T19A 3NOUC 1V9ZA 3UB9A 2QJ7A 3F1NA 3EWKA 2I9VA 5TBMA 3VE4A 2K7SA 3NHQA 5TBMB 2VEAA 1UWPX 4WF0A 1UWNX 1OTIA 4WLAA 1S67L 4EESA 3PHYA 2D01A 4E04A 2P7JA 4HQAA 4L9FA 1TS7A 4JGPA 1V9YA 3UMDA 3F1OA 2VLGA 3CWFA 3HJKA 3F1OB 1OTDA 1DRMA 2YKFA 4R6LA 1EW0A 3CLOA 4HOIA 3H9WA 4WUJA 3FC7A 5AVFA 3LI9A 1F98A 1XJ3A 2VV6A 4EW7A 1BYWA 3NOTC 2L1MA 4F3LB 1P0ZA 1DP8A 4MN5A 2OWHA 4BBUA 2WKRA 2B02A 3LYXA 3G6OA 4EEUA 2PHYA 3BWLA 4HP4A 4DJ2A 2VV8A 4LLOB 3GECA 4R38A 3MQQA 4EETB 1N9OA 2JN7A 4WL9A 2L0WA 5I5LA 5G4ZA 2OWJA 3LIBA 2PD8A 1XFQA 5A8BA 1OJGA 2V0UA 4RQ9A 4XT2A 1DP9A 5F6AA 2D02A 2M1CA 2HV1A 3IS2B 4JGRA 2V9AA 4GS9A 3EEHA 2BASA 2YKHA 5HZHA 4HH3A 1T1BA 1GSVA 1S4SA 1P97A 1JNUA 3H7WB 3LUQA 4HH2A 2R78A 3LI8A 2EA9A 1TS6A 2Z6DA 2QWSA 4GCZA 1XJ4A 5DJTA 5F68A 1T18A 1MZUA 3SW1A 1GSXA 4GHIA 4LRZE 2GJ3A 1TS8A 3LICA 4GHIB 3OLOA 5HDDA 3BY9A 2KX6A 3C8CA 4HP9A 1LSXA 4NXFA 3E4QA 4I5SA 2ZOHA 4K08A 3BY8A 2J80A 4HI4A 3MFXA 5F5YA 5HD5A 2A24B 3E4OA 1XFNA 4L9EA 5F69A 2JHEA 4F3LA 4DJ3A 5HWTA 3K3CA 2WKQA 3F1PB 3H82B 2OOLA 1LSVA 1VB6A 4H6JB 3ZQ5A 2WKPA 2Z6CA 4JGQA 2QJ5A 3LIAA 3NOPC 3GDIA 3RTYA 3CAXA 5J7EA 5DKLA 5HSQA 3P7NA 1S66L 4HJ3A 4HNBA 1TS0A 4EERA 3MQOA 4EEPA 1X0OA 3MXQA 4NXBA 1N9NA 3IS2A 2ZOIA 4KUKA 5DKKA 2QKPA 3ULFA 4R3AA 3FG8A 1T1AA 1LL8A 2PYPA 4KQDA 3T50A 1LSWA 1S1YA 2PR6A 5IU1A 5J4EA 3H7WA 3KX0X 3A0VA 5G4YA 1D06A 4BBTA 5HDCA 5AVEA 1Y28A 2PYRA 3UB7A 4PKYA 3A0SA 2VV7A 5IS1A 1NWZA 2H28A 1KOUA 5HWWA 3UB8A 2L4RA 3LIEA 4L9GA 3B33A 1DP6A 3F1NB 3VOLA 2PR5A 1S4RA 4MN6A 4HJ6A 1OT9A 5KIZA 5J3WA 5HWVA 2A24A 1D7EA 1ODVA 3UE6A 3K3DA 1G28A 2CMNA 2KDKA 2PDRA 5EFWA 1T1CA 4KUOA 3E4PA 3VE3A 3ICYA 4LRYC 1OTEA 5HDSA 4HHDA 3F1PA 3H82A 4H6JA 1N9LA 2V0WA 3MR0A 1WA9A 3D72A 4PKYG
chains in the Genus database with same CATH superfamily
2W3EA 5HL1A 3CPTB 4NXGA 3ISGA 3HLGA 3RJUA 3BFCA 2HF6A 4OP8A 5A93A 4FCFA 3VP4A 3T4SA 3MZFA 3IX4A 4FTXA 4Q0JA 5A90A 2H0YA 4WEJA 3QP5A 4EQ1A 3CUEA 5EM0A 2HZ5A 4KENB 2JE5A 4LRXC 5EOOA 5JYOA 1K0KA 3BRMA 3C2WA 3L7HA 1OT6A 3N4IA 2V2FF 4I39A 3QNBA 4UAAA 4E3MA 4B9OA 1PZOA 5E43A 3VV4A 4EWFA 3PYPA 4OOMA 1NXYA 2P9VB 4KZAA 4KZ8A 4WYYA 2HP9A 3T4LA 5EVIA 4QWOA 3KSGA 2GX5A 5FDHA 3FWLA 5KSCA 2E8JA 4EXOA 4Y2FA 1LL5A 3MQ0A 4I3AA 4HIAA 4MCWA 3OC2A 1OTAA 4R70A 1IYOA 2Q9MA 1L0FA 4IJGA 4E3JA 3W2ZA 1WYBA 3V67A 4O01A 3CJMA 1ONHA 1WYCA 5E2HA 1V9ZA 3IWQA 5L2FA 3DTEA 1M6KA 4KG5A 1ZC2A 3NHQA 3JYIA 4PM6A 4KQQA 1VEUA 2B5RA 5EVID 1H3QA 4JKTA 4E04A 4L9FA 1TS7A 3LY4A 2WGVA 3UMDA 3VP2A 3ZG7B 1BSGA 2HJ9C 1NYYA 5CRFA 4YOFA 3WS0A 4R6LA 3BW6A 4OP5A 2J3TD 4RA7A 4WELA 3FC7A 2GDNA 1F98A 4DXCA 4OQHA 4GD6A 5DTKA 2VV6A 1GA9A 1BYWA 2WKIA 4FH2A 3N8RA 3KYEA 3E2KA 1G68A 3AGDA 2IWBA 3LYXA 3G2YA 3NECA 4HP4A 4DJ2A 1QMFA 2VV8A 3EOIA 1H5XA 5GHXA 1TF1A 2L0WA 5G4ZA 2OWJA 2Y79A 4DE3A 1KE4A 2PD8A 2V0UA 4GN2A 4N1XA 1K56A 4MDZA 4KG2A 4GZBA 4ETZA 4PAUA 3IS2B 1LI0A 2WGWB 4MMNA 4DN0A 3HL9A 2DRWA 2V9AA 3TSGA 3EEHA 1N4OA 2VX8A 5HL6A 2XSSA 5HZHA 3HUNA 1T1BA 1H8YA 4BD1A 1CEGA 4X56A 3LUQA 2HDRA 4S2JA 4RX3A 2R78A 1YSQA 3VMAA 1TS6A 4KZ7A 3V3SA 3GR2A 3OPPA 4UA6A 4WZ5A 4XXRA 1MZUA 2ACGA 5EV0A 5AQ9A 2W3DA 3IH8A 3E0YA 4Z1WA 1NRFA 1K56D 4GHIA 4LRZE 1TS8A 3ZHHA 3LICA 4GHIB 3OLOA 1Z09A 2UWXA 3S7NA 4Y5FA 1IYPA 2EWVA 4NXFA 3N6IA 2C6WB 2WKHA 1KGFA 5LBRA 1PWDA 5IT5A 2EX6A 3PTEA 1RGZA 2W1TB 3G35A 5GLBA 1GA0A 4JLFA 4R1GA 5EVLA 1EWZA 1L0EA 3KSIA 1XPBA 3BM6A 4GKUA 5HFOA 1FR1A 4F3LA 1YPRA 5HWTA 3QP2A 5FEFA 1KDSA 1LSVA 5EUAA 1H0MA 2WKPA 3BLSA 1ZG4A 5CHJA 2Z6CA 4JGQA 4S2NC 1MKIA 3GDIA 3EQUA 5FSRA 4KQRA 3RTYA 1CI9A 5DKLA 4NETA 4GNUA 1S0WA 4N9LA 4BJPA 4EEPA 1MBLA 1X0OA 1FQGA 4CLCC 4NXBA 5FQJA 4DXBA 2Y2GA 1N9NA 4MBFA 1W63Q 2ZC4B 2ZOIA 1ERMA 1NY0A 3MKFA 4R23A 2H10A 5DKKA 3FG8A 3SH8A 1E25A 4BLMA 3C30A 2PYPA 4ZAMA 3ZNYA 3OCLA 2PR6A 3W8KA 5J4EA 3TE8A 4B93A 3BFGA 3HLWA 4HEFA 2V8CA 4N9KA 4GDBA 2LB9A 4PMAA 1IFQA 1Y28A 3T4TA 4PKYA 4Q0HA 2FFYA 4IVIA 4DE2A 4HESA 4M3KA 5M1AA 1NWZA 4LV2A 2WAEA 2C5WB 3PAEA 2IWCA 3BFEA 4LV1A 2OAP1 1OMEA 3F1NB 1W7FA 4NKPA 4U0XA 2VKSA 3C5AA 4WZ4A 3DWZA 3LGOA 3A3JA 1K55C 3PXPA 3UE6A 2JKRM 2JC7A 3MMHA 2PDRA 1PRQA 3DWKA 3QNCA 4WMCD 3S1YA 4OOLA 5CERA 1YKDA 1ES5A 2Q0OA 1I2WA 1VHMA 4S2LA 3VFFA 1ZTUA 1OTEA 4HHDA 5J8XA 2G7UA 1N9LA 3MR0A 1EROA 2V20A 4AFIA 3KO6A 1XJ6A 3G2ZA 2A49A 5HX9A 1MWUA 4NXEA 3UB6A 2INWA 5CEBA 1ZHHB 2ZQ8A 5KZHA 1NRJA 3GSGA 4BBVA 3NIAA 4X25A 4LENA 3FV7A 3CUEC 1SDNA 4E6WA 4I3IA 4XT2B 2XFSA 3E98A 4ZTKA 2NUTC 5GHYA 4WN5A 2V1BA 4GS9B 1GHIA 5L10A 5EVIC 2W1RA 3IF6A 4Y17A 4MEZA 1E3UA 2QZ6A 4Y3IA 1PW1A 2OAQ1 1YMXA 3Q1FA 4CPKA 3UMEA 4UA7A 3T4QA 1T19A 3NOUC 2XFTA 4GLQA 2XGNA 3ZNTA 4ETXA 1K6SA 2M7UA 4S2MA 4C6YA 3VE4A 1ONGA 3BECA 1QMEA 3MKEA 1JTGA 2VK3A 1UWPX 2Y2NA 4WF0A 3HVFA 3GQZA 1XGIA 1S67L 1GCEA 4EESA 4E3KA 4HQAA 4ZBEA 2ZMFA 3NBLA 4U0TA 3V5MA 3HLDA 3HUOA 4XUXA 3A3DA 2JKFA 4IEDA 3PBNA 1EW0A 4HOIA 2Y2KA 3GRJA 3Q7VB 2BTFP 3CPTA 3N8SA 2B95A 3LFVA 5AQ7A 1XX2A 3U4LP 4G3VA 1K6RA 4MN5A 2WKRA 2OSUA 2LB5A 5AQAA 3WWXA 3BQAA 1XGJA 2I72A 2IWDA 5DF7A 1YQSA 1TEMA 4R38A 1N9OA 2JN7A 4DE0A 4X53A 4P0MA 2Z2LB 1PW8A 5CXWA 1XFQA 2EXBA 5GLDA 5A8BA 3UDXA 3RXWA 5E2FA 5F6AA 3W4QA 3PBRA 5L09A 3ZGAB 3TJZC 2WGIA 2P9VA 2O9CA 4PM8A 3SZTA 1AXBA 1MXOA 1MKMA 2BG1A 2EX2A 2YKHA 2KOIA 1IKIA 5CHMA 4HH3A 3VSLA 4Q0IA 2Y91A 1JNUA 3BFDA 4HH2A 3LI8A 3C7UA 2EA9A 4QJGA 5FAQA 3CITA 4EUZA 2G2WA 4P6ZS 5F68A 3Q07A 4OPRA 4JXGA 4WZ5C 1KGGA 1L2SA 4QD4A 3SW1A 2O9AA 2BLSA 1BTLA 1W79A 4DRTA 2GJ3A 2PU4A 3FPVA 2OLVA 1BLPA 2IA2A 3BY9A 3T4OA 2ZD8A 1YLZA 1E4DA 2X02A 1M40A 4RYEA 3E4QA 2Y2PA 3MF0A 4I5SA 4Y0TA 4LGWA 4K08A 3BY8A 3WS2A 2HDUA 1KE0A 3HUMA 5L8MA 4CLCE 2Y2JA 2WKEA 3SS5A 1SCWA 5F5YA 4NEED 4OPZA 4R4SA 4H8RA 4ESPA 4L9EA 4IVKA 4X6TA 3UPOA 2XQZA 5F69A 4OQIA 2JHEA 3WS1A 4FSFA 4BENA 2MJ6A 3PAGA 4KZBA 1K4EA 1YSPA 2WKQA 3F1PB 2OOLA 4UA9A 2EFUA 2Z2MB 1VB6A 3ZQ5A 4CQHA 3WRTA 3ZDJA 3SS4A 4RVAA 4Z9QA 1CK3A 2ZQ9A 2QJ5A 4E3IA 5FL3A 5GHZA 2WAFA 3CAXA 3ZG9B 1K54A 1IOUA 2ZQCA 1S66L 1KDWA 4HJ3A 4CJNA 3MXSA 3MQOA 3JVUA 3MXQA 4IHQA 2JKTM 4O8GA 3V39A 3IS2A 2WGWA 1W8QA 4D2OA 4XUZA 4KUKA 4ME4A 2QKPA 3TW8A 3ULFA 5FA7A 5EOEA 3HLCA 1TVFA 4R4RA 1T1AA 4OLGA 3P98A 5IHVA 3QP8A 1YLTA 5FI7A 3RFBA 2ZC6B 3O86A 3LR4A 3KX0X 3IWOA 4BL3A 2AVXA 3QP4A 2DCFA 3MFDA 3IHBA 2DNSA 1XA7A 1W8YA 3UB7A 3HBRA 2W3GA 3PBQA 2VV7A 3C4OA 2WUQA 3IXHA 4Y0UA 2H28A 3IH9A 3UB8A 2ZQAA 1DJBA 5HAPA 1PFLA 3ITAA 1GHMA 1FILA 4L9GA 3I7JA 3B33A 4E3NA 4S2PA 5A91A 2XA7M 4ARZB 2PR5A 2W3HA 3BFFA 2W1TA 2PBDP 1CJFA 5GL9A 2ZM0A 4HJ6A 2Y2LA 2KLIA 1OT9A 2PRFA 3CG5A 2PBYA 2XLNA 3M2JA 5J3WA 2V1ZA 3A3IA 3QP6A 5FI2A 4UEYA 3G32A 5TFQA 4KZ5A 1ODVA 2EXAA 2ZL1B 2P08A 1D1JA 1BLHA 2ZLYA 1G28A 2HDSA 2KDKA 4QPRA 3O87A 4ZJ2A 3OPHA 4B88A 5A92A 4KZ9A 1DJAA 4RX2A 2JKRI 4OVDA 5EVEA 3S7OA 5HPFA 4DDYA 3T12B 1ACFA 3C7VA 1WA9A 3D72A 4X1MA 2Y2MA 3FKWA 1NLYA 4R0QA 4MNRA 2E8IA 3LIFA 4QU3A 2ZBBA 1OTBA 4M4XA 4ZDXA 3O88A 3FYZA 5MC7A 3DTKA 5FAPA 1FCNA 1ERQA 4PM7A 4Y7PA 3IBJA 3FPWA 1XJ2A 1H8ZA 1OJ5A 4P85A 4E3OA 3UDIA 4KG6A 1IKGA 2QMIA 3PR6A 2W0NA 3A3EA 4IBXA 3A3FA 1XA1A 1F9IA 2RL3A 3MJQA 5CEDA 4EBLA 1S1ZA 5KSHA 1YAXA 3UE0A 1K57A 3OZHA 4UQIM 4Y15A 5M19A 3UDFA 3A0RA 3BLMA 1FOFA 1HTZA 3LCEA 3R7WB 2P04A 1SKOB 1UGUA 4I38A 1PWCA 4HJ4A 5DFYA 1SHVA 4D60A 1XXMA 3IF6C 2XRNA 4WMCA 4HY8A 3DTMA 4KZ3A 1I5QA 1NYMA 4KQOA 1H8MA 4GW9A 2V1AA 1YLWA 5DTTA 4C3QA 2WK0A 3O5YA 3UB9A 2QJ7A 3F1NA 4FUWA 1RGYA 3EWKA 5FQQA 2K7SA 3ZVWA 2VEAA 4WLAA 3PHYA 4JGPA 1P9RA 1V9YA 3TRCA 3F1OA 2VLGA 2Y55A 3CWFA 3HJKA 1LL9A 3F1OB 2JBFA 4L0LA 3VOYA 1O07A 3HLBA 5E2EA 5CGSA 4O0PA 2YKFA 3HLEA 3KSFA 4IBRA 3LI9A 3AGFA 2VGLM 1XJ3A 4JF5A 3NOTC 4MN7A 1P0ZA 1PI4A 2XD1A 1S6RA 1CEFA 1Q2QA 2OWHA 1TDGA 4BBUA 4EBPA 3D9YA 3ZVTA 3BWLA 1PWGA 4NK3A 3EGDC 3GECA 2HDQA 1YM1A 4BQMA 3M6BA 3MQQA 4EETB 5HAQA 4WL9A 1TDLA 3Q82A 2PAVP 1MPLA 1BZAA 2XA7S 5FATA 4QY6A 4CLCB 4RQ9A 1STZA 5TJJA 3HREA 1YLPA 3G34A 4XT2A 1DP9A 2CC1A 5HAIA 5FDSA 3UE1A 1KGEA 2D02A 1DY6A 1ALQA 1HD8A 2M1CA 2ZMAA 2X01A 4JGRA 4E6XA 4II7A 4GS9A 1CI8A 2PT7A 2BASA 2ZC3B 2Y8HA 4DF6A 3UB5P 1P97A 3H7WB 1PNEA 2VGKA 2X71A 4R3JA 3VP0A 2Z6DA 3S22A 2QWSA 3EQVA 4N1HA 1XJ4A 2J3TC 5DJTA 5M18A 1FCMA 3ZYTA 3BQ8A 1CQAA 5C5KA 4CLCD 3BJNA 5CGWA 4BMWA 2W3FA 1MWTA 1GSXA 4OH0A 1LI9A 3C38A 5HDDA 2PU2A 3IF5A 4ZJ3A 3NCKA 4X1LA 1NJ4A 5HARA 1RCJA 4F94A 2EX8A 3E2LA 1K38A 3M6HA 2J80A 4DE1A 4HI4A 1WE4A 4UQIS 4HBUA 4OQ0A 3W4OA 1YLJA 5L07A 1Y4OA 3MFXA 1GHPA 2HGVA 2A24B 3Q7VA 3E4OA 5FQ9A 1XFNA 2JKGA 2ZMVA 1RP5A 4Q8IA 3GV9A 3SOIA 1KVLA 3IQAA 1KVMA 1F5MA 3H82B 4H6JB 3OPLA 1IEMA 2B18A 5U47A 5D3OA 4PM9A 4YNRA 2J8YA 1FCOA 3NY4A 3QHYA 4LCMA 3T4JA 4OPQA 5DTSA 2A2LA 5HSQA 3MZDA 3V50A 4BL2A 4HNBA 1TS0A 1K54C 2J9OA 1G5UA 5E2GA 1XKZA 1IYSA 2WADA 2JKTI 3B3XA 5TR7A 1L0DA 3VFHA 4R3AA 5KMWA 4KQDA 4YFMA 3T50A 3T1SA 1LSWA 3VSKA 3P01A 5IU1A 3MS6A 2QYBA 2VZWA 4DKIA 4S2KA 3T1RA 1C3BA 4EUVA 3A0VA 4JXWA 3OBFA 2VGLS 1D06A 5EVIB 2Y59A 5GLAA 5DFXA 4BBTA 5HDCA 5AVEA 3NC8A 4B4XA 2PYRA 2VA0A 5EPHA 2WYXA 2M7VA 3JVVA 4G3WA 3EEAA 4U3TA 4BD0A 2ZM8A 4A5RA 1SKFA 1JWVA 2DMWA 4LV0A 3PBOA 4MBKA 2Y2OA 3KSHA 2GNXA 5EE8A 2R9XA 5DF9A 2Y4AA 3KYQA 2ZQDA 1HLUP 2O0YA 1G6AA 1IYQA 5F82A 5FQKA 3VP3A 4S2IA 1ESIA 2A3UA 4MN6A 3NULA 3Q7ZA 3UE3A 1VEUB 5HWVA 5CECA 4N92A 3P09A 3K3DA 3LR3A 5EFWA 1T1CA 3MBZA 4KUOA 3O3VA 3E4PA 4FH4A 3VE3A 3ICYA 2FH5A 5HPIA 4E3LA 1SDEA 4YINA 3F1PA 3TOIA 4WBGA 5FEGA 2V0WA 2HP6A 1EI5A 5EECA 3B42A 4PM5A 3VOZA 2QHKA 2Y2QA 3HJIA 5GLCA 1PZPA 4I3JA 4IUKA 3ITBA 3WS4A 3UN7A 3NJAA 2V8FA 3K2NA 1MC0A 4JXSA 1CF0A 1NLZA 5HD3A 4FD8A 5AJGA 1GSWA 2W27A 2PD7A 3C4PA 3QP1A 2JCHA 2J7VA 4ZRRA 4OKPA 2OLUA 5F1FA 4YWZA 4JGOA 2EX9A 1K57C 1LT0A 3LY3A 3DW0A 3LEZA 3LIDA 4DMZA 1W5DA 4BWIA 1ES2A 5FASA 4JXVA 2FZ0A 3SS3A 1Z6FA 3HCYA 5DJUA 1LLBA 3JPUA 4OPYA 1BT5A 3IBRA 3GTCA 2VGJA 2HJEA 3NDGA 3G31A 3UNWA 3L9KA 5FQIA 4OQGA 3WRZA 3RH8B 3IXDA 3EGXC 4HBTA 4LPZA 1BLCA 2HP5A 4JF4A 3WS5A 3CHWP 4GB7A 5HW3A 4MLLA 3LR5A 4ARZA 3OOVA 2I9VA 1BLSA 5TBMA 3MXRA 2Y2HA 2Y2IA 2ZC7A 5TBMB 1HVBA 4GDNA 1UWNX 1OTIA 4EQIA 1PIOA 2D01A 1NZUA 2P7JA 1A0KA 2ZL1A 1FIKA 3IXBA 4B4ZA 1U60A 1OTDA 1DRMA 2O99A 5FQMA 1PYYA 3CLOA 4QB8A 3H9WA 1K25A 3R4KA 4WUJA 2R9WA 1HZOA 5AVFA 1KE3A 2XK1A 3CMZA 4EW7A 4GD8A 2L1MA 4F3LB 3MSHA 5BOHA 1DP8A 4LCLA 4KZ6A 2B02A 2G2UA 2VJWA 3G6OA 2PHYA 4EEUA 3LEQA 2XF3A 2ZM2A 4Y13A 3HLFA 4LLOB 1XP4A 3D4FA 3LO7A 2K2NA 2ZQ7A 4X68A 4K0XA 5I5LA 3UPPA 3BYDA 3LIBA 1J3WA 2WZZA 1OJGA 2ZJ9A 3R7WA 3Q81A 1PI5A 2HV1A 2P74A 4NG2A 1NZOA 1P9WA 1SKOA 1MY8A 2XR0A 3V3RA 3IXGA 1BULA 3S7PA 5AQBA 4LV3A 2H0TA 4O7DA 1GSVA 1S4SA 1L0GA 2OV5A 4WEKA 4GCZA 4EBNA 4G3KA 2WZXA 4UHUA 5DF8A 1T18A 2GZAA 5CX7A 1TD5A 5G18A 1SZVA 3T1QB 1VQQA 1AWIA 1JVJA 1BUEA 3KYZA 3BEBA 2UV0E 2Q9NA 4LFUA 2KX6A 1O7EA 5F83A 3C8CA 3FKVA 3PBSA 4HP9A 1LSXA 1FR6A 2RCXA 4KZ4A 1JWZA 2HPBA 3UY6A 3DBAA 3IX3A 3FZCA 2ZOHA 2J3WA 3NDEA 4WM9A 4QY5A 3S7QA 2XROA 5K5BA 4EU0A 3IT9A 3OCNA 5DVAA 4P6BA 1F2KA 5HD5A 1MWRA 1L3LA 4IUHA 4K91A 3DTIA 2XEPA 3SH9A 4DJ3A 4ID4A 3K3CA 3ZG0A 4X69A 3GMWA 3VP1A 1J9MA 1YMSA 4S2NA 3OPRA 1IELA 1DJCA 1OPXA 4P6ZM 4JF6A 4C75A 3LIAA 3NOPC 3UO9A 3LR0A 4X55A 3CZDA 4MBHA 5J7EA 3G4PA 1I2SA 3N7WA 3ZG8B 4CLCA 3P7NA 4EERA 3U2AA 5I94A 1LHYA 3T1XA 2J9PA 3MZEA 4OOYA 4EV4A 2QPNA 3ZG5A 5EM1A 5F1GA 1LL8A 1FSWA 1S1YA 3CI6A 1VM1A 4Y0OA 4GJ4A 4JPMA 3M2KA 3H7WA 1YT4A 5FAOA 3G30A 3IWIA 5CGXA 5G4YA 4FOFA 1VETA 4R3BA 1VETB 1JTDA 3DAVA 1Y54A 4P87A 3UPNA 1MWSA 3IF6B 5CTNA 3PBTA 3A0SA 1ES4A 5CTMA 1ZKJA 5TGFA 3AGEA 1Q2PA 1G6OA 1ZG6A 3S4XA 5IS1A 1KOUA 5HWWA 2L4RA 2EWWA 1ESUA 3LIEA 3W4PA 2K31A 5CHUA 2O9BA 2H5SA 3ZCZA 1DP6A 3VOLA 1ES3A 3B47A 1S4RA 3SH7A 1K4FA 3D3OA 4GOGA 4PPRA 1FSYA 3ZFZA 4DDSA 3RXXA 5KIZA 4JBFA 1YLYA 2EFXA 1K55A 2A24A 4OONA 1D7EA 3TG9A 2XH9A 4S2OA 2CMNA 2XDMA 4PHTA 4OLDA 1E3UD 5JYPA 4QHCA 1W63M 2ZC5B 4ZJ1A 3T4KA 1N9BA 3IX8A 4LRYC 5FI6A 3N8LA 5HDSA 3H82A 2NUPC 3NI9A 4H6JA 3IHAA 1JWPA 3GVBA 4K0WA 2XD5A 4PKYG 2FFFB
chains in the Genus database with same CATH topology
4AFIA 3B42A 3LIFA 2W3EA 3KO6A 1XJ6A 1OTBA 2ZBBA 4NXGA 4M4XA 5MC7A 2HF6A 4NXEA 3UB6A 2QHKA 2INWA 3IBJA 3FPWA 3T4SA 1XJ2A 1OJ5A 1ZHHB 3HJIA 1NRJA 4I3JA 4IUKA 3PR6A 2W0NA 4Q0JA 3NJAA 3K2NA 1MC0A 4WEJA 4BBVA 4EQ1A 3CUEA 1F9IA 1NLZA 5HD3A 3MJQA 5AJGA 3CUEC 1GSWA 2W27A 2PD7A 1S1ZA 4LRXC 5KSHA 1YAXA 4ZRRA 3C2WA 1OT6A 4YWZA 4UQIM 4I39A 4I3IA 4JGOA 3A0RA 4XT2B 4B9OA 1LT0A 3E98A 3R7WB 3VV4A 3LIDA 4DMZA 3PYPA 4OOMA 2P04A 4BWIA 2NUTC 3T4LA 4WN5A 2V1BA 3KSGA 4GS9B 2GX5A 1UGUA 2FZ0A 2W1RA 3HCYA 4I38A 4HJ4A 4EXOA 5DFYA 5DJUA 4Y2FA 2XRNA 4HY8A 3IBRA 3MQ0A 4I3AA 2HJEA 4HIAA 4MCWA 4Y3IA 2OAQ1 3OC2A 4KQOA 1OTAA 4R70A 3RH8B 1H8MA 4GW9A 2V1AA 3EGXC 4IJGA 4LPZA 3UMEA 3W2ZA 3T4QA 3V67A 1T19A 3NOUC 4O01A 4GLQA 4ETXA 2M7UA 3O5YA 1V9ZA 3LR5A 3UB9A 2QJ7A 3F1NA 4ARZA 3OOVA 3EWKA 2I9VA 5TBMA 3VE4A 2K7SA 3NHQA 5TBMB 2VEAA 1UWPX 1UWNX 4WF0A 1OTIA 4WLAA 1S67L 4EESA 2D01A 3PHYA 1H3QA 4E04A 2P7JA 4HQAA 4L9FA 1TS7A 4JGPA 1P9RA 1V9YA 2ZMFA 3UMDA 3TRCA 3F1OA 2VLGA 3CWFA 3HJKA 3F1OB 2HJ9C 4L0LA 1OTDA 4YOFA 1DRMA 2O99A 4O0PA 2YKFA 3PBNA 4R6LA 3BW6A 1EW0A 3CLOA 2J3TD 4HOIA 3H9WA 4WELA 3KSFA 3R4KA 4WUJA 3FC7A 5AVFA 3LI9A 2VGLM 1F98A 3LFVA 1XJ3A 2VV6A 4EW7A 1BYWA 3NOTC 2L1MA 4G3VA 4MN7A 4F3LB 1P0ZA 1DP8A 4MN5A 2OWHA 4BBUA 2WKRA 2B02A 2LB5A 3LYXA 2VJWA 3G6OA 2PHYA 3BWLA 4EEUA 3BQAA 4HP4A 4DJ2A 2VV8A 3EOIA 4LLOB 3EGDC 3GECA 2K2NA 4R38A 3MQQA 4EETB 1TF1A 1N9OA 2JN7A 4WL9A 2L0WA 5I5LA 5G4ZA 2OWJA 2Y79A 2XA7S 3LIBA 2PD8A 1XFQA 5A8BA 1OJGA 4CLCB 2V0UA 4RQ9A 1STZA 5TJJA 4XT2A 1DP9A 5F6AA 2D02A 3PBRA 4MDZA 2M1CA 3R7WA 2HV1A 4ETZA 4PAUA 3TJZC 3IS2B 4JGRA 4II7A 4MMNA 2O9CA 1P9WA 4DN0A 2V9AA 4GS9A 2PT7A 3EEHA 2BASA 2VX8A 1MKMA 5HL6A 2YKHA 2KOIA 2XSSA 3S7PA 5HZHA 2Y8HA 4HH3A 1T1BA 1GSVA 1S4SA 4Q0IA 1P97A 1JNUA 3H7WB 3LUQA 4HH2A 2R78A 3LI8A 2EA9A 1YSQA 3CITA 1TS6A 2Z6DA 2QWSA 3EQVA 4WEKA 4GCZA 4G3KA 1XJ4A 2J3TC 5DJTA 4P6ZS 5F68A 1T18A 3ZYTA 3BQ8A 2GZAA 1MZUA 5CX7A 5C5KA 3BJNA 4CLCD 1TD5A 2W3DA 4BMWA 3SW1A 2W3FA 2O9AA 3E0YA 4Z1WA 1GSXA 4GHIA 4LRZE 2GJ3A 1TS8A 3KYZA 3LICA 3OLOA 3FPVA 4GHIB 3C38A 5HDDA 2IA2A 3BY9A 3T4OA 2KX6A 3S7NA 3C8CA 3PBSA 4Y5FA 4HP9A 1LSXA 2EWVA 4NXFA 3E4QA 3DBAA 3MF0A 4I5SA 5LBRA 2ZOHA 2J3WA 5IT5A 4K08A 3BY8A 2J80A 2W1TB 4HI4A 3S7QA 5L8MA 4UQIS 2XROA 5K5BA 4CLCE 4EU0A 3MFXA 3OCNA 5F5YA 4NEED 2HGVA 5HD5A 2A24B 3KSIA 3E4OA 1XFNA 4L9EA 4IUHA 2ZMVA 5F69A 2JHEA 4F3LA 4FSFA 2MJ6A 4DJ3A 5HWTA 3K3CA 1F5MA 1YSPA 2WKQA 3F1PB 3H82B 2OOLA 1LSVA 1VB6A 4H6JB 3ZQ5A 4CQHA 2B18A 2WKPA 1OPXA 2Z6CA 4JGQA 4P6ZM 2QJ5A 3LIAA 3NOPC 4YNRA 3GDIA 3LR0A 3EQUA 5FL3A 3RTYA 3T4JA 1IOUA 3CAXA 5J7EA 5DKLA 2A2LA 5HSQA 4CLCA 3P7NA 1S66L 4HJ3A 4HNBA 1TS0A 4EERA 3MQOA 3JVUA 4BJPA 4EEPA 1X0OA 4CLCC 3MXQA 3U2AA 4IHQA 4NXBA 2JKTM 4O8GA 1N9NA 3IS2A 1W63Q 2ZOIA 2JKTI 4KUKA 5DKKA 4ME4A 2QKPA 3TW8A 3ULFA 4R3AA 3FG8A 3C30A 1T1AA 1LL8A 2PYPA 4KQDA 3T50A 3CI6A 1LSWA 1S1YA 3P01A 3OCLA 4GJ4A 2PR6A 5IU1A 5J4EA 3TE8A 4B93A 3RFBA 2QYBA 2VZWA 3H7WA 3LR4A 3KX0X 4EUVA 3A0VA 3OBFA 5G4YA 4FOFA 2VGLS 1D06A 2LB9A 5DFXA 4BBTA 5HDCA 5AVEA 1IFQA 1Y28A 3T4TA 2PYRA 2VA0A 3UB7A 3PBTA 4PKYA 3A0SA 4Q0HA 2M7VA 3JVVA 4G3WA 3EEAA 2W3GA 3PBQA 2VV7A 1G6OA 2DMWA 5IS1A 1NWZA 3PBOA 2H28A 2GNXA 3KSHA 1KOUA 5HWWA 3UB8A 2L4RA 2EWWA 5DF9A 3LIEA 2K31A 3KYQA 2O9BA 4L9GA 2O0YA 2OAP1 3B33A 1DP6A 3F1NB 2XA7M 4NKPA 3VOLA 4ARZB 2PR5A 2W3HA 3B47A 1S4RA 2W1TA 3D3OA 4MN6A 4HJ6A 2KLIA 1OT9A 2VKSA 3UE3A 5KIZA 5J3WA 5HWVA 4UEYA 2A24A 1D7EA 1ODVA 3PXPA 3UE6A 2JKRM 2P08A 3K3DA 3MMHA 1G28A 2CMNA 2KDKA 4QPRA 2PDRA 4PHTA 3LR3A 4OOLA 1T1CA 5EFWA 1YKDA 4KUOA 3E4PA 1W63M 2JKRI 1VHMA 3T4KA 3ICYA 4LRYC 3VE3A 1ZTUA 2FH5A 5HPIA 1OTEA 5HDSA 4HHDA 3F1PA 3H82A 2G7UA 2NUPC 4H6JA 3S7OA 5HPFA 1N9LA 2V0WA 3MR0A 1WA9A 3D72A 4PKYG 1NLYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LIF A;  1XJ6 A;  1OTB A;  2ZBB A;  4NXG A;  4M4X A;  4NXE A;  3UB6 A;  2QHK A;  2INW A;  1XJ2 A;  1OJ5 A;  3HJI A;  4I3J A;  2W0N A;  3NJA A;  4BBV A;  4EQ1 A;  1F9I A;  5HD3 A;  3MJQ A;  1GSW A;  2W27 A;  2PD7 A;  1S1Z A;  4LRX C;  3C2W A;  1OT6 A;  4YWZ A;  4I39 A;  4I3I A;  4JGO A;  3A0R A;  4XT2 B;  4B9O A;  1LT0 A;  3LID A;  3PYP A;  4WN5 A;  2V1B A;  4GS9 B;  1UGU A;  4I38 A;  4HJ4 A;  4EXO A;  5DJU A;  4HY8 A;  3IBR A;  4I3A A;  4HIA A;  1OTA A;  4R70 A;  3RH8 B;  4GW9 A;  2V1A A;  3UME A;  4LPZ A;  1T19 A;  3NOU C;  1V9Z A;  3UB9 A;  2QJ7 A;  3F1N A;  3EWK A;  2I9V A;  5TBM A;  3VE4 A;  2K7S A;  3NHQ A;  5TBM B;  2VEA A;  1UWP X;  4WF0 A;  1UWN X;  1OTI A;  4WLA A;  1S67 L;  4EES A;  3PHY A;  2D01 A;  4E04 A;  2P7J A;  4HQA A;  4L9F A;  1TS7 A;  4JGP A;  1V9Y A;  3UMD A;  3F1O A;  2VLG A;  3CWF A;  3HJK A;  3F1O B;  1OTD A;  1DRM A;  2YKF A;  4R6L A;  1EW0 A;  3CLO A;  4HOI A;  3H9W A;  4WUJ A;  3FC7 A;  5AVF A;  3LI9 A;  1F98 A;  1XJ3 A;  2VV6 A;  4EW7 A;  1BYW A;  3NOT C;  2L1M A;  4F3L B;  1P0Z A;  1DP8 A;  4MN5 A;  2OWH A;  4BBU A;  2WKR A;  2B02 A;  3LYX A;  3G6O A;  4EEU A;  2PHY A;  3BWL A;  4HP4 A;  4DJ2 A;  2VV8 A;  4LLO B;  3GEC A;  4R38 A;  3MQQ A;  4EET B;  1N9O A;  2JN7 A;  4WL9 A;  2L0W A;  5I5L A;  5G4Z A;  2OWJ A;  3LIB A;  2PD8 A;  1XFQ A;  5A8B A;  1OJG A;  2V0U A;  4RQ9 A;  4XT2 A;  1DP9 A;  5F6A A;  2D02 A;  2M1C A;  2HV1 A;  3IS2 B;  4JGR A;  2V9A A;  4GS9 A;  3EEH A;  2BAS A;  2YKH A;  5HZH A;  4HH3 A;  1T1B A;  1GSV A;  1S4S A;  1P97 A;  1JNU A;  3H7W B;  3LUQ A;  4HH2 A;  2R78 A;  3LI8 A;  2EA9 A;  1TS6 A;  2Z6D A;  2QWS A;  4GCZ A;  1XJ4 A;  5DJT A;  5F68 A;  1T18 A;  1MZU A;  3SW1 A;  1GSX A;  4GHI A;  4LRZ E;  2GJ3 A;  1TS8 A;  3LIC A;  4GHI B;  3OLO A;  5HDD A;  3BY9 A;  2KX6 A;  3C8C A;  4HP9 A;  1LSX A;  4NXF A;  3E4Q A;  4I5S A;  2ZOH A;  4K08 A;  3BY8 A;  2J80 A;  4HI4 A;  3MFX A;  5F5Y A;  5HD5 A;  2A24 B;  3E4O A;  1XFN A;  4L9E A;  5F69 A;  2JHE A;  4F3L A;  4DJ3 A;  5HWT A;  3K3C A;  2WKQ A;  3F1P B;  3H82 B;  2OOL A;  1LSV A;  1VB6 A;  4H6J B;  3ZQ5 A;  2WKP A;  2Z6C A;  4JGQ A;  2QJ5 A;  3LIA A;  3NOP C;  3GDI A;  3RTY A;  3CAX A;  5J7E A;  5DKL A;  5HSQ A;  3P7N A;  1S66 L;  4HJ3 A;  4HNB A;  1TS0 A;  4EER A;  3MQO A;  4EEP A;  1X0O A;  3MXQ A;  4NXB A;  1N9N A;  3IS2 A;  2ZOI A;  4KUK A;  5DKK A;  2QKP A;  3ULF A;  4R3A A;  3FG8 A;  1T1A A;  1LL8 A;  2PYP A;  4KQD A;  3T50 A;  1LSW A;  1S1Y A;  2PR6 A;  5IU1 A;  5J4E A;  3H7W A;  3KX0 X;  3A0V A;  5G4Y A;  1D06 A;  4BBT A;  5HDC A;  5AVE A;  1Y28 A;  2PYR A;  3UB7 A;  4PKY A;  3A0S A;  2VV7 A;  5IS1 A;  1NWZ A;  2H28 A;  1KOU A;  5HWW A;  3UB8 A;  2L4R A;  3LIE A;  4L9G A;  3B33 A;  1DP6 A;  3F1N B;  3VOL A;  2PR5 A;  1S4R A;  4MN6 A;  4HJ6 A;  1OT9 A;  5KIZ A;  5J3W A;  5HWV A;  2A24 A;  1D7E A;  1ODV A;  3UE6 A;  3K3D A;  1G28 A;  2CMN A;  2KDK A;  2PDR A;  5EFW A;  1T1C A;  4KUO A;  3E4P A;  3VE3 A;  3ICY A;  4LRY C;  1OTE A;  5HDS A;  4HHD A;  3F1P A;  3H82 A;  4H6J A;  1N9L A;  2V0W A;  3MR0 A;  1WA9 A;  3D72 A;  4PKY G; 
#chains in the Genus database with same CATH topology
 2W3E A;  5HL1 A;  3CPT B;  4NXG A;  3ISG A;  3HLG A;  3RJU A;  3BFC A;  2HF6 A;  4OP8 A;  5A93 A;  4FCF A;  3VP4 A;  3T4S A;  3MZF A;  3IX4 A;  4FTX A;  4Q0J A;  5A90 A;  2H0Y A;  4WEJ A;  3QP5 A;  4EQ1 A;  3CUE A;  5EM0 A;  2HZ5 A;  4KEN B;  2JE5 A;  4LRX C;  5EOO A;  5JYO A;  1K0K A;  3BRM A;  3C2W A;  3L7H A;  1OT6 A;  3N4I A;  2V2F F;  4I39 A;  3QNB A;  4UAA A;  4E3M A;  4B9O A;  1PZO A;  5E43 A;  3VV4 A;  4EWF A;  3PYP A;  4OOM A;  1NXY A;  2P9V B;  4KZA A;  4KZ8 A;  4WYY A;  2HP9 A;  3T4L A;  5EVI A;  4QWO A;  3KSG A;  2GX5 A;  5FDH A;  3FWL A;  5KSC A;  2E8J A;  4EXO A;  4Y2F A;  1LL5 A;  3MQ0 A;  4I3A A;  4HIA A;  4MCW A;  3OC2 A;  1OTA A;  4R70 A;  1IYO A;  2Q9M A;  1L0F A;  4IJG A;  4E3J A;  3W2Z A;  1WYB A;  3V67 A;  4O01 A;  3CJM A;  1ONH A;  1WYC A;  5E2H A;  1V9Z A;  3IWQ A;  5L2F A;  3DTE A;  1M6K A;  4KG5 A;  1ZC2 A;  3NHQ A;  3JYI A;  4PM6 A;  4KQQ A;  1VEU A;  2B5R A;  5EVI D;  1H3Q A;  4JKT A;  4E04 A;  4L9F A;  1TS7 A;  3LY4 A;  2WGV A;  3UMD A;  3VP2 A;  3ZG7 B;  1BSG A;  2HJ9 C;  1NYY A;  5CRF A;  4YOF A;  3WS0 A;  4R6L A;  3BW6 A;  4OP5 A;  2J3T D;  4RA7 A;  4WEL A;  3FC7 A;  2GDN A;  1F98 A;  4DXC A;  4OQH A;  4GD6 A;  5DTK A;  2VV6 A;  1GA9 A;  1BYW A;  2WKI A;  4FH2 A;  3N8R A;  3KYE A;  3E2K A;  1G68 A;  3AGD A;  2IWB A;  3LYX A;  3G2Y A;  3NEC A;  4HP4 A;  4DJ2 A;  1QMF A;  2VV8 A;  3EOI A;  1H5X A;  5GHX A;  1TF1 A;  2L0W A;  5G4Z A;  2OWJ A;  2Y79 A;  4DE3 A;  1KE4 A;  2PD8 A;  2V0U A;  4GN2 A;  4N1X A;  1K56 A;  4MDZ A;  4KG2 A;  4GZB A;  4ETZ A;  4PAU A;  3IS2 B;  1LI0 A;  2WGW B;  4MMN A;  4DN0 A;  3HL9 A;  2DRW A;  2V9A A;  3TSG A;  3EEH A;  1N4O A;  2VX8 A;  5HL6 A;  2XSS A;  5HZH A;  3HUN A;  1T1B A;  1H8Y A;  4BD1 A;  1CEG A;  4X56 A;  3LUQ A;  2HDR A;  4S2J A;  4RX3 A;  2R78 A;  1YSQ A;  3VMA A;  1TS6 A;  4KZ7 A;  3V3S A;  3GR2 A;  3OPP A;  4UA6 A;  4WZ5 A;  4XXR A;  1MZU A;  2ACG A;  5EV0 A;  5AQ9 A;  2W3D A;  3IH8 A;  3E0Y A;  4Z1W A;  1NRF A;  1K56 D;  4GHI A;  4LRZ E;  1TS8 A;  3ZHH A;  3LIC A;  4GHI B;  3OLO A;  1Z09 A;  2UWX A;  3S7N A;  4Y5F A;  1IYP A;  2EWV A;  4NXF A;  3N6I A;  2C6W B;  2WKH A;  1KGF A;  5LBR A;  1PWD A;  5IT5 A;  2EX6 A;  3PTE A;  1RGZ A;  2W1T B;  3G35 A;  5GLB A;  1GA0 A;  4JLF A;  4R1G A;  5EVL A;  1EWZ A;  1L0E A;  3KSI A;  1XPB A;  3BM6 A;  4GKU A;  5HFO A;  1FR1 A;  4F3L A;  1YPR A;  5HWT A;  3QP2 A;  5FEF A;  1KDS A;  1LSV A;  5EUA A;  1H0M A;  2WKP A;  3BLS A;  1ZG4 A;  5CHJ A;  2Z6C A;  4JGQ A;  4S2N C;  1MKI A;  3GDI A;  3EQU A;  5FSR A;  4KQR A;  3RTY A;  1CI9 A;  5DKL A;  4NET A;  4GNU A;  1S0W A;  4N9L A;  4BJP A;  4EEP A;  1MBL A;  1X0O A;  1FQG A;  4CLC C;  4NXB A;  5FQJ A;  4DXB A;  2Y2G A;  1N9N A;  4MBF A;  1W63 Q;  2ZC4 B;  2ZOI A;  1ERM A;  1NY0 A;  3MKF A;  4R23 A;  2H10 A;  5DKK A;  3FG8 A;  3SH8 A;  1E25 A;  4BLM A;  3C30 A;  2PYP A;  4ZAM A;  3ZNY A;  3OCL A;  2PR6 A;  3W8K A;  5J4E A;  3TE8 A;  4B93 A;  3BFG A;  3HLW A;  4HEF A;  2V8C A;  4N9K A;  4GDB A;  2LB9 A;  4PMA A;  1IFQ A;  1Y28 A;  3T4T A;  4PKY A;  4Q0H A;  2FFY A;  4IVI A;  4DE2 A;  4HES A;  4M3K A;  5M1A A;  1NWZ A;  4LV2 A;  2WAE A;  2C5W B;  3PAE A;  2IWC A;  3BFE A;  4LV1 A;  2OAP 1;  1OME A;  3F1N B;  1W7F A;  4NKP A;  4U0X A;  2VKS A;  3C5A A;  4WZ4 A;  3DWZ A;  3LGO A;  3A3J A;  1K55 C;  3PXP A;  3UE6 A;  2JKR M;  2JC7 A;  3MMH A;  2PDR A;  1PRQ A;  3DWK A;  3QNC A;  4WMC D;  3S1Y A;  4OOL A;  5CER A;  1YKD A;  1ES5 A;  2Q0O A;  1I2W A;  1VHM A;  4S2L A;  3VFF A;  1ZTU A;  1OTE A;  4HHD A;  5J8X A;  2G7U A;  1N9L A;  3MR0 A;  1ERO A;  2V20 A;  4AFI A;  3KO6 A;  1XJ6 A;  3G2Z A;  2A49 A;  5HX9 A;  1MWU A;  4NXE A;  3UB6 A;  2INW A;  5CEB A;  1ZHH B;  2ZQ8 A;  5KZH A;  1NRJ A;  3GSG A;  4BBV A;  3NIA A;  4X25 A;  4LEN A;  3FV7 A;  3CUE C;  1SDN A;  4E6W A;  4I3I A;  4XT2 B;  2XFS A;  3E98 A;  4ZTK A;  2NUT C;  5GHY A;  4WN5 A;  2V1B A;  4GS9 B;  1GHI A;  5L10 A;  5EVI C;  2W1R A;  3IF6 A;  4Y17 A;  4MEZ A;  1E3U A;  2QZ6 A;  4Y3I A;  1PW1 A;  2OAQ 1;  1YMX A;  3Q1F A;  4CPK A;  3UME A;  4UA7 A;  3T4Q A;  1T19 A;  3NOU C;  2XFT A;  4GLQ A;  2XGN A;  3ZNT A;  4ETX A;  1K6S A;  2M7U A;  4S2M A;  4C6Y A;  3VE4 A;  1ONG A;  3BEC A;  1QME A;  3MKE A;  1JTG A;  2VK3 A;  1UWP X;  2Y2N A;  4WF0 A;  3HVF A;  3GQZ A;  1XGI A;  1S67 L;  1GCE A;  4EES A;  4E3K A;  4HQA A;  4ZBE A;  2ZMF A;  3NBL A;  4U0T A;  3V5M A;  3HLD A;  3HUO A;  4XUX A;  3A3D A;  2JKF A;  4IED A;  3PBN A;  1EW0 A;  4HOI A;  2Y2K A;  3GRJ A;  3Q7V B;  2BTF P;  3CPT A;  3N8S A;  2B95 A;  3LFV A;  5AQ7 A;  1XX2 A;  3U4L P;  4G3V A;  1K6R A;  4MN5 A;  2WKR A;  2OSU A;  2LB5 A;  5AQA A;  3WWX A;  3BQA A;  1XGJ A;  2I72 A;  2IWD A;  5DF7 A;  1YQS A;  1TEM A;  4R38 A;  1N9O A;  2JN7 A;  4DE0 A;  4X53 A;  4P0M A;  2Z2L B;  1PW8 A;  5CXW A;  1XFQ A;  2EXB A;  5GLD A;  5A8B A;  3UDX A;  3RXW A;  5E2F A;  5F6A A;  3W4Q A;  3PBR A;  5L09 A;  3ZGA B;  3TJZ C;  2WGI A;  2P9V A;  2O9C A;  4PM8 A;  3SZT A;  1AXB A;  1MXO A;  1MKM A;  2BG1 A;  2EX2 A;  2YKH A;  2KOI A;  1IKI A;  5CHM A;  4HH3 A;  3VSL A;  4Q0I A;  2Y91 A;  1JNU A;  3BFD A;  4HH2 A;  3LI8 A;  3C7U A;  2EA9 A;  4QJG A;  5FAQ A;  3CIT A;  4EUZ A;  2G2W A;  4P6Z S;  5F68 A;  3Q07 A;  4OPR A;  4JXG A;  4WZ5 C;  1KGG A;  1L2S A;  4QD4 A;  3SW1 A;  2O9A A;  2BLS A;  1BTL A;  1W79 A;  4DRT A;  2GJ3 A;  2PU4 A;  3FPV A;  2OLV A;  1BLP A;  2IA2 A;  3BY9 A;  3T4O A;  2ZD8 A;  1YLZ A;  1E4D A;  2X02 A;  1M40 A;  4RYE A;  3E4Q A;  2Y2P A;  3MF0 A;  4I5S A;  4Y0T A;  4LGW A;  4K08 A;  3BY8 A;  3WS2 A;  2HDU A;  1KE0 A;  3HUM A;  5L8M A;  4CLC E;  2Y2J A;  2WKE A;  3SS5 A;  1SCW A;  5F5Y A;  4NEE D;  4OPZ A;  4R4S A;  4H8R A;  4ESP A;  4L9E A;  4IVK A;  4X6T A;  3UPO A;  2XQZ A;  5F69 A;  4OQI A;  2JHE A;  3WS1 A;  4FSF A;  4BEN A;  2MJ6 A;  3PAG A;  4KZB A;  1K4E A;  1YSP A;  2WKQ A;  3F1P B;  2OOL A;  4UA9 A;  2EFU A;  2Z2M B;  1VB6 A;  3ZQ5 A;  4CQH A;  3WRT A;  3ZDJ A;  3SS4 A;  4RVA A;  4Z9Q A;  1CK3 A;  2ZQ9 A;  2QJ5 A;  4E3I A;  5FL3 A;  5GHZ A;  2WAF A;  3CAX A;  3ZG9 B;  1K54 A;  1IOU A;  2ZQC A;  1S66 L;  1KDW A;  4HJ3 A;  4CJN A;  3MXS A;  3MQO A;  3JVU A;  3MXQ A;  4IHQ A;  2JKT M;  4O8G A;  3V39 A;  3IS2 A;  2WGW A;  1W8Q A;  4D2O A;  4XUZ A;  4KUK A;  4ME4 A;  2QKP A;  3TW8 A;  3ULF A;  5FA7 A;  5EOE A;  3HLC A;  1TVF A;  4R4R A;  1T1A A;  4OLG A;  3P98 A;  5IHV A;  3QP8 A;  1YLT A;  5FI7 A;  3RFB A;  2ZC6 B;  3O86 A;  3LR4 A;  3KX0 X;  3IWO A;  4BL3 A;  2AVX A;  3QP4 A;  2DCF A;  3MFD A;  3IHB A;  2DNS A;  1XA7 A;  1W8Y A;  3UB7 A;  3HBR A;  2W3G A;  3PBQ A;  2VV7 A;  3C4O A;  2WUQ A;  3IXH A;  4Y0U A;  2H28 A;  3IH9 A;  3UB8 A;  2ZQA A;  1DJB A;  5HAP A;  1PFL A;  3ITA A;  1GHM A;  1FIL A;  4L9G A;  3I7J A;  3B33 A;  4E3N A;  4S2P A;  5A91 A;  2XA7 M;  4ARZ B;  2PR5 A;  2W3H A;  3BFF A;  2W1T A;  2PBD P;  1CJF A;  5GL9 A;  2ZM0 A;  4HJ6 A;  2Y2L A;  2KLI A;  1OT9 A;  2PRF A;  3CG5 A;  2PBY A;  2XLN A;  3M2J A;  5J3W A;  2V1Z A;  3A3I A;  3QP6 A;  5FI2 A;  4UEY A;  3G32 A;  5TFQ A;  4KZ5 A;  1ODV A;  2EXA A;  2ZL1 B;  2P08 A;  1D1J A;  1BLH A;  2ZLY A;  1G28 A;  2HDS A;  2KDK A;  4QPR A;  3O87 A;  4ZJ2 A;  3OPH A;  4B88 A;  5A92 A;  4KZ9 A;  1DJA A;  4RX2 A;  2JKR I;  4OVD A;  5EVE A;  3S7O A;  5HPF A;  4DDY A;  3T12 B;  1ACF A;  3C7V A;  1WA9 A;  3D72 A;  4X1M A;  2Y2M A;  3FKW A;  1NLY A;  4R0Q A;  4MNR A;  2E8I A;  3LIF A;  4QU3 A;  2ZBB A;  1OTB A;  4M4X A;  4ZDX A;  3O88 A;  3FYZ A;  5MC7 A;  3DTK A;  5FAP A;  1FCN A;  1ERQ A;  4PM7 A;  4Y7P A;  3IBJ A;  3FPW A;  1XJ2 A;  1H8Z A;  1OJ5 A;  4P85 A;  4E3O A;  3UDI A;  4KG6 A;  1IKG A;  2QMI A;  3PR6 A;  2W0N A;  3A3E A;  4IBX A;  3A3F A;  1XA1 A;  1F9I A;  2RL3 A;  3MJQ A;  5CED A;  4EBL A;  1S1Z A;  5KSH A;  1YAX A;  3UE0 A;  1K57 A;  3OZH A;  4UQI M;  4Y15 A;  5M19 A;  3UDF A;  3A0R A;  3BLM A;  1FOF A;  1HTZ A;  3LCE A;  3R7W B;  2P04 A;  1SKO B;  1UGU A;  4I38 A;  1PWC A;  4HJ4 A;  5DFY A;  1SHV A;  4D60 A;  1XXM A;  3IF6 C;  2XRN A;  4WMC A;  4HY8 A;  3DTM A;  4KZ3 A;  1I5Q A;  1NYM A;  4KQO A;  1H8M A;  4GW9 A;  2V1A A;  1YLW A;  5DTT A;  4C3Q A;  2WK0 A;  3O5Y A;  3UB9 A;  2QJ7 A;  3F1N A;  4FUW A;  1RGY A;  3EWK A;  5FQQ A;  2K7S A;  3ZVW A;  2VEA A;  4WLA A;  3PHY A;  4JGP A;  1P9R A;  1V9Y A;  3TRC A;  3F1O A;  2VLG A;  2Y55 A;  3CWF A;  3HJK A;  1LL9 A;  3F1O B;  2JBF A;  4L0L A;  3VOY A;  1O07 A;  3HLB A;  5E2E A;  5CGS A;  4O0P A;  2YKF A;  3HLE A;  3KSF A;  4IBR A;  3LI9 A;  3AGF A;  2VGL M;  1XJ3 A;  4JF5 A;  3NOT C;  4MN7 A;  1P0Z A;  1PI4 A;  2XD1 A;  1S6R A;  1CEF A;  1Q2Q A;  2OWH A;  1TDG A;  4BBU A;  4EBP A;  3D9Y A;  3ZVT A;  3BWL A;  1PWG A;  4NK3 A;  3EGD C;  3GEC A;  2HDQ A;  1YM1 A;  4BQM A;  3M6B A;  3MQQ A;  4EET B;  5HAQ A;  4WL9 A;  1TDL A;  3Q82 A;  2PAV P;  1MPL A;  1BZA A;  2XA7 S;  5FAT A;  4QY6 A;  4CLC B;  4RQ9 A;  1STZ A;  5TJJ A;  3HRE A;  1YLP A;  3G34 A;  4XT2 A;  1DP9 A;  2CC1 A;  5HAI A;  5FDS A;  3UE1 A;  1KGE A;  2D02 A;  1DY6 A;  1ALQ A;  1HD8 A;  2M1C A;  2ZMA A;  2X01 A;  4JGR A;  4E6X A;  4II7 A;  4GS9 A;  1CI8 A;  2PT7 A;  2BAS A;  2ZC3 B;  2Y8H A;  4DF6 A;  3UB5 P;  1P97 A;  3H7W B;  1PNE A;  2VGK A;  2X71 A;  4R3J A;  3VP0 A;  2Z6D A;  3S22 A;  2QWS A;  3EQV A;  4N1H A;  1XJ4 A;  2J3T C;  5DJT A;  5M18 A;  1FCM A;  3ZYT A;  3BQ8 A;  1CQA A;  5C5K A;  4CLC D;  3BJN A;  5CGW A;  4BMW A;  2W3F A;  1MWT A;  1GSX A;  4OH0 A;  1LI9 A;  3C38 A;  5HDD A;  2PU2 A;  3IF5 A;  4ZJ3 A;  3NCK A;  4X1L A;  1NJ4 A;  5HAR A;  1RCJ A;  4F94 A;  2EX8 A;  3E2L A;  1K38 A;  3M6H A;  2J80 A;  4DE1 A;  4HI4 A;  1WE4 A;  4UQI S;  4HBU A;  4OQ0 A;  3W4O A;  1YLJ A;  5L07 A;  1Y4O A;  3MFX A;  1GHP A;  2HGV A;  2A24 B;  3Q7V A;  3E4O A;  5FQ9 A;  1XFN A;  2JKG A;  2ZMV A;  1RP5 A;  4Q8I A;  3GV9 A;  3SOI A;  1KVL A;  3IQA A;  1KVM A;  1F5M A;  3H82 B;  4H6J B;  3OPL A;  1IEM A;  2B18 A;  5U47 A;  5D3O A;  4PM9 A;  4YNR A;  2J8Y A;  1FCO A;  3NY4 A;  3QHY A;  4LCM A;  3T4J A;  4OPQ A;  5DTS A;  2A2L A;  5HSQ A;  3MZD A;  3V50 A;  4BL2 A;  4HNB A;  1TS0 A;  1K54 C;  2J9O A;  1G5U A;  5E2G A;  1XKZ A;  1IYS A;  2WAD A;  2JKT I;  3B3X A;  5TR7 A;  1L0D A;  3VFH A;  4R3A A;  5KMW A;  4KQD A;  4YFM A;  3T50 A;  3T1S A;  1LSW A;  3VSK A;  3P01 A;  5IU1 A;  3MS6 A;  2QYB A;  2VZW A;  4DKI A;  4S2K A;  3T1R A;  1C3B A;  4EUV A;  3A0V A;  4JXW A;  3OBF A;  2VGL S;  1D06 A;  5EVI B;  2Y59 A;  5GLA A;  5DFX A;  4BBT A;  5HDC A;  5AVE A;  3NC8 A;  4B4X A;  2PYR A;  2VA0 A;  5EPH A;  2WYX A;  2M7V A;  3JVV A;  4G3W A;  3EEA A;  4U3T A;  4BD0 A;  2ZM8 A;  4A5R A;  1SKF A;  1JWV A;  2DMW A;  4LV0 A;  3PBO A;  4MBK A;  2Y2O A;  3KSH A;  2GNX A;  5EE8 A;  2R9X A;  5DF9 A;  2Y4A A;  3KYQ A;  2ZQD A;  1HLU P;  2O0Y A;  1G6A A;  1IYQ A;  5F82 A;  5FQK A;  3VP3 A;  4S2I A;  1ESI A;  2A3U A;  4MN6 A;  3NUL A;  3Q7Z A;  3UE3 A;  1VEU B;  5HWV A;  5CEC A;  4N92 A;  3P09 A;  3K3D A;  3LR3 A;  5EFW A;  1T1C A;  3MBZ A;  4KUO A;  3O3V A;  3E4P A;  4FH4 A;  3VE3 A;  3ICY A;  2FH5 A;  5HPI A;  4E3L A;  1SDE A;  4YIN A;  3F1P A;  3TOI A;  4WBG A;  5FEG A;  2V0W A;  2HP6 A;  1EI5 A;  5EEC A;  3B42 A;  4PM5 A;  3VOZ A;  2QHK A;  2Y2Q A;  3HJI A;  5GLC A;  1PZP A;  4I3J A;  4IUK A;  3ITB A;  3WS4 A;  3UN7 A;  3NJA A;  2V8F A;  3K2N A;  1MC0 A;  4JXS A;  1CF0 A;  1NLZ A;  5HD3 A;  4FD8 A;  5AJG A;  1GSW A;  2W27 A;  2PD7 A;  3C4P A;  3QP1 A;  2JCH A;  2J7V A;  4ZRR A;  4OKP A;  2OLU A;  5F1F A;  4YWZ A;  4JGO A;  2EX9 A;  1K57 C;  1LT0 A;  3LY3 A;  3DW0 A;  3LEZ A;  3LID A;  4DMZ A;  1W5D A;  4BWI A;  1ES2 A;  5FAS A;  4JXV A;  2FZ0 A;  3SS3 A;  1Z6F A;  3HCY A;  5DJU A;  1LLB A;  3JPU A;  4OPY A;  1BT5 A;  3IBR A;  3GTC A;  2VGJ A;  2HJE A;  3NDG A;  3G31 A;  3UNW A;  3L9K A;  5FQI A;  4OQG A;  3WRZ A;  3RH8 B;  3IXD A;  3EGX C;  4HBT A;  4LPZ A;  1BLC A;  2HP5 A;  4JF4 A;  3WS5 A;  3CHW P;  4GB7 A;  5HW3 A;  4MLL A;  3LR5 A;  4ARZ A;  3OOV A;  2I9V A;  1BLS A;  5TBM A;  3MXR A;  2Y2H A;  2Y2I A;  2ZC7 A;  5TBM B;  1HVB A;  4GDN A;  1UWN X;  1OTI A;  4EQI A;  1PIO A;  2D01 A;  1NZU A;  2P7J A;  1A0K A;  2ZL1 A;  1FIK A;  3IXB A;  4B4Z A;  1U60 A;  1OTD A;  1DRM A;  2O99 A;  5FQM A;  1PYY A;  3CLO A;  4QB8 A;  3H9W A;  1K25 A;  3R4K A;  4WUJ A;  2R9W A;  1HZO A;  5AVF A;  1KE3 A;  2XK1 A;  3CMZ A;  4EW7 A;  4GD8 A;  2L1M A;  4F3L B;  3MSH A;  5BOH A;  1DP8 A;  4LCL A;  4KZ6 A;  2B02 A;  2G2U A;  2VJW A;  3G6O A;  2PHY A;  4EEU A;  3LEQ A;  2XF3 A;  2ZM2 A;  4Y13 A;  3HLF A;  4LLO B;  1XP4 A;  3D4F A;  3LO7 A;  2K2N A;  2ZQ7 A;  4X68 A;  4K0X A;  5I5L A;  3UPP A;  3BYD A;  3LIB A;  1J3W A;  2WZZ A;  1OJG A;  2ZJ9 A;  3R7W A;  3Q81 A;  1PI5 A;  2HV1 A;  2P74 A;  4NG2 A;  1NZO A;  1P9W A;  1SKO A;  1MY8 A;  2XR0 A;  3V3R A;  3IXG A;  1BUL A;  3S7P A;  5AQB A;  4LV3 A;  2H0T A;  4O7D A;  1GSV A;  1S4S A;  1L0G A;  2OV5 A;  4WEK A;  4GCZ A;  4EBN A;  4G3K A;  2WZX A;  4UHU A;  5DF8 A;  1T18 A;  2GZA A;  5CX7 A;  1TD5 A;  5G18 A;  1SZV A;  3T1Q B;  1VQQ A;  1AWI A;  1JVJ A;  1BUE A;  3KYZ A;  3BEB A;  2UV0 E;  2Q9N A;  4LFU A;  2KX6 A;  1O7E A;  5F83 A;  3C8C A;  3FKV A;  3PBS A;  4HP9 A;  1LSX A;  1FR6 A;  2RCX A;  4KZ4 A;  1JWZ A;  2HPB A;  3UY6 A;  3DBA A;  3IX3 A;  3FZC A;  2ZOH A;  2J3W A;  3NDE A;  4WM9 A;  4QY5 A;  3S7Q A;  2XRO A;  5K5B A;  4EU0 A;  3IT9 A;  3OCN A;  5DVA A;  4P6B A;  1F2K A;  5HD5 A;  1MWR A;  1L3L A;  4IUH A;  4K91 A;  3DTI A;  2XEP A;  3SH9 A;  4DJ3 A;  4ID4 A;  3K3C A;  3ZG0 A;  4X69 A;  3GMW A;  3VP1 A;  1J9M A;  1YMS A;  4S2N A;  3OPR A;  1IEL A;  1DJC A;  1OPX A;  4P6Z M;  4JF6 A;  4C75 A;  3LIA A;  3NOP C;  3UO9 A;  3LR0 A;  4X55 A;  3CZD A;  4MBH A;  5J7E A;  3G4P A;  1I2S A;  3N7W A;  3ZG8 B;  4CLC A;  3P7N A;  4EER A;  3U2A A;  5I94 A;  1LHY A;  3T1X A;  2J9P A;  3MZE A;  4OOY A;  4EV4 A;  2QPN A;  3ZG5 A;  5EM1 A;  5F1G A;  1LL8 A;  1FSW A;  1S1Y A;  3CI6 A;  1VM1 A;  4Y0O A;  4GJ4 A;  4JPM A;  3M2K A;  3H7W A;  1YT4 A;  5FAO A;  3G30 A;  3IWI A;  5CGX A;  5G4Y A;  4FOF A;  1VET A;  4R3B A;  1VET B;  1JTD A;  3DAV A;  1Y54 A;  4P87 A;  3UPN A;  1MWS A;  3IF6 B;  5CTN A;  3PBT A;  3A0S A;  1ES4 A;  5CTM A;  1ZKJ A;  5TGF A;  3AGE A;  1Q2P A;  1G6O A;  1ZG6 A;  3S4X A;  5IS1 A;  1KOU A;  5HWW A;  2L4R A;  2EWW A;  1ESU A;  3LIE A;  3W4P A;  2K31 A;  5CHU A;  2O9B A;  2H5S A;  3ZCZ A;  1DP6 A;  3VOL A;  1ES3 A;  3B47 A;  1S4R A;  3SH7 A;  1K4F A;  3D3O A;  4GOG A;  4PPR A;  1FSY A;  3ZFZ A;  4DDS A;  3RXX A;  5KIZ A;  4JBF A;  1YLY A;  2EFX A;  1K55 A;  2A24 A;  4OON A;  1D7E A;  3TG9 A;  2XH9 A;  4S2O A;  2CMN A;  2XDM A;  4PHT A;  4OLD A;  1E3U D;  5JYP A;  4QHC A;  1W63 M;  2ZC5 B;  4ZJ1 A;  3T4K A;  1N9B A;  3IX8 A;  4LRY C;  5FI6 A;  3N8L A;  5HDS A;  3H82 A;  2NUP C;  3NI9 A;  4H6J A;  3IHA A;  1JWP A;  3GVB A;  4K0W A;  2XD5 A;  4PKY G;  2FFF B; 
#chains in the Genus database with same CATH homology
 4AFI A;  3B42 A;  3LIF A;  2W3E A;  3KO6 A;  1XJ6 A;  1OTB A;  2ZBB A;  4NXG A;  4M4X A;  5MC7 A;  2HF6 A;  4NXE A;  3UB6 A;  2QHK A;  2INW A;  3IBJ A;  3FPW A;  3T4S A;  1XJ2 A;  1OJ5 A;  1ZHH B;  3HJI A;  1NRJ A;  4I3J A;  4IUK A;  3PR6 A;  2W0N A;  4Q0J A;  3NJA A;  3K2N A;  1MC0 A;  4WEJ A;  4BBV A;  4EQ1 A;  3CUE A;  1F9I A;  1NLZ A;  5HD3 A;  3MJQ A;  5AJG A;  3CUE C;  1GSW A;  2W27 A;  2PD7 A;  1S1Z A;  4LRX C;  5KSH A;  1YAX A;  4ZRR A;  3C2W A;  1OT6 A;  4YWZ A;  4UQI M;  4I39 A;  4I3I A;  4JGO A;  3A0R A;  4XT2 B;  4B9O A;  1LT0 A;  3E98 A;  3R7W B;  3VV4 A;  3LID A;  4DMZ A;  3PYP A;  4OOM A;  2P04 A;  4BWI A;  2NUT C;  3T4L A;  4WN5 A;  2V1B A;  3KSG A;  4GS9 B;  2GX5 A;  1UGU A;  2FZ0 A;  2W1R A;  3HCY A;  4I38 A;  4HJ4 A;  4EXO A;  5DFY A;  5DJU A;  4Y2F A;  2XRN A;  4HY8 A;  3IBR A;  3MQ0 A;  4I3A A;  2HJE A;  4HIA A;  4MCW A;  4Y3I A;  2OAQ 1;  3OC2 A;  4KQO A;  1OTA A;  4R70 A;  3RH8 B;  1H8M A;  4GW9 A;  2V1A A;  3EGX C;  4IJG A;  4LPZ A;  3UME A;  3W2Z A;  3T4Q A;  3V67 A;  1T19 A;  3NOU C;  4O01 A;  4GLQ A;  4ETX A;  2M7U A;  3O5Y A;  1V9Z A;  3LR5 A;  3UB9 A;  2QJ7 A;  3F1N A;  4ARZ A;  3OOV A;  3EWK A;  2I9V A;  5TBM A;  3VE4 A;  2K7S A;  3NHQ A;  5TBM B;  2VEA A;  1UWP X;  1UWN X;  4WF0 A;  1OTI A;  4WLA A;  1S67 L;  4EES A;  2D01 A;  3PHY A;  1H3Q A;  4E04 A;  2P7J A;  4HQA A;  4L9F A;  1TS7 A;  4JGP A;  1P9R A;  1V9Y A;  2ZMF A;  3UMD A;  3TRC A;  3F1O A;  2VLG A;  3CWF A;  3HJK A;  3F1O B;  2HJ9 C;  4L0L A;  1OTD A;  4YOF A;  1DRM A;  2O99 A;  4O0P A;  2YKF A;  3PBN A;  4R6L A;  3BW6 A;  1EW0 A;  3CLO A;  2J3T D;  4HOI A;  3H9W A;  4WEL A;  3KSF A;  3R4K A;  4WUJ A;  3FC7 A;  5AVF A;  3LI9 A;  2VGL M;  1F98 A;  3LFV A;  1XJ3 A;  2VV6 A;  4EW7 A;  1BYW A;  3NOT C;  2L1M A;  4G3V A;  4MN7 A;  4F3L B;  1P0Z A;  1DP8 A;  4MN5 A;  2OWH A;  4BBU A;  2WKR A;  2B02 A;  2LB5 A;  3LYX A;  2VJW A;  3G6O A;  2PHY A;  3BWL A;  4EEU A;  3BQA A;  4HP4 A;  4DJ2 A;  2VV8 A;  3EOI A;  4LLO B;  3EGD C;  3GEC A;  2K2N A;  4R38 A;  3MQQ A;  4EET B;  1TF1 A;  1N9O A;  2JN7 A;  4WL9 A;  2L0W A;  5I5L A;  5G4Z A;  2OWJ A;  2Y79 A;  2XA7 S;  3LIB A;  2PD8 A;  1XFQ A;  5A8B A;  1OJG A;  4CLC B;  2V0U A;  4RQ9 A;  1STZ A;  5TJJ A;  4XT2 A;  1DP9 A;  5F6A A;  2D02 A;  3PBR A;  4MDZ A;  2M1C A;  3R7W A;  2HV1 A;  4ETZ A;  4PAU A;  3TJZ C;  3IS2 B;  4JGR A;  4II7 A;  4MMN A;  2O9C A;  1P9W A;  4DN0 A;  2V9A A;  4GS9 A;  2PT7 A;  3EEH A;  2BAS A;  2VX8 A;  1MKM A;  5HL6 A;  2YKH A;  2KOI A;  2XSS A;  3S7P A;  5HZH A;  2Y8H A;  4HH3 A;  1T1B A;  1GSV A;  1S4S A;  4Q0I A;  1P97 A;  1JNU A;  3H7W B;  3LUQ A;  4HH2 A;  2R78 A;  3LI8 A;  2EA9 A;  1YSQ A;  3CIT A;  1TS6 A;  2Z6D A;  2QWS A;  3EQV A;  4WEK A;  4GCZ A;  4G3K A;  1XJ4 A;  2J3T C;  5DJT A;  4P6Z S;  5F68 A;  1T18 A;  3ZYT A;  3BQ8 A;  2GZA A;  1MZU A;  5CX7 A;  5C5K A;  3BJN A;  4CLC D;  1TD5 A;  2W3D A;  4BMW A;  3SW1 A;  2W3F A;  2O9A A;  3E0Y A;  4Z1W A;  1GSX A;  4GHI A;  4LRZ E;  2GJ3 A;  1TS8 A;  3KYZ A;  3LIC A;  3OLO A;  3FPV A;  4GHI B;  3C38 A;  5HDD A;  2IA2 A;  3BY9 A;  3T4O A;  2KX6 A;  3S7N A;  3C8C A;  3PBS A;  4Y5F A;  4HP9 A;  1LSX A;  2EWV A;  4NXF A;  3E4Q A;  3DBA A;  3MF0 A;  4I5S A;  5LBR A;  2ZOH A;  2J3W A;  5IT5 A;  4K08 A;  3BY8 A;  2J80 A;  2W1T B;  4HI4 A;  3S7Q A;  5L8M A;  4UQI S;  2XRO A;  5K5B A;  4CLC E;  4EU0 A;  3MFX A;  3OCN A;  5F5Y A;  4NEE D;  2HGV A;  5HD5 A;  2A24 B;  3KSI A;  3E4O A;  1XFN A;  4L9E A;  4IUH A;  2ZMV A;  5F69 A;  2JHE A;  4F3L A;  4FSF A;  2MJ6 A;  4DJ3 A;  5HWT A;  3K3C A;  1F5M A;  1YSP A;  2WKQ A;  3F1P B;  3H82 B;  2OOL A;  1LSV A;  1VB6 A;  4H6J B;  3ZQ5 A;  4CQH A;  2B18 A;  2WKP A;  1OPX A;  2Z6C A;  4JGQ A;  4P6Z M;  2QJ5 A;  3LIA A;  3NOP C;  4YNR A;  3GDI A;  3LR0 A;  3EQU A;  5FL3 A;  3RTY A;  3T4J A;  1IOU A;  3CAX A;  5J7E A;  5DKL A;  2A2L A;  5HSQ A;  4CLC A;  3P7N A;  1S66 L;  4HJ3 A;  4HNB A;  1TS0 A;  4EER A;  3MQO A;  3JVU A;  4BJP A;  4EEP A;  1X0O A;  4CLC C;  3MXQ A;  3U2A A;  4IHQ A;  4NXB A;  2JKT M;  4O8G A;  1N9N A;  3IS2 A;  1W63 Q;  2ZOI A;  2JKT I;  4KUK A;  5DKK A;  4ME4 A;  2QKP A;  3TW8 A;  3ULF A;  4R3A A;  3FG8 A;  3C30 A;  1T1A A;  1LL8 A;  2PYP A;  4KQD A;  3T50 A;  3CI6 A;  1LSW A;  1S1Y A;  3P01 A;  3OCL A;  4GJ4 A;  2PR6 A;  5IU1 A;  5J4E A;  3TE8 A;  4B93 A;  3RFB A;  2QYB A;  2VZW A;  3H7W A;  3LR4 A;  3KX0 X;  4EUV A;  3A0V A;  3OBF A;  5G4Y A;  4FOF A;  2VGL S;  1D06 A;  2LB9 A;  5DFX A;  4BBT A;  5HDC A;  5AVE A;  1IFQ A;  1Y28 A;  3T4T A;  2PYR A;  2VA0 A;  3UB7 A;  3PBT A;  4PKY A;  3A0S A;  4Q0H A;  2M7V A;  3JVV A;  4G3W A;  3EEA A;  2W3G A;  3PBQ A;  2VV7 A;  1G6O A;  2DMW A;  5IS1 A;  1NWZ A;  3PBO A;  2H28 A;  2GNX A;  3KSH A;  1KOU A;  5HWW A;  3UB8 A;  2L4R A;  2EWW A;  5DF9 A;  3LIE A;  2K31 A;  3KYQ A;  2O9B A;  4L9G A;  2O0Y A;  2OAP 1;  3B33 A;  1DP6 A;  3F1N B;  2XA7 M;  4NKP A;  3VOL A;  4ARZ B;  2PR5 A;  2W3H A;  3B47 A;  1S4R A;  2W1T A;  3D3O A;  4MN6 A;  4HJ6 A;  2KLI A;  1OT9 A;  2VKS A;  3UE3 A;  5KIZ A;  5J3W A;  5HWV A;  4UEY A;  2A24 A;  1D7E A;  1ODV A;  3PXP A;  3UE6 A;  2JKR M;  2P08 A;  3K3D A;  3MMH A;  1G28 A;  2CMN A;  2KDK A;  4QPR A;  2PDR A;  4PHT A;  3LR3 A;  4OOL A;  1T1C A;  5EFW A;  1YKD A;  4KUO A;  3E4P A;  1W63 M;  2JKR I;  1VHM A;  3T4K A;  3ICY A;  4LRY C;  3VE3 A;  1ZTU A;  2FH5 A;  5HPI A;  1OTE A;  5HDS A;  4HHD A;  3F1P A;  3H82 A;  2G7U A;  2NUP C;  4H6J A;  3S7O A;  5HPF A;  1N9L A;  2V0W A;  3MR0 A;  1WA9 A;  3D72 A;  4PKY G;  1NLY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...