3DAVA

Schizosaccharomyces pombe profilin crystallized from sodium formate
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
126
structure length
126
Chain Sequence
SWQAYVDTSLLGTGKIDRAAIVSRAGDSVWAASAGFNLSPQEIQGLAAGFQDPPSMFGTGIILAGQKYITIRAEGRSIYGKLQKEGIICVATKLCILVSHYPETTLPGEAAKITEALADYLVGVGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Profilin
publication title Incompatibility with Formin Cdc12p Prevents Human Profilin from Substituting for Fission Yeast Profilin: INSIGHTS FROM CRYSTAL STRUCTURES OF FISSION YEAST PROFILIN.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Protein binding
total genus 36
structure length 126
sequence length 126
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00235 Profilin Profilin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 3davA00
1PFLA 3CPTB 1G5UA 3LGOA 1VETA 1SKOA 2B95A 3CPTA 3T1QB 2V8CA 3T12B 3KYEA 3NULA 1A0KA 1J3WA 1VEUB 1SKOB 2JKFA 2PAVP 2ACGA 5EM0A 3MSHA 1VEUA 3NECA 3T1SA 5FEFA 5EM1A 5EVEA 1PRQA 1CF0A 4X25A 2E8JA 1FIKA 4X1LA 2PBDP 2JKGA 1CJFA 2BTFP 3UB5P 1ACFA 3L9KA 1CQAA 3MS6A 1HLUP 1K0KA 1D1JA 5FEGA 3T1XA 4D60A 1AWIA 1FILA 5EV0A 2VK3A 4X1MA 2ZL1A 2PRFA 1YPRA 3LEQA 3D9YA 1Z09A 3U4LP 3CHWP 3DAVA 4FUWA 2HZ5A 1Y4OA 2V8FA 4QWOA 3T1RA 4ESPA 2ZL1B 1SZVA 4FTXA 3L7HA 1VETB 1F2KA 1PNEA 5FDSA
chains in the Genus database with same CATH superfamily
4CQHA 4YFMA 1ZC2A 3PBRA 5I5LA 1YT4A 3C7VA 1BLCA 4U3TA 3RTYA 2H10A 3N6IA 1S6RA 4S2OA 3ZFZA 1NYYA 1JVJA 4ZJ2A 2HP9A 4GCZA 4H6JA 5AJGA 4ETZA 2A49A 1K57C 5CXWA 1LL5A 3MXQA 5E2HA 4S2IA 3JPUA 2PR5A 4X69A 5DKLA 3LIAA 1JWZA 3IF6C 3RXWA 4DE0A 3IWOA 2M1CA 1OT9A 2A2LA 5K5BA 2ZQCA 1D1JA 4OOLA 3IH8A 2PHYA 3MMHA 4H8RA 4HNBA 2NUPC 2V20A 2J3WA 1RGZA 4GHIB 4KQOA 1KDWA 3C8CA 4LLOB 3F1OB 3NI9A 4BBTA 1PW8A 2WGVA 2DMWA 3UDFA 5A92A 1P9RA 1LSVA 3SOIA 4AFIA 1OT6A 3HLWA 3DTMA 4EBLA 5CX7A 2A24B 3PR6A 3IH9A 3ZQ5A 2J9PA 2V1ZA 5FI7A 4KZ4A 5CGXA 4KG5A 2ZC7A 2ZC3B 2B95A 5HWVA 4GJ4A 3T4JA 3H82A 4XUXA 1SDNA 4X6TA 3WRTA 4MLLA 3EWKA 1YMXA 3HLCA 2PU4A 4Z1WA 3RH8B 1QMEA 5F1FA 2ZQ9A 5DF8A 4OVDA 4ID4A 3M2KA 1L3LA 1CEFA 1FOFA 2VLGA 3MBZA 4BJPA 1OTEA 4WMCD 4K0XA 3NOPC 2EA9A 3MF0A 1FR6A 5A8BA 5EVIB 1OTIA 4LRXC 3CZDA 3KYZA 4E3NA 4Q0HA 3CUEA 5FI2A 2PBYA 3G34A 4DDSA 2JKRI 3UE6A 4EERA 5HZHA 2Z2MB 3HBRA 3GV9A 3R7WB 1XGIA 1LHYA 5CHUA 1FILA 3LR0A 1XJ2A 2VK3A 2ZC6B 3HLEA 3UDIA 4OQIA 3KSGA 3KYQA 4YOFA 3MZEA 1RP5A 3FC7A 4JBFA 1KE4A 3G35A 1EI5A 4MMNA 4R3JA 5CHJA 3QP2A 3VE3A 4C75A 2IA2A 3BQAA 3BY9A 2Z6CA 1V9YA 4QD4A 4EQIA 1ONGA 4FTXA 2L1MA 1E4DA 2M7VA 1IOUA 3JVUA 4Q0IA 1XJ4A 4BD0A 4HJ4A 2Z2LB 3LEZA 4RA7A 2A3UA 1SKOA 4HBTA 4X55A 2W3GA 1JWVA 3T1QB 5CTMA 1OTAA 5DJTA 3S1YA 4OOMA 1VEUB 1FSYA 4ZTKA 2HDQA 4S2NC 1MWTA 1FCOA 1VQQA 2ACGA 2EX9A 3NECA 5M19A 1BUEA 2JC7A 4E6XA 2WAFA 4K0WA 3LYXA 1MKMA 2HDRA 3W4QA 5HX9A 4DXBA 3KSHA 3CJMA 1N9LA 1HVBA 1CJFA 1KGEA 5TR7A 3R4KA 2WYXA 3B33A 1Y54A 3OCNA 3HLFA 3UN7A 4HQAA 4EETB 2WKIA 2OV5A 4WZ5C 4E6WA 3NDEA 2FH5A 2VJWA 3GVBA 3VE4A 3F1NB 4JXSA 5DFXA 5EFWA 1S1ZA 1ESUA 5CEDA 3OC2A 2EWWA 3F1PA 4DN0A 3UB7A 4C6YA 5L09A 3U4LP 3PBSA 3JYIA 2WUQA 3Q7VA 5EVIC 4R3BA 5I94A 3ZG5A 4MN5A 4KQRA 2ZL1B 2H28A 3G32A 4HBUA 4XT2B 4IUKA 4OQHA 1K55C 2ZMAA 1YAXA 1PFLA 3E0YA 2P7JA 3UB6A 2JKTI 1XA1A 3LIDA 3UE1A 4X68A 2PD8A 4E3OA 1CEGA 2XR0A 4JXWA 3DWKA 4O7DA 1TD5A 5FQKA 4E04A 3HUOA 1GHPA 3K3CA 2Y55A 4LV3A 5FDHA 3MKFA 4GLQA 2E8IA 4PM8A 3V39A 2Y59A 1S4RA 4MCWA 5L2FA 3HUNA 2FZ0A 1KVMA 5F5YA 3T1SA 4RX2A 2XFSA 1EROA 1L2SA 3TJZC 2L4RA 1CF0A 4NXGA 1FIKA 1G6AA 3OZHA 4E3KA 4UHUA 4X53A 2ZJ9A 3T4LA 4Q8IA 3L9KA 2VZWA 2Q9NA 1L0FA 2XA7S 4Y3IA 1P0ZA 4R6LA 4JKTA 3FPWA 1LL8A 3S7OA 1OPXA 1E25A 4D60A 3SS3A 3VP1A 5DFYA 1X0OA 3EOIA 4PMAA 1UGUA 1Z09A 4WLAA 5F69A 5BOHA 2O9AA 4HHDA 3JVVA 1XKZA 3ZVTA 3W2ZA 2HP6A 2JHEA 4ZJ1A 1S66L 2W1RA 3ISGA 4QWOA 4XXRA 3EGDC 3D72A 5TBMA 2EX2A 1YLYA 1T1AA 3DTKA 4Y7PA 1SKFA 4S2KA 1IYSA 2EXBA 2HDUA 5FAPA 2OSUA 1F2KA 3WWXA 3LFVA 5GLCA 1KGFA 3NDGA 2D01A 4L0LA 4WZ4A 1XFQA 3NCKA 4B4ZA 4EEPA 3PBTA 4N1XA 1S4SA 3IBJA 1KVLA 1A0KA 3FG8A 4NKPA 4R23A 3OPPA 3TSGA 1V9ZA 5EM0A 2ZM0A 4DXCA 3MXRA 3DWZA 3MFXA 1PWCA 4DRTA 3IF6B 1XX2A 2HDSA 4X25A 2W1TB 1BULA 4L9FA 4EESA 2C6WB 3G2ZA 4E3IA 3D4FA 3V3RA 5D3OA 5HDSA 3OLOA 4I3IA 1ERMA 1PZPA 5EECA 4BMWA 5KZHA 1MXOA 2QKPA 4D2OA 4CLCE 1JWPA 1PWDA 4PPRA 1VM1A 2XK1A 2WADA 2HF6A 4ARZA 4OONA 4CPKA 4JF5A 4EU0A 3KSIA 1P9WA 4OQ0A 2EFUA 3QP6A 4MEZA 4ESPA 3ZG8B 2PYPA 4Q0JA 1D7EA 1NRFA 4UAAA 4WYYA 1N9NA 4IBXA 5FI6A 4GDBA 4EXOA 4YINA 3NBLA 1HZOA 3MJQA 3LGOA 4YWZA 5JYPA 4WMCA 2JE5A 4JLFA 5JYOA 4KUOA 1Q2QA 3V5MA 2UV0E 1FCMA 1GCEA 4ZJ3A 1F9IA 1TF1A 2O0YA 5HSQA 3LCEA 3VP4A 4FD8A 1TS0A 2P08A 3MSHA 2B18A 2ZM2A 5FQJA 3BQ8A 4U0XA 3CG5A 3DTIA 4KG6A 4CLCD 3O87A 1LSWA 2LB5A 3N8LA 1WE4A 2O9BA 3UB8A 3ZNTA 1KE0A 1NXYA 3QP1A 3SZTA 1LLBA 4OPRA 5AVFA 1PIOA 4UA7A 1K0KA 5EVLA 2QWSA 4PM6A 1TS6A 3EQUA 1YSPA 3D3OA 4DE3A 3IQAA 1GSWA 4Y5FA 4B9OA 3LY3A 2CC1A 4OPZA 3HLBA 3S7PA 2J3TD 2J80A 1H5XA 5EE8A 5KMWA 3A0VA 4LPZA 3CUEC 1IFQA 3PBNA 1TDGA 4ZAMA 3A3DA 1W79A 3BLMA 1UWNX 4PHTA 3MXSA 3IS2A 2QYBA 2VKSA 4K91A 2QHKA 2QJ5A 5FDSA 4PM5A 1GHIA 5DF9A 5DJUA 3LR3A 5G18A 1CI8A 3OOVA 4DJ3A 4OLGA 4P87A 3SS5A 5F82A 2BASA 3ZNYA 3HVFA 3WS5A 4BBVA 4HP9A 3A3IA 4DJ2A 3MZDA 4IHQA 5AQ9A 3BYDA 5L8MA 3HLDA 4BQMA 3GTCA 4LV0A 3DW0A 4HH3A 3NIAA 2R9WA 5DTKA 4FOFA 1BTLA 2VA0A 4KZ8A 5CHMA 2J9OA 1ZG6A 3OCLA 2ZMFA 1ACFA 3M6BA 3ZGAB 3GSGA 3LIFA 4MBKA 3P01A 1MWUA 2GJ3A 5FEGA 3T1XA 4RVAA 3NC8A 1N9OA 1TS8A 1AWIA 1YQSA 4WL9A 2WKQA 5GLDA 5FL3A 4GZBA 3M2JA 1DP9A 2XLNA 3M6HA 2NUTC 4P85A 4NG2A 4F3LA 5TGFA 1KGGA 1MC0A 1XPBA 4QB8A 3WS2A 3IHAA 4FH2A 1ES4A 3OPLA 2XQZA 3WS4A 4BENA 2ZQ8A 1H0MA 4QHCA 4HH2A 3ITBA 4WEJA 5M18A 4E3LA 4PKYG 1YSQA 3GQZA 2I72A 3AGDA 3W4PA 3PHYA 5GLBA 3CPTA 3IXHA 1CI9A 3S4XA 2YKHA 2JCHA 3NY4A 3VSKA 3VP2A 3Q07A 4R70A 3P09A 3AGFA 1W63M 2JKFA 1LI0A 3A0SA 5C5KA 1P97A 3CAXA 5DVAA 4DE2A 1L0EA 2Q9MA 2V1AA 3IXDA 1L0GA 1YLWA 2V1BA 4X1LA 3TG9A 2JN7A 1ES2A 2P9VA 4B93A 1ZHHB 2XH9A 2PR6A 3LR5A 4P6ZM 4NXFA 3VOZA 4IUHA 4UQIM 1DJCA 4HOIA 4WF0A 1KE3A 4HI4A 2PU2A 2PRFA 1G68A 1L0DA 3D9YA 3V67A 1U60A 5AQBA 3ZG9B 1PW1A 3T4TA 2J8YA 2FFFB 4IVKA 3ZCZA 5F6AA 1GSVA 5L07A 3WS1A 4DKIA 2ZOHA 5CRFA 4CJNA 4JXGA 3EGXC 3C5AA 1K54A 4MBFA 3W4OA 1K4EA 2HV1A 4MN6A 3IX3A 4N1HA 2V0WA 5GL9A 1RCJA 2VGLS 1YLPA 2VX8A 3LUQA 3C38A 2QJ7A 3FV7A 5FEFA 1YMSA 5EVEA 2D02A 1EW0A 1XXMA 4JGRA 5DKKA 1K56D 3PAEA 4ZBEA 4H6JB 3BM6A 3PXPA 2VEAA 3PAGA 2J3TC 4Y17A 4C3QA 1CQAA 1UWPX 2K31A 3CI6A 1EWZA 5HPFA 1XJ3A 5CGWA 4KUKA 3DBAA 1NZUA 3MQ0A 3VMAA 1SHVA 4Y2FA 2WGWA 3BRMA 4O0PA 2WZZA 3LEQA 2VGJA 1I2SA 3VSLA 1YLZA 3GDIA 3GRJA 2A24A 3BLSA 3WS0A 4KZ5A 5FAOA 2W3DA 4OPYA 1GA9A 3UE0A 4KZAA 3S7NA 1NLZA 4OQGA 1KDSA 5L10A 1I2WA 3VFHA 1VETA 4DE1A 4CLCA 3HLGA 2BG1A 3SS4A 3O3VA 1GHMA 3HREA 2XRNA 3T12B 4HEFA 3TOIA 3LR4A 3G30A 4EBPA 4QJGA 3G6OA 4NEED 3MFDA 4BBUA 4KZBA 2Q0OA 4GKUA 2X01A 3IF5A 4IBRA 3BW6A 3H82B 3BFCA 1F98A 1G28A 5HL1A 2Y79A 5G4YA 1YLJA 2PBDP 3QP5A 3R7WA 4OH0A 2P74A 4GN2A 3ZVWA 2XROA 2GX5A 4MNRA 2Y2GA 5U47A 3K2NA 4S2JA 1DJBA 2W0NA 2RL3A 2CMNA 1K25A 5TJJA 5FASA 1BT5A 3B3XA 4U0TA 2WGIA 2M7UA 5HAPA 4F3LB 4B88A 5HDDA 4FSFA 3PTEA 1FQGA 1IKGA 4GS9A 4R0QA 4S2LA 3BY8A 1OJ5A 4OKPA 5CERA 2HP5A 3BFEA 2WAEA 1YKDA 3ZG0A 3QP8A 2J7VA 4R1GA 4PM7A 4Y15A 1M6KA 3T50A 2R9XA 5CECA 1BZAA 1JNUA 3E4PA 5HAQA 2GDNA 2K7SA 1PNEA 5F83A 3P7NA 2L0WA 3CPTB 3OPRA 4DF6A 3E98A 4O01A 2HJEA 2G7UA 5GHZA 3G2YA 4I3AA 2DNSA 4RQ9A 4P6BA 3S22A 3NULA 5LBRA 4X56A 2GZAA 4G3KA 5J4EA 5IT5A 3B42A 3ICYA 1MZUA 1J9MA 4UA6A 4EUZA 2VV8A 1XA7A 1SKOB 2PAVP 4JPMA 1LT0A 3C2WA 1PI4A 3QNBA 4KZ3A 1PRQA 4HJ6A 4LRYC 4HY8A 1NZOA 2P9VB 3UPOA 2E8JA 3NHQA 5FQMA 1M40A 2OWHA 5HFOA 2OAQ1 4PM9A 4KENB 2BTFP 3VFFA 2JKRM 3T4OA 4KG2A 5DF7A 2ZLYA 1WA9A 3QNCA 1HD8A 1ALQA 2LB9A 1O07A 3IWQA 4PKYA 4K08A 1DRMA 3O5YA 5DTTA 1TDLA 3RXXA 3A3FA 2ZL1A 2OLVA 4GNUA 1MWRA 4UA9A 4XT2A 1IELA 2JBFA 4F94A 1WYCA 3H7WA 5HD3A 2ZQAA 2HJ9C 5EVID 5A91A 4JF4A 5CEBA 3VOYA 2Z6DA 4LFUA 4Z9QA 3ZG7B 5FSRA 3F1PB 4JXVA 3UPNA 2EWVA 2Y2HA 4QY5A 3HJKA 3Q7VB 3EQVA 5J8XA 5E2GA 3UNWA 2INWA 4LV2A 4HJ3A 3GECA 3TE8A 2X71A 2V0UA 2G2WA 3UB9A 2VGKA 3BEBA 1JTGA 4EBNA 4ZDXA 5GLAA 1KOUA 4WUJA 4IEDA 4BLMA 3MKEA 4WM9A 1N4OA 5KIZA 1IYOA 3KX0X 2Y2OA 4PAUA 2Y2JA 2XD1A 2V2FF 2ZQ7A 3OBFA 1VHMA 4EWFA 4ETXA 3SH9A 2OOLA 1PZOA 4KQQA 5FQIA 2HGVA 3NOTC 2WGWB 3MR0A 4OPQA 3UO9A 1Q2PA 4BL3A 1FSWA 5EPHA 1W5DA 5E2FA 4QPRA 1H8YA 4X1MA 3UPPA 4GW9A 1NWZA 5CTNA 3IX4A 2EX6A 1STZA 1CK3A 3CHWP 3AGEA 3E2LA 3NJAA 4KQDA 4FUWA 1XP4A 2XEPA 3Q7ZA 3IXGA 3HJIA 1Y4OA 5FAQA 1S1YA 2KDKA 5HPIA 1GSXA 4ME4A 2Y4AA 4MBHA 1ZTUA 2UWXA 3PBOA 2Y91A 2JKTM 4WELA 2XSSA 1VETB 2Y2KA 4CLCB 1H3QA 4KZ9A 1K57A 5TBMB 3FZCA 4GOGA 3V50A 3GMWA 1K56A 1YLTA 4LENA 2EXAA 1TEMA 3IF6A 4EQ1A 2PYRA 4P6ZS 2W1TA 1IKIA 1ERQA 4NXBA 4UQIS 3PYPA 5DTSA 1BSGA 2HPBA 4OP5A 4GD6A 3IT9A 4EUVA 3VP3A 4HIAA 3SW1A 1LSXA 3WRZA 1K54C 4NK3A 3IWIA 3TRCA 5IS1A 2O9CA 4G3WA 5IHVA 4Y0TA 5KSHA 3UB5P 4R4SA 1IYPA 5EUAA 3LI8A 3KSFA 4Y0OA 1VB6A 1PI5A 3ITAA 5FATA 3FYZA 4JF6A 1T19A 1FCNA 1Z6FA 2WKEA 4IVIA 1XGJA 5EV0A 4GS9B 5HAIA 3Q1FA 4YNRA 2H0TA 1K6SA 4OOYA 1T18A 3RJUA 1ESIA 3ZHHA 3A3JA 3GR2A 3IBRA 4ARZB 1Y28A 2DRWA 5GHYA 3Q81A 4MDZA 5HW3A 2WKRA 3ZDJA 2EFXA 1LL9A 1MPLA 2GNXA 4R4RA 3HUMA 1W63Q 3C4OA 4WBGA 1ES5A 2XD5A 2Y2NA 4M4XA 4EW7A 1DP6A 2Y2LA 3TW8A 3MQOA 4KZ7A 5HARA 2RCXA 3V3SA 2XFTA 4I38A 1ES3A 2WK0A 3HCYA 5A93A 1J3WA 2MJ6A 4FH4A 1ONHA 3UY6A 2XF3A 3SH8A 2WZXA 1BLSA 4S2PA 2VV6A 3BWLA 3KO6A 2K2NA 3C7UA 4N92A 1K6RA 1G6OA 2Y2QA 4BL2A 4CLCC 4II7A 2ZBBA 4OLDA 2VV7A 3B47A 3BFGA 4JGPA 2JKGA 1WYBA 2KOIA 3N8RA 3NOUC 4OP8A 1NYMA 1HTZA 3BECA 3E4OA 3MS6A 3BJNA 3T4SA 5E43A 4L9GA 2OWJA 3E4QA 4EEUA 2DCFA 4EV4A 1MBLA 1ODVA 1XJ6A 4WN5A 4R3AA 3H7WB 2Y8HA 3LIEA 5HDCA 2Y2PA 2P04A 1YPRA 2ZMVA 5A90A 4R38A 3IHBA 1E3UA 3LO7A 3QP4A 2PD7A 2G2UA 5AQ7A 4JGQA 1I5QA 2B5RA 1S0WA 2HZ5A 1MKIA 4GHIA 2V8FA 1XFNA 3UDXA 1PYYA 1W7FA 3BFFA 4N9KA 3F1OA 1SZVA 3CWFA 2KX6A 3L7HA 3N4IA 2EX8A 4S2NA 4QU3A 4I3JA 4B4XA 4DMZA 4UEYA 4P0MA 2R78A 4L9EA 4JGOA 4GD8A 3MZFA 4WEKA 3IS2B 5AQAA 4Y0UA 2H0YA 5FA7A 1H8MA 4G3VA 3ZYTA 3QHYA 2Y2MA 3Q82A 5HL6A 3A3EA 4DDYA 3K3DA 4IJGA 2B02A 5FQQA 1OTDA 1D06A 2ZM8A 4WZ5A 5F68A 4BD1A 3ULFA 2VGLM 1DJAA 1OMEA 5G4ZA 3LIBA 3RFBA 2IWCA 3G31A 5TFQA 2OLUA 4GB7A 5KSCA 1W8QA 2IWDA 1N9BA 2OAP1 4RX3A 1F5MA 3IXBA 2PDRA 4I5SA 1SCWA 1SDEA 4ZRRA 2X02A 3W8KA 5EVIA 3CMZA 1O7EA 2BLSA 3UE3A 4GDNA 2C5WB 3VP0A 3P98A 1QMFA 1K55A 2FFYA 4Y13A 1GA0A 2W3EA 1BLPA 2AVXA 3BFDA 3FPVA 3SH7A 4LRZE 2XA7M 1BLHA 2XGNA 4LCLA 2YKFA 3T1RA 5HWWA 1W8YA 5F1GA 1NRJA 3T4QA 3CLOA 3LI9A 3C30A 2QPNA 1YM1A 1NJ4A 3S7QA 3C4PA 4N9LA 1AXBA 4LCMA 3FWLA 2Y2IA 1G5UA 4KZ6A 1OJGA 2ZD8A 1T1BA 5GHXA 2W3HA 1DY6A 4XUZA 1ZKJA 2ZQDA 3O88A 2PT7A 2V8CA 4S2MA 5IU1A 1ZG4A 3KYEA 2ZC4B 4O8GA 3E2KA 4NXEA 2I9VA 5HWTA 1IEMA 4RYEA 2H5SA 5EOEA 1T1CA 3DTEA 4HP4A 1BYWA 3N7WA 2O99A 1E3UD 2WKHA 1VEUA 3A0RA 1NLYA 5EM1A 5AVEA 1OTBA 4I39A 3HL9A 4E3JA 3O86A 1K38A 4MN7A 1C3BA 4E3MA 2XDMA 1IYQA 5CGSA 3VOLA 3U2AA 3G4PA 2W27A 1JTDA 2QMIA 3IX8A 1MY8A 4FCFA 4BWIA 2QZ6A 2KLIA 1PWGA 1HLUP 2ZC5B 4LGWA 4QY6A 5FQ9A 5HD5A 4M3KA 1TS7A 3CITA 5MC7A 3FKVA 5J7EA 2WKPA 5EOOA 3FKWA 3UMDA 3EEAA 1TVFA 1S67L 2V9AA 5E2EA 4HESA 1FR1A 3T4KA 3MQQA 1H8ZA 1NY0A 5J3WA 3F1NA 3UMEA 5M1AA 1LI9A 3I7JA 4NETA 1K4FA 3OPHA 3DAVA 1DP8A 2ZOIA 3H9WA 4LV1A 1MWSA 4A5RA 3EEHA 1RGYA 3PBQA 2IWBA 3LY4A 3LICA 3VV4A 3N8SA 2W3FA
chains in the Genus database with same CATH topology
1PFLA 3CPTB 1G5UA 3LGOA 1VETA 1SKOA 2B95A 3CPTA 3T1QB 2V8CA 3T12B 3KYEA 3NULA 1A0KA 1J3WA 1VEUB 1SKOB 2JKFA 2PAVP 2ACGA 5EM0A 3MSHA 1VEUA 3NECA 3T1SA 5FEFA 5EM1A 5EVEA 1PRQA 1CF0A 4X25A 2E8JA 1FIKA 4X1LA 2PBDP 2JKGA 1CJFA 2BTFP 3UB5P 1ACFA 3L9KA 1CQAA 3MS6A 1HLUP 1K0KA 1D1JA 5FEGA 3T1XA 4D60A 1AWIA 1FILA 5EV0A 2VK3A 4X1MA 2ZL1A 2PRFA 1YPRA 3LEQA 3D9YA 1Z09A 3U4LP 3CHWP 3DAVA 4FUWA 2HZ5A 1Y4OA 2V8FA 4QWOA 3T1RA 4ESPA 2ZL1B 1SZVA 4FTXA 3L7HA 1VETB 1F2KA 1PNEA 5FDSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PFL A;  3CPT B;  1G5U A;  3LGO A;  1VET A;  1SKO A;  2B95 A;  3CPT A;  3T1Q B;  2V8C A;  3T12 B;  3KYE A;  3NUL A;  1A0K A;  1J3W A;  1VEU B;  1SKO B;  2JKF A;  2PAV P;  2ACG A;  5EM0 A;  3MSH A;  1VEU A;  3NEC A;  3T1S A;  5FEF A;  5EM1 A;  5EVE A;  1PRQ A;  1CF0 A;  4X25 A;  2E8J A;  1FIK A;  4X1L A;  2PBD P;  2JKG A;  1CJF A;  2BTF P;  3UB5 P;  1ACF A;  3L9K A;  1CQA A;  3MS6 A;  1HLU P;  1K0K A;  1D1J A;  5FEG A;  3T1X A;  4D60 A;  1AWI A;  1FIL A;  5EV0 A;  2VK3 A;  4X1M A;  2ZL1 A;  2PRF A;  1YPR A;  3LEQ A;  3D9Y A;  1Z09 A;  3U4L P;  3CHW P;  3DAV A;  4FUW A;  2HZ5 A;  1Y4O A;  2V8F A;  4QWO A;  3T1R A;  4ESP A;  2ZL1 B;  1SZV A;  4FTX A;  3L7H A;  1VET B;  1F2K A;  1PNE A;  5FDS A; 
#chains in the Genus database with same CATH topology
 4CQH A;  4YFM A;  1ZC2 A;  3PBR A;  5I5L A;  1YT4 A;  3C7V A;  1BLC A;  4U3T A;  3RTY A;  2H10 A;  3N6I A;  1S6R A;  4S2O A;  3ZFZ A;  1NYY A;  1JVJ A;  4ZJ2 A;  2HP9 A;  4GCZ A;  4H6J A;  5AJG A;  4ETZ A;  2A49 A;  1K57 C;  5CXW A;  1LL5 A;  3MXQ A;  5E2H A;  4S2I A;  3JPU A;  2PR5 A;  4X69 A;  5DKL A;  3LIA A;  1JWZ A;  3IF6 C;  3RXW A;  4DE0 A;  3IWO A;  2M1C A;  1OT9 A;  2A2L A;  5K5B A;  2ZQC A;  1D1J A;  4OOL A;  3IH8 A;  2PHY A;  3MMH A;  4H8R A;  4HNB A;  2NUP C;  2V20 A;  2J3W A;  1RGZ A;  4GHI B;  4KQO A;  1KDW A;  3C8C A;  4LLO B;  3F1O B;  3NI9 A;  4BBT A;  1PW8 A;  2WGV A;  2DMW A;  3UDF A;  5A92 A;  1P9R A;  1LSV A;  3SOI A;  4AFI A;  1OT6 A;  3HLW A;  3DTM A;  4EBL A;  5CX7 A;  2A24 B;  3PR6 A;  3IH9 A;  3ZQ5 A;  2J9P A;  2V1Z A;  5FI7 A;  4KZ4 A;  5CGX A;  4KG5 A;  2ZC7 A;  2ZC3 B;  2B95 A;  5HWV A;  4GJ4 A;  3T4J A;  3H82 A;  4XUX A;  1SDN A;  4X6T A;  3WRT A;  4MLL A;  3EWK A;  1YMX A;  3HLC A;  2PU4 A;  4Z1W A;  3RH8 B;  1QME A;  5F1F A;  2ZQ9 A;  5DF8 A;  4OVD A;  4ID4 A;  3M2K A;  1L3L A;  1CEF A;  1FOF A;  2VLG A;  3MBZ A;  4BJP A;  1OTE A;  4WMC D;  4K0X A;  3NOP C;  2EA9 A;  3MF0 A;  1FR6 A;  5A8B A;  5EVI B;  1OTI A;  4LRX C;  3CZD A;  3KYZ A;  4E3N A;  4Q0H A;  3CUE A;  5FI2 A;  2PBY A;  3G34 A;  4DDS A;  2JKR I;  3UE6 A;  4EER A;  5HZH A;  2Z2M B;  3HBR A;  3GV9 A;  3R7W B;  1XGI A;  1LHY A;  5CHU A;  1FIL A;  3LR0 A;  1XJ2 A;  2VK3 A;  2ZC6 B;  3HLE A;  3UDI A;  4OQI A;  3KSG A;  3KYQ A;  4YOF A;  3MZE A;  1RP5 A;  3FC7 A;  4JBF A;  1KE4 A;  3G35 A;  1EI5 A;  4MMN A;  4R3J A;  5CHJ A;  3QP2 A;  3VE3 A;  4C75 A;  2IA2 A;  3BQA A;  3BY9 A;  2Z6C A;  1V9Y A;  4QD4 A;  4EQI A;  1ONG A;  4FTX A;  2L1M A;  1E4D A;  2M7V A;  1IOU A;  3JVU A;  4Q0I A;  1XJ4 A;  4BD0 A;  4HJ4 A;  2Z2L B;  3LEZ A;  4RA7 A;  2A3U A;  1SKO A;  4HBT A;  4X55 A;  2W3G A;  1JWV A;  3T1Q B;  5CTM A;  1OTA A;  5DJT A;  3S1Y A;  4OOM A;  1VEU B;  1FSY A;  4ZTK A;  2HDQ A;  4S2N C;  1MWT A;  1FCO A;  1VQQ A;  2ACG A;  2EX9 A;  3NEC A;  5M19 A;  1BUE A;  2JC7 A;  4E6X A;  2WAF A;  4K0W A;  3LYX A;  1MKM A;  2HDR A;  3W4Q A;  5HX9 A;  4DXB A;  3KSH A;  3CJM A;  1N9L A;  1HVB A;  1CJF A;  1KGE A;  5TR7 A;  3R4K A;  2WYX A;  3B33 A;  1Y54 A;  3OCN A;  3HLF A;  3UN7 A;  4HQA A;  4EET B;  2WKI A;  2OV5 A;  4WZ5 C;  4E6W A;  3NDE A;  2FH5 A;  2VJW A;  3GVB A;  3VE4 A;  3F1N B;  4JXS A;  5DFX A;  5EFW A;  1S1Z A;  1ESU A;  5CED A;  3OC2 A;  2EWW A;  3F1P A;  4DN0 A;  3UB7 A;  4C6Y A;  5L09 A;  3U4L P;  3PBS A;  3JYI A;  2WUQ A;  3Q7V A;  5EVI C;  4R3B A;  5I94 A;  3ZG5 A;  4MN5 A;  4KQR A;  2ZL1 B;  2H28 A;  3G32 A;  4HBU A;  4XT2 B;  4IUK A;  4OQH A;  1K55 C;  2ZMA A;  1YAX A;  1PFL A;  3E0Y A;  2P7J A;  3UB6 A;  2JKT I;  1XA1 A;  3LID A;  3UE1 A;  4X68 A;  2PD8 A;  4E3O A;  1CEG A;  2XR0 A;  4JXW A;  3DWK A;  4O7D A;  1TD5 A;  5FQK A;  4E04 A;  3HUO A;  1GHP A;  3K3C A;  2Y55 A;  4LV3 A;  5FDH A;  3MKF A;  4GLQ A;  2E8I A;  4PM8 A;  3V39 A;  2Y59 A;  1S4R A;  4MCW A;  5L2F A;  3HUN A;  2FZ0 A;  1KVM A;  5F5Y A;  3T1S A;  4RX2 A;  2XFS A;  1ERO A;  1L2S A;  3TJZ C;  2L4R A;  1CF0 A;  4NXG A;  1FIK A;  1G6A A;  3OZH A;  4E3K A;  4UHU A;  4X53 A;  2ZJ9 A;  3T4L A;  4Q8I A;  3L9K A;  2VZW A;  2Q9N A;  1L0F A;  2XA7 S;  4Y3I A;  1P0Z A;  4R6L A;  4JKT A;  3FPW A;  1LL8 A;  3S7O A;  1OPX A;  1E25 A;  4D60 A;  3SS3 A;  3VP1 A;  5DFY A;  1X0O A;  3EOI A;  4PMA A;  1UGU A;  1Z09 A;  4WLA A;  5F69 A;  5BOH A;  2O9A A;  4HHD A;  3JVV A;  1XKZ A;  3ZVT A;  3W2Z A;  2HP6 A;  2JHE A;  4ZJ1 A;  1S66 L;  2W1R A;  3ISG A;  4QWO A;  4XXR A;  3EGD C;  3D72 A;  5TBM A;  2EX2 A;  1YLY A;  1T1A A;  3DTK A;  4Y7P A;  1SKF A;  4S2K A;  1IYS A;  2EXB A;  2HDU A;  5FAP A;  2OSU A;  1F2K A;  3WWX A;  3LFV A;  5GLC A;  1KGF A;  3NDG A;  2D01 A;  4L0L A;  4WZ4 A;  1XFQ A;  3NCK A;  4B4Z A;  4EEP A;  3PBT A;  4N1X A;  1S4S A;  3IBJ A;  1KVL A;  1A0K A;  3FG8 A;  4NKP A;  4R23 A;  3OPP A;  3TSG A;  1V9Z A;  5EM0 A;  2ZM0 A;  4DXC A;  3MXR A;  3DWZ A;  3MFX A;  1PWC A;  4DRT A;  3IF6 B;  1XX2 A;  2HDS A;  4X25 A;  2W1T B;  1BUL A;  4L9F A;  4EES A;  2C6W B;  3G2Z A;  4E3I A;  3D4F A;  3V3R A;  5D3O A;  5HDS A;  3OLO A;  4I3I A;  1ERM A;  1PZP A;  5EEC A;  4BMW A;  5KZH A;  1MXO A;  2QKP A;  4D2O A;  4CLC E;  1JWP A;  1PWD A;  4PPR A;  1VM1 A;  2XK1 A;  2WAD A;  2HF6 A;  4ARZ A;  4OON A;  4CPK A;  4JF5 A;  4EU0 A;  3KSI A;  1P9W A;  4OQ0 A;  2EFU A;  3QP6 A;  4MEZ A;  4ESP A;  3ZG8 B;  2PYP A;  4Q0J A;  1D7E A;  1NRF A;  4UAA A;  4WYY A;  1N9N A;  4IBX A;  5FI6 A;  4GDB A;  4EXO A;  4YIN A;  3NBL A;  1HZO A;  3MJQ A;  3LGO A;  4YWZ A;  5JYP A;  4WMC A;  2JE5 A;  4JLF A;  5JYO A;  4KUO A;  1Q2Q A;  3V5M A;  2UV0 E;  1FCM A;  1GCE A;  4ZJ3 A;  1F9I A;  1TF1 A;  2O0Y A;  5HSQ A;  3LCE A;  3VP4 A;  4FD8 A;  1TS0 A;  2P08 A;  3MSH A;  2B18 A;  2ZM2 A;  5FQJ A;  3BQ8 A;  4U0X A;  3CG5 A;  3DTI A;  4KG6 A;  4CLC D;  3O87 A;  1LSW A;  2LB5 A;  3N8L A;  1WE4 A;  2O9B A;  3UB8 A;  3ZNT A;  1KE0 A;  1NXY A;  3QP1 A;  3SZT A;  1LLB A;  4OPR A;  5AVF A;  1PIO A;  4UA7 A;  1K0K A;  5EVL A;  2QWS A;  4PM6 A;  1TS6 A;  3EQU A;  1YSP A;  3D3O A;  4DE3 A;  3IQA A;  1GSW A;  4Y5F A;  4B9O A;  3LY3 A;  2CC1 A;  4OPZ A;  3HLB A;  3S7P A;  2J3T D;  2J80 A;  1H5X A;  5EE8 A;  5KMW A;  3A0V A;  4LPZ A;  3CUE C;  1IFQ A;  3PBN A;  1TDG A;  4ZAM A;  3A3D A;  1W79 A;  3BLM A;  1UWN X;  4PHT A;  3MXS A;  3IS2 A;  2QYB A;  2VKS A;  4K91 A;  2QHK A;  2QJ5 A;  5FDS A;  4PM5 A;  1GHI A;  5DF9 A;  5DJU A;  3LR3 A;  5G18 A;  1CI8 A;  3OOV A;  4DJ3 A;  4OLG A;  4P87 A;  3SS5 A;  5F82 A;  2BAS A;  3ZNY A;  3HVF A;  3WS5 A;  4BBV A;  4HP9 A;  3A3I A;  4DJ2 A;  3MZD A;  4IHQ A;  5AQ9 A;  3BYD A;  5L8M A;  3HLD A;  4BQM A;  3GTC A;  4LV0 A;  3DW0 A;  4HH3 A;  3NIA A;  2R9W A;  5DTK A;  4FOF A;  1BTL A;  2VA0 A;  4KZ8 A;  5CHM A;  2J9O A;  1ZG6 A;  3OCL A;  2ZMF A;  1ACF A;  3M6B A;  3ZGA B;  3GSG A;  3LIF A;  4MBK A;  3P01 A;  1MWU A;  2GJ3 A;  5FEG A;  3T1X A;  4RVA A;  3NC8 A;  1N9O A;  1TS8 A;  1AWI A;  1YQS A;  4WL9 A;  2WKQ A;  5GLD A;  5FL3 A;  4GZB A;  3M2J A;  1DP9 A;  2XLN A;  3M6H A;  2NUT C;  4P85 A;  4NG2 A;  4F3L A;  5TGF A;  1KGG A;  1MC0 A;  1XPB A;  4QB8 A;  3WS2 A;  3IHA A;  4FH2 A;  1ES4 A;  3OPL A;  2XQZ A;  3WS4 A;  4BEN A;  2ZQ8 A;  1H0M A;  4QHC A;  4HH2 A;  3ITB A;  4WEJ A;  5M18 A;  4E3L A;  4PKY G;  1YSQ A;  3GQZ A;  2I72 A;  3AGD A;  3W4P A;  3PHY A;  5GLB A;  3CPT A;  3IXH A;  1CI9 A;  3S4X A;  2YKH A;  2JCH A;  3NY4 A;  3VSK A;  3VP2 A;  3Q07 A;  4R70 A;  3P09 A;  3AGF A;  1W63 M;  2JKF A;  1LI0 A;  3A0S A;  5C5K A;  1P97 A;  3CAX A;  5DVA A;  4DE2 A;  1L0E A;  2Q9M A;  2V1A A;  3IXD A;  1L0G A;  1YLW A;  2V1B A;  4X1L A;  3TG9 A;  2JN7 A;  1ES2 A;  2P9V A;  4B93 A;  1ZHH B;  2XH9 A;  2PR6 A;  3LR5 A;  4P6Z M;  4NXF A;  3VOZ A;  4IUH A;  4UQI M;  1DJC A;  4HOI A;  4WF0 A;  1KE3 A;  4HI4 A;  2PU2 A;  2PRF A;  1G68 A;  1L0D A;  3D9Y A;  3V67 A;  1U60 A;  5AQB A;  3ZG9 B;  1PW1 A;  3T4T A;  2J8Y A;  2FFF B;  4IVK A;  3ZCZ A;  5F6A A;  1GSV A;  5L07 A;  3WS1 A;  4DKI A;  2ZOH A;  5CRF A;  4CJN A;  4JXG A;  3EGX C;  3C5A A;  1K54 A;  4MBF A;  3W4O A;  1K4E A;  2HV1 A;  4MN6 A;  3IX3 A;  4N1H A;  2V0W A;  5GL9 A;  1RCJ A;  2VGL S;  1YLP A;  2VX8 A;  3LUQ A;  3C38 A;  2QJ7 A;  3FV7 A;  5FEF A;  1YMS A;  5EVE A;  2D02 A;  1EW0 A;  1XXM A;  4JGR A;  5DKK A;  1K56 D;  3PAE A;  4ZBE A;  4H6J B;  3BM6 A;  3PXP A;  2VEA A;  3PAG A;  2J3T C;  4Y17 A;  4C3Q A;  1CQA A;  1UWP X;  2K31 A;  3CI6 A;  1EWZ A;  5HPF A;  1XJ3 A;  5CGW A;  4KUK A;  3DBA A;  1NZU A;  3MQ0 A;  3VMA A;  1SHV A;  4Y2F A;  2WGW A;  3BRM A;  4O0P A;  2WZZ A;  3LEQ A;  2VGJ A;  1I2S A;  3VSL A;  1YLZ A;  3GDI A;  3GRJ A;  2A24 A;  3BLS A;  3WS0 A;  4KZ5 A;  5FAO A;  2W3D A;  4OPY A;  1GA9 A;  3UE0 A;  4KZA A;  3S7N A;  1NLZ A;  4OQG A;  1KDS A;  5L10 A;  1I2W A;  3VFH A;  1VET A;  4DE1 A;  4CLC A;  3HLG A;  2BG1 A;  3SS4 A;  3O3V A;  1GHM A;  3HRE A;  2XRN A;  3T12 B;  4HEF A;  3TOI A;  3LR4 A;  3G30 A;  4EBP A;  4QJG A;  3G6O A;  4NEE D;  3MFD A;  4BBU A;  4KZB A;  2Q0O A;  4GKU A;  2X01 A;  3IF5 A;  4IBR A;  3BW6 A;  3H82 B;  3BFC A;  1F98 A;  1G28 A;  5HL1 A;  2Y79 A;  5G4Y A;  1YLJ A;  2PBD P;  3QP5 A;  3R7W A;  4OH0 A;  2P74 A;  4GN2 A;  3ZVW A;  2XRO A;  2GX5 A;  4MNR A;  2Y2G A;  5U47 A;  3K2N A;  4S2J A;  1DJB A;  2W0N A;  2RL3 A;  2CMN A;  1K25 A;  5TJJ A;  5FAS A;  1BT5 A;  3B3X A;  4U0T A;  2WGI A;  2M7U A;  5HAP A;  4F3L B;  4B88 A;  5HDD A;  4FSF A;  3PTE A;  1FQG A;  1IKG A;  4GS9 A;  4R0Q A;  4S2L A;  3BY8 A;  1OJ5 A;  4OKP A;  5CER A;  2HP5 A;  3BFE A;  2WAE A;  1YKD A;  3ZG0 A;  3QP8 A;  2J7V A;  4R1G A;  4PM7 A;  4Y15 A;  1M6K A;  3T50 A;  2R9X A;  5CEC A;  1BZA A;  1JNU A;  3E4P A;  5HAQ A;  2GDN A;  2K7S A;  1PNE A;  5F83 A;  3P7N A;  2L0W A;  3CPT B;  3OPR A;  4DF6 A;  3E98 A;  4O01 A;  2HJE A;  2G7U A;  5GHZ A;  3G2Y A;  4I3A A;  2DNS A;  4RQ9 A;  4P6B A;  3S22 A;  3NUL A;  5LBR A;  4X56 A;  2GZA A;  4G3K A;  5J4E A;  5IT5 A;  3B42 A;  3ICY A;  1MZU A;  1J9M A;  4UA6 A;  4EUZ A;  2VV8 A;  1XA7 A;  1SKO B;  2PAV P;  4JPM A;  1LT0 A;  3C2W A;  1PI4 A;  3QNB A;  4KZ3 A;  1PRQ A;  4HJ6 A;  4LRY C;  4HY8 A;  1NZO A;  2P9V B;  3UPO A;  2E8J A;  3NHQ A;  5FQM A;  1M40 A;  2OWH A;  5HFO A;  2OAQ 1;  4PM9 A;  4KEN B;  2BTF P;  3VFF A;  2JKR M;  3T4O A;  4KG2 A;  5DF7 A;  2ZLY A;  1WA9 A;  3QNC A;  1HD8 A;  1ALQ A;  2LB9 A;  1O07 A;  3IWQ A;  4PKY A;  4K08 A;  1DRM A;  3O5Y A;  5DTT A;  1TDL A;  3RXX A;  3A3F A;  2ZL1 A;  2OLV A;  4GNU A;  1MWR A;  4UA9 A;  4XT2 A;  1IEL A;  2JBF A;  4F94 A;  1WYC A;  3H7W A;  5HD3 A;  2ZQA A;  2HJ9 C;  5EVI D;  5A91 A;  4JF4 A;  5CEB A;  3VOY A;  2Z6D A;  4LFU A;  4Z9Q A;  3ZG7 B;  5FSR A;  3F1P B;  4JXV A;  3UPN A;  2EWV A;  2Y2H A;  4QY5 A;  3HJK A;  3Q7V B;  3EQV A;  5J8X A;  5E2G A;  3UNW A;  2INW A;  4LV2 A;  4HJ3 A;  3GEC A;  3TE8 A;  2X71 A;  2V0U A;  2G2W A;  3UB9 A;  2VGK A;  3BEB A;  1JTG A;  4EBN A;  4ZDX A;  5GLA A;  1KOU A;  4WUJ A;  4IED A;  4BLM A;  3MKE A;  4WM9 A;  1N4O A;  5KIZ A;  1IYO A;  3KX0 X;  2Y2O A;  4PAU A;  2Y2J A;  2XD1 A;  2V2F F;  2ZQ7 A;  3OBF A;  1VHM A;  4EWF A;  4ETX A;  3SH9 A;  2OOL A;  1PZO A;  4KQQ A;  5FQI A;  2HGV A;  3NOT C;  2WGW B;  3MR0 A;  4OPQ A;  3UO9 A;  1Q2P A;  4BL3 A;  1FSW A;  5EPH A;  1W5D A;  5E2F A;  4QPR A;  1H8Y A;  4X1M A;  3UPP A;  4GW9 A;  1NWZ A;  5CTN A;  3IX4 A;  2EX6 A;  1STZ A;  1CK3 A;  3CHW P;  3AGE A;  3E2L A;  3NJA A;  4KQD A;  4FUW A;  1XP4 A;  2XEP A;  3Q7Z A;  3IXG A;  3HJI A;  1Y4O A;  5FAQ A;  1S1Y A;  2KDK A;  5HPI A;  1GSX A;  4ME4 A;  2Y4A A;  4MBH A;  1ZTU A;  2UWX A;  3PBO A;  2Y91 A;  2JKT M;  4WEL A;  2XSS A;  1VET B;  2Y2K A;  4CLC B;  1H3Q A;  4KZ9 A;  1K57 A;  5TBM B;  3FZC A;  4GOG A;  3V50 A;  3GMW A;  1K56 A;  1YLT A;  4LEN A;  2EXA A;  1TEM A;  3IF6 A;  4EQ1 A;  2PYR A;  4P6Z S;  2W1T A;  1IKI A;  1ERQ A;  4NXB A;  4UQI S;  3PYP A;  5DTS A;  1BSG A;  2HPB A;  4OP5 A;  4GD6 A;  3IT9 A;  4EUV A;  3VP3 A;  4HIA A;  3SW1 A;  1LSX A;  3WRZ A;  1K54 C;  4NK3 A;  3IWI A;  3TRC A;  5IS1 A;  2O9C A;  4G3W A;  5IHV A;  4Y0T A;  5KSH A;  3UB5 P;  4R4S A;  1IYP A;  5EUA A;  3LI8 A;  3KSF A;  4Y0O A;  1VB6 A;  1PI5 A;  3ITA A;  5FAT A;  3FYZ A;  4JF6 A;  1T19 A;  1FCN A;  1Z6F A;  2WKE A;  4IVI A;  1XGJ A;  5EV0 A;  4GS9 B;  5HAI A;  3Q1F A;  4YNR A;  2H0T A;  1K6S A;  4OOY A;  1T18 A;  3RJU A;  1ESI A;  3ZHH A;  3A3J A;  3GR2 A;  3IBR A;  4ARZ B;  1Y28 A;  2DRW A;  5GHY A;  3Q81 A;  4MDZ A;  5HW3 A;  2WKR A;  3ZDJ A;  2EFX A;  1LL9 A;  1MPL A;  2GNX A;  4R4R A;  3HUM A;  1W63 Q;  3C4O A;  4WBG A;  1ES5 A;  2XD5 A;  2Y2N A;  4M4X A;  4EW7 A;  1DP6 A;  2Y2L A;  3TW8 A;  3MQO A;  4KZ7 A;  5HAR A;  2RCX A;  3V3S A;  2XFT A;  4I38 A;  1ES3 A;  2WK0 A;  3HCY A;  5A93 A;  1J3W A;  2MJ6 A;  4FH4 A;  1ONH A;  3UY6 A;  2XF3 A;  3SH8 A;  2WZX A;  1BLS A;  4S2P A;  2VV6 A;  3BWL A;  3KO6 A;  2K2N A;  3C7U A;  4N92 A;  1K6R A;  1G6O A;  2Y2Q A;  4BL2 A;  4CLC C;  4II7 A;  2ZBB A;  4OLD A;  2VV7 A;  3B47 A;  3BFG A;  4JGP A;  2JKG A;  1WYB A;  2KOI A;  3N8R A;  3NOU C;  4OP8 A;  1NYM A;  1HTZ A;  3BEC A;  3E4O A;  3MS6 A;  3BJN A;  3T4S A;  5E43 A;  4L9G A;  2OWJ A;  3E4Q A;  4EEU A;  2DCF A;  4EV4 A;  1MBL A;  1ODV A;  1XJ6 A;  4WN5 A;  4R3A A;  3H7W B;  2Y8H A;  3LIE A;  5HDC A;  2Y2P A;  2P04 A;  1YPR A;  2ZMV A;  5A90 A;  4R38 A;  3IHB A;  1E3U A;  3LO7 A;  3QP4 A;  2PD7 A;  2G2U A;  5AQ7 A;  4JGQ A;  1I5Q A;  2B5R A;  1S0W A;  2HZ5 A;  1MKI A;  4GHI A;  2V8F A;  1XFN A;  3UDX A;  1PYY A;  1W7F A;  3BFF A;  4N9K A;  3F1O A;  1SZV A;  3CWF A;  2KX6 A;  3L7H A;  3N4I A;  2EX8 A;  4S2N A;  4QU3 A;  4I3J A;  4B4X A;  4DMZ A;  4UEY A;  4P0M A;  2R78 A;  4L9E A;  4JGO A;  4GD8 A;  3MZF A;  4WEK A;  3IS2 B;  5AQA A;  4Y0U A;  2H0Y A;  5FA7 A;  1H8M A;  4G3V A;  3ZYT A;  3QHY A;  2Y2M A;  3Q82 A;  5HL6 A;  3A3E A;  4DDY A;  3K3D A;  4IJG A;  2B02 A;  5FQQ A;  1OTD A;  1D06 A;  2ZM8 A;  4WZ5 A;  5F68 A;  4BD1 A;  3ULF A;  2VGL M;  1DJA A;  1OME A;  5G4Z A;  3LIB A;  3RFB A;  2IWC A;  3G31 A;  5TFQ A;  2OLU A;  4GB7 A;  5KSC A;  1W8Q A;  2IWD A;  1N9B A;  2OAP 1;  4RX3 A;  1F5M A;  3IXB A;  2PDR A;  4I5S A;  1SCW A;  1SDE A;  4ZRR A;  2X02 A;  3W8K A;  5EVI A;  3CMZ A;  1O7E A;  2BLS A;  3UE3 A;  4GDN A;  2C5W B;  3VP0 A;  3P98 A;  1QMF A;  1K55 A;  2FFY A;  4Y13 A;  1GA0 A;  2W3E A;  1BLP A;  2AVX A;  3BFD A;  3FPV A;  3SH7 A;  4LRZ E;  2XA7 M;  1BLH A;  2XGN A;  4LCL A;  2YKF A;  3T1R A;  5HWW A;  1W8Y A;  5F1G A;  1NRJ A;  3T4Q A;  3CLO A;  3LI9 A;  3C30 A;  2QPN A;  1YM1 A;  1NJ4 A;  3S7Q A;  3C4P A;  4N9L A;  1AXB A;  4LCM A;  3FWL A;  2Y2I A;  1G5U A;  4KZ6 A;  1OJG A;  2ZD8 A;  1T1B A;  5GHX A;  2W3H A;  1DY6 A;  4XUZ A;  1ZKJ A;  2ZQD A;  3O88 A;  2PT7 A;  2V8C A;  4S2M A;  5IU1 A;  1ZG4 A;  3KYE A;  2ZC4 B;  4O8G A;  3E2K A;  4NXE A;  2I9V A;  5HWT A;  1IEM A;  4RYE A;  2H5S A;  5EOE A;  1T1C A;  3DTE A;  4HP4 A;  1BYW A;  3N7W A;  2O99 A;  1E3U D;  2WKH A;  1VEU A;  3A0R A;  1NLY A;  5EM1 A;  5AVE A;  1OTB A;  4I39 A;  3HL9 A;  4E3J A;  3O86 A;  1K38 A;  4MN7 A;  1C3B A;  4E3M A;  2XDM A;  1IYQ A;  5CGS A;  3VOL A;  3U2A A;  3G4P A;  2W27 A;  1JTD A;  2QMI A;  3IX8 A;  1MY8 A;  4FCF A;  4BWI A;  2QZ6 A;  2KLI A;  1PWG A;  1HLU P;  2ZC5 B;  4LGW A;  4QY6 A;  5FQ9 A;  5HD5 A;  4M3K A;  1TS7 A;  3CIT A;  5MC7 A;  3FKV A;  5J7E A;  2WKP A;  5EOO A;  3FKW A;  3UMD A;  3EEA A;  1TVF A;  1S67 L;  2V9A A;  5E2E A;  4HES A;  1FR1 A;  3T4K A;  3MQQ A;  1H8Z A;  1NY0 A;  5J3W A;  3F1N A;  3UME A;  5M1A A;  1LI9 A;  3I7J A;  4NET A;  1K4F A;  3OPH A;  3DAV A;  1DP8 A;  2ZOI A;  3H9W A;  4LV1 A;  1MWS A;  4A5R A;  3EEH A;  1RGY A;  3PBQ A;  2IWB A;  3LY4 A;  3LIC A;  3VV4 A;  3N8S A;  2W3F A; 
#chains in the Genus database with same CATH homology
 1PFL A;  3CPT B;  1G5U A;  3LGO A;  1VET A;  1SKO A;  2B95 A;  3CPT A;  3T1Q B;  2V8C A;  3T12 B;  3KYE A;  3NUL A;  1A0K A;  1J3W A;  1VEU B;  1SKO B;  2JKF A;  2PAV P;  2ACG A;  5EM0 A;  3MSH A;  1VEU A;  3NEC A;  3T1S A;  5FEF A;  5EM1 A;  5EVE A;  1PRQ A;  1CF0 A;  4X25 A;  2E8J A;  1FIK A;  4X1L A;  2PBD P;  2JKG A;  1CJF A;  2BTF P;  3UB5 P;  1ACF A;  3L9K A;  1CQA A;  3MS6 A;  1HLU P;  1K0K A;  1D1J A;  5FEG A;  3T1X A;  4D60 A;  1AWI A;  1FIL A;  5EV0 A;  2VK3 A;  4X1M A;  2ZL1 A;  2PRF A;  1YPR A;  3LEQ A;  3D9Y A;  1Z09 A;  3U4L P;  3CHW P;  3DAV A;  4FUW A;  2HZ5 A;  1Y4O A;  2V8F A;  4QWO A;  3T1R A;  4ESP A;  2ZL1 B;  1SZV A;  4FTX A;  3L7H A;  1VET B;  1F2K A;  1PNE A;  5FDS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...