3DAVA

Schizosaccharomyces pombe profilin crystallized from sodium formate
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
126
structure length
126
Chain Sequence
SWQAYVDTSLLGTGKIDRAAIVSRAGDSVWAASAGFNLSPQEIQGLAAGFQDPPSMFGTGIILAGQKYITIRAEGRSIYGKLQKEGIICVATKLCILVSHYPETTLPGEAAKITEALADYLVGVGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Profilin
publication title Incompatibility with Formin Cdc12p Prevents Human Profilin from Substituting for Fission Yeast Profilin: INSIGHTS FROM CRYSTAL STRUCTURES OF FISSION YEAST PROFILIN.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Protein binding
total genus 36
structure length 126
sequence length 126
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00235 Profilin Profilin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 3davA00
4FTXA 1CJFA 1PNEA 1J3WA 2ZL1A 3T1RA 3CPTA 2HZ5A 1PRQA 3D9YA 3T12B 1SKOA 1Y4OA 1Z09A 1YPRA 2V8FA 3MS6A 1A0KA 3DAVA 5FEGA 1VETA 4X25A 3T1XA 3MSHA 3LGOA 3T1QB 2BTFP 2PBDP 4FUWA 2JKGA 5FDSA 1SKOB 1VEUB 5FEFA 3LEQA 2PRFA 1FILA 1FIKA 3L7HA 3L9KA 2B95A 2VK3A 1K0KA 5EVEA 5EM1A 2ZL1B 5EV0A 3CPTB 1SZVA 2V8CA 3T1SA 1AWIA 1D1JA 1CQAA 3KYEA 1ACFA 5EM0A 4D60A 4X1MA 2E8JA 3UB5P 1VETB 2JKFA 4X1LA 3CHWP 4QWOA 3NULA 1F2KA 3NECA 2ACGA 1HLUP 1CF0A 1VEUA 4ESPA 2PAVP 3U4LP 1PFLA 1G5UA
chains in the Genus database with same CATH superfamily
5DTTA 4E3LA 4JXWA 1YAXA 5DJUA 5TR7A 2O9AA 2HGVA 3H9WA 1VQQA 5F1GA 1Y4OA 5HDDA 3BEBA 2HDRA 1H8YA 4EW7A 3VOZA 4GDNA 4HP4A 2PBDP 3MBZA 3C7VA 1L2SA 3WS1A 4CLCA 2INWA 1XGIA 3QNCA 4R1GA 5J4EA 5FA7A 5DFXA 1XJ2A 2HP6A 4HHDA 1YLZA 4GD6A 5TGFA 2G7UA 3L7HA 2XGNA 2M7UA 4JF4A 4OQ0A 4LV1A 2JBFA 2RL3A 5EV0A 4OQHA 3ITAA 1WYBA 2V1BA 5DF9A 3NHQA 2Y2OA 1OTEA 1I5QA 3T1SA 1W63M 3DWZA 4R70A 3Q81A 3C38A 4DXCA 4RYEA 1KVLA 3V39A 4BBUA 3B33A 4S2LA 3IS2B 4P85A 4IVKA 3W4OA 2VJWA 1L3LA 2ZC7A 1RCJA 2PYPA 1BTLA 4ME4A 2JCHA 2QJ5A 4HESA 3DTEA 1WYCA 5F82A 1VEUA 1W63Q 5J7EA 2HJ9C 1O7EA 4FTXA 2A24B 5M18A 4OOLA 4QY5A 4ZBEA 5CGXA 2R9XA 2W3HA 2FFFB 1OTIA 4WEKA 1NYYA 3ZFZA 3S7NA 4KQDA 3NDEA 3D9YA 1WE4A 1XJ6A 3UPPA 1YLWA 3VMAA 3IXHA 3T4SA 1K57A 2DRWA 3UE3A 3PAGA 3EEHA 3W4QA 3OCLA 1PWCA 4S2JA 3C4OA 4K91A 3H7WB 4U0TA 3F1PB 1QMEA 4KZ4A 1H0MA 4YWZA 4I39A 4X53A 5TFQA 3BLSA 1K0KA 5GLAA 3H82B 3GTCA 4X6TA 1W8YA 1W79A 4QJGA 1H3QA 4GKUA 1YMXA 3CAXA 3ITBA 3O3VA 1FR6A 3B42A 2NUPC 1FCMA 3PTEA 4XXRA 5EE8A 1KGEA 2JC7A 2KLIA 3N7WA 4WZ5A 1K56A 3ULFA 4AFIA 2VKSA 1NRJA 2XA7S 2GDNA 3RTYA 3LR4A 4MNRA 4Q0IA 1YSQA 1DP9A 3UPOA 1S1ZA 3KSHA 4Z1WA 1PW1A 4HJ3A 1MXOA 1VHMA 1PNEA 3BQ8A 4Z9QA 2B02A 3F1NA 4FSFA 2G2WA 2Y2IA 3PBTA 2WUQA 3PBRA 5MC7A 3RH8B 1MWUA 1K25A 1SKFA 1YKDA 3GQZA 3ZG0A 2Y79A 1D7EA 3PBQA 2Q9NA 4F94A 5IU1A 3U2AA 3UE6A 1UWNX 2WAFA 2K31A 5BOHA 1K6SA 2ZC5B 3R7WB 2WGWB 3NC8A 3AGFA 4BD0A 2VGLM 2P7JA 3T4KA 1T1BA 3MFXA 1S66L 2HV1A 3AGDA 3ZYTA 3A0RA 3EQVA 2WKPA 2VA0A 4LCMA 3W8KA 2VK3A 2EXBA 3IQAA 1IEMA 4ZJ2A 1MWTA 1LL5A 3B47A 4PMAA 1IYQA 4LGWA 1MZUA 1EW0A 3K3CA 5K5BA 3QP5A 3FKVA 1NZOA 3UE0A 4P6ZS 2E8JA 3S22A 3DWKA 4LLOB 3E4QA 1IOUA 5AVFA 4EQ1A 1ES2A 3TW8A 1ESIA 5KIZA 3OPPA 5EVIA 2Z2LB 3A3DA 3PXPA 2XEPA 1HLUP 3IBJA 3IWOA 2WGIA 1RP5A 4B93A 1BSGA 4EXOA 3U4LP 3FYZA 3S7PA 4IEDA 3O5YA 5G18A 4S2NA 3N4IA 4KZ7A 2VV8A 2VLGA 1LSWA 3GMWA 3LIBA 2XR0A 2Y8HA 4WF0A 3SW1A 4B4XA 5F69A 1Z09A 3C2WA 3O87A 1IFQA 5HAQA 4HIAA 4JXVA 5FEGA 2EFXA 4QD4A 4MLLA 2J9OA 2J80A 3EWKA 2ZM8A 1S6RA 3BY9A 1LI0A 4G3VA 5HX9A 1RGYA 2EX9A 3NY4A 3P01A 5GHYA 3M2JA 3MJQA 2ZJ9A 1K56D 4DDSA 5FQKA 2WGVA 1GSVA 3KSFA 1YMSA 4RVAA 1M6KA 1NRFA 3LIDA 2HPBA 3BY8A 3HBRA 4BENA 1MKIA 1CQAA 3UDIA 2KDKA 4LENA 1Z6FA 2OOLA 3Q7ZA 3A3IA 4ARZA 4CPKA 3UB5P 1FR1A 4OLDA 1MC0A 1DP8A 3I7JA 4QWOA 3NULA 2ZQCA 3QP8A 4G3WA 4X56A 2EXAA 3BECA 3T50A 4JLFA 1TS8A 4KZ9A 4MN5A 4Y0OA 2R9WA 4OP5A 1PZPA 2DMWA 2DNSA 4OPYA 2JKRM 1LI9A 4GHIA 4GCZA 3TOIA 4KG2A 3IXDA 1K38A 3WS5A 2K2NA 5F5YA 3CPTA 3FWLA 2O99A 4Y0UA 1S4SA 1PRQA 2Y2GA 3T4QA 4GJ4A 4EERA 3LI9A 3IH9A 3CMZA 3MKEA 3A3EA 2QWSA 4E3MA 2VZWA 2V1AA 3NDGA 2IWDA 3LI8A 2Q0OA 2PDRA 2QMIA 5CHMA 5GLDA 1FCNA 3V3SA 3N6IA 1H8ZA 2Y55A 3N8SA 1L0EA 1XFQA 3Q82A 1TDLA 5FL3A 2W3FA 3HLGA 3G4PA 5EVID 1N9LA 3NOTC 3MXRA 3FPVA 3E98A 4CLCB 5FI2A 3NI9A 2WADA 3MKFA 1S67L 4HBTA 1ZTUA 4MBHA 3FC7A 3MZEA 3QP2A 3S4XA 1SDEA 3FG8A 3UE1A 4MDZA 2Y59A 4LV2A 4F3LB 3QP1A 1GSWA 4PKYA 2WKEA 3TRCA 4YNRA 4EV4A 3HLWA 3ZDJA 3HVFA 4EEPA 4DRTA 2IA2A 5HPIA 5EUAA 3UO9A 3WRTA 2J3TC 4KZ3A 2EX2A 4HEFA 4RA7A 1W8QA 1OJGA 3EGXC 3Q7VB 3WS0A 3C7UA 1PW8A 4WN5A 2VGKA 1S4RA 1SKOA 3UB6A 5D3OA 3MS6A 5FQIA 4R6LA 1A0KA 3IXGA 4DF6A 1VB6A 3HL9A 4BLMA 5GHZA 1HZOA 2G2UA 2UWXA 4JPMA 1XJ4A 4FUWA 3LYXA 5FDSA 2QHKA 1NLZA 2CC1A 1TD5A 4QPRA 2V1ZA 4IUKA 4NXBA 2J3TD 2ZM2A 3SH9A 2VV7A 3OBFA 1XA7A 4H6JB 2WZZA 2XF3A 3R4KA 2H0YA 4WUJA 3NJAA 3PAEA 1SZVA 5A93A 1AWIA 4BQMA 3CITA 4LV0A 1YSPA 1D06A 3A3FA 1MY8A 2ZQ9A 2W1TA 1BLPA 2QPNA 3RXWA 2QJ7A 4RX2A 2ZQ7A 1N9OA 4MBKA 5LBRA 2M7VA 1DP6A 5FAPA 4R3JA 2ACGA 4JGOA 1LSXA 2PBYA 4WMCD 5CHJA 3VSLA 3MXQA 5GLBA 4ZJ3A 2FZ0A 2PAVP 5TBMA 2HP5A 3RJUA 3T4TA 1E3UD 3N8RA 5A90A 4L9GA 2HJEA 5DKKA 3G35A 3IX4A 5EFWA 4DE1A 5HPFA 4OQGA 4HI4A 1SDNA 5HAIA 4G3KA 4Q0HA 2V8FA 4RX3A 1P97A 1U60A 2X02A 4XT2B 3ICYA 4GB7A 4PPRA 2D01A 1P9WA 3F1NB 4LFUA 3IF6B 2BTFP 4EBPA 4LV3A 4DJ3A 4U3TA 1I2WA 2XRNA 4K08A 3OPHA 4X69A 1H5XA 2H10A 3V5MA 5A8BA 4BMWA 1W7FA 1PWDA 3UB9A 1JWPA 3L9KA 3QP6A 1YM1A 3P09A 4OPRA 4D2OA 5HARA 4GLQA 3P7NA 5DFYA 3C8CA 1XP4A 3HLFA 5EECA 3FV7A 4E3KA 4S2PA 3D3OA 3HLBA 1VETB 3VP3A 1X0OA 4BL2A 1P0ZA 1KOUA 4GS9A 1DJAA 2JHEA 1ZKJA 5IT5A 1OT6A 4UEYA 5U47A 2H28A 3HJKA 2WKRA 3CUEC 1HVBA 1Y28A 2VX8A 2PYRA 5FI7A 4UQIM 1NXYA 5HSQA 4IJGA 5FQQA 2WZXA 4OPQA 4ZRRA 1G5UA 4EUVA 1G6AA 2M1CA 5EVIB 5HL1A 4B9OA 4EWFA 1EROA 1OJ5A 3F1OA 4OOMA 5HAPA 3G2YA 1BYWA 4NXGA 4MN7A 1GCEA 1YLTA 3SOIA 4LRYC 3HLEA 3NCKA 5GLCA 5CGSA 2QZ6A 2PHYA 1P9RA 4A5RA 2GZAA 2P08A 1IELA 1KDSA 1T1AA 2P74A 4JXSA 4E04A 4DN0A 4R3BA 1ONGA 1OMEA 3LY3A 1LLBA 2XH9A 5CEDA 2J3WA 2JKTM 3ZG5A 2P9VA 5KSCA 3W2ZA 5EOOA 3E4PA 4QHCA 3LR0A 2A3UA 5FQMA 1MWSA 3ZQ5A 2BASA 2Y2PA 4YINA 3FZCA 3BJNA 1OTAA 3EEAA 4FH4A 4OKPA 4HJ6A 3A0VA 2ZQAA 3DTIA 3K2NA 1ZG6A 1ERMA 4HNBA 2GJ3A 2XQZA 5I5LA 2W3EA 3GV9A 4JGQA 5EOEA 2WYXA 5HW3A 4CLCE 3LIEA 4BD1A 1NZUA 2AVXA 3WS4A 3VSKA 5G4YA 2GX5A 2V20A 4FH2A 2H0TA 3UMDA 5CGWA 1LT0A 4YFMA 4ARZB 4E3NA 1BUEA 1XFNA 1F9IA 2W27A 4DE3A 1PFLA 4LPZA 4KQRA 2X01A 5FATA 3PHYA 4KUOA 5J8XA 4NG2A 4O0PA 3C30A 1ES4A 1FCOA 2W3GA 2HZ5A 3SH8A 3KYZA 2MJ6A 1ES5A 3N8LA 2VEAA 2Y2NA 3VP2A 3PBOA 1K55C 2JKRI 4U0XA 3UN7A 1XPBA 4GD8A 3NOPC 2W3DA 3GDIA 2PU4A 3ZNTA 5HWWA 3BWLA 3BFFA 5HL6A 2JKGA 4NKPA 5FEFA 3GVBA 3KSGA 4PAUA 3S7QA 2XD1A 4OPZA 3OCNA 3VP0A 4JF5A 5E43A 4KG6A 4BBTA 2ZL1B 4E3OA 3M6BA 4BJPA 3LO7A 2XD5A 3IF6C 1XJ3A 2EA9A 4GOGA 3IWQA 4Y15A 3CWFA 1JNUA 1ODVA 1FQGA 3ZHHA 3HUMA 2ZOIA 2CMNA 2I9VA 3BYDA 3R7WA 1GA9A 2ZLYA 2HDQA 4PM5A 1GA0A 3HLCA 1CI8A 1T1CA 1H8MA 5CRFA 1XX2A 5CHUA 5AJGA 2O9CA 1IKGA 2V9AA 5I94A 3OLOA 4S2IA 4DMZA 3Q07A 3SZTA 3SS4A 4KENB 3LCEA 5DTSA 2P04A 3CI6A 4PHTA 1OTDA 3T12B 1LSVA 2Y2HA 5DTKA 5L2FA 4Y5FA 2C5WB 2OSUA 4R0QA 1SHVA 5F83A 1CEFA 2PR6A 5M19A 2GNXA 4PM6A 2XDMA 3ZCZA 4IHQA 1PYYA 2XSSA 1Q2QA 1XGJA 3B3XA 3IX8A 4UQIS 2HF6A 2ZD8A 3KYQA 4DDYA 5C5KA 3LR3A 3MF0A 3IBRA 1SKOB 2V0UA 5AVEA 1PZOA 4LRXC 1N9BA 3QHYA 2B95A 4WMCA 2YKHA 3BRMA 1FOFA 1UWPX 5HD5A 4JKTA 1XA1A 3IT9A 5M1AA 1E3UA 4RQ9A 2XFTA 3SS5A 4LRZE 4WELA 3V3RA 3G32A 3T4LA 4IBXA 3KYEA 1TDGA 2O9BA 2IWBA 1XKZA 5KSHA 1ZHHB 2HDUA 1SCWA 2JKFA 2Z2MB 2J8YA 2Y2JA 5L10A 4PKYG 3IF5A 1L0FA 1F2KA 3LFVA 5F68A 2Y2QA 4E3JA 1EWZA 4UA9A 5HDSA 4HH3A 2OWJA 3SS3A 2Q9MA 1G28A 1E25A 2PT7A 3BW6A 2W1TB 2D02A 4II7A 1KVMA 4HOIA 4WZ4A 3NBLA 3WRZA 5EVLA 5FQ9A 3QNBA 5GL9A 4E3IA 2RCXA 2VGLS 3HLDA 3LUQA 4EQIA 4KQOA 5FAQA 3DTKA 3VP1A 1KE0A 2PU2A 2PR5A 3GR2A 1TF1A 5TBMB 3HCYA 4ETZA 3HUOA 1DJCA 1M40A 4GDBA 4MN6A 4EBLA 4PM9A 1NLYA 3O86A 2I72A 3C4PA 4R4RA 3V67A 3OZHA 3VE3A 4K0XA 2ZC6B 5FQJA 1VEUB 4I3JA 3G31A 2XFSA 2QKPA 4L9FA 4IVIA 2R78A 2VV6A 3T4OA 1ZC2A 5EVEA 1CK3A 3TE8A 3PYPA 4S2KA 3TSGA 3LY4A 2FH5A 3PBSA 4OONA 1NWZA 5E2EA 1S1YA 4KZ5A 1K6RA 1PI4A 4R3AA 5EM0A 5HDCA 1MBLA 3DW0A 5AQBA 1AXBA 5JYOA 4QY6A 4R23A 4KG5A 3WS2A 1XXMA 3MXSA 2ZMAA 4WYYA 3S7OA 4BWIA 3UMEA 1HD8A 3MZFA 1JWVA 4X55A 1GHIA 1RGZA 1CF0A 1KDWA 1KGGA 3PBNA 1HTZA 4S2MA 4DJ2A 3HJIA 4ESPA 3A0SA 3IWIA 3VOLA 3CUEA 5E2FA 1YLPA 4M3KA 4P6ZM 4GS9B 1DRMA 2QYBA 3E4OA 3CJMA 1IYOA 4CQHA 3T1RA 3UDXA 2EWVA 1K4FA 5FAOA 4XUZA 2EFUA 1YQSA 1GHPA 3G2ZA 1N9NA 1KGFA 3LIAA 3MZDA 4IUHA 3T1XA 3GSGA 4F3LA 5CEBA 3ZVWA 4R4SA 5HZHA 4O8GA 3F1OB 2ZBBA 3FPWA 3KO6A 1J9MA 4CJNA 4MEZA 2OLVA 2Z6CA 4EEUA 3SH7A 3P98A 3Q7VA 2ZMFA 4B88A 4NK3A 3NOUC 5CERA 4E6XA 3BFEA 2V8CA 4N9LA 2P9VB 2JKTI 4XUXA 3K3DA 4EU0A 5JYPA 5L09A 4UA7A 3NIAA 4X1MA 4ETXA 4I3IA 5FI6A 2W1RA 3RXXA 4O7DA 3NECA 3MQQA 4HBUA 1NYMA 1MPLA 3EOIA 5CTMA 4C75A 1TVFA 2ZC3B 1IYPA 5F6AA 1PIOA 5L07A 3M2KA 4GZBA 4JXGA 1F5MA 4H6JA 2L0WA 1W5DA 2KOIA 3BFDA 3O88A 4KZBA 4EESA 5TJJA 1YLJA 1E4DA 3E2LA 2EX8A 1BLCA 2JE5A 3BLMA 1LL8A 2Y2LA 5A91A 4CLCC 4QU3A 2V2FF 2LB9A 4QB8A 5HWVA 1FSWA 5G4ZA 3LGOA 2PD8A 2EWWA 2L1MA 1PI5A 4KZ6A 3LR5A 5F1FA 3Q1FA 4Y17A 3MFDA 2K7SA 1OTBA 4I38A 1K55A 3ZG7B 2BLSA 2A2LA 1OT9A 5IHVA 1DY6A 1JVJA 2ZQ8A 4N1XA 4OVDA 4BBVA 3JYIA 3IS2A 3MR0A 4NEED 4H8RA 1V9YA 1JTDA 4KUKA 2IWCA 3W4PA 2L4RA 5DVAA 4EUZA 2V0WA 1TS6A 3WWXA 5A92A 2WAEA 3IHAA 3CG5A 3IX3A 4GNUA 4PM7A 5AQ7A 3G6OA 4D60A 4XT2A 5DF8A 3MMHA 4CLCD 3ZGAB 2A24A 3IF6A 3A3JA 3BM6A 4GN2A 3T4JA 3HUNA 4DE0A 4NXEA 1DJBA 1ZG4A 3GRJA 1BT5A 4Q0JA 5CXWA 1MWRA 1LHYA 4WEJA 4Y2FA 5KZHA 3UDFA 2YKFA 3KSIA 5HFOA 1K57C 4WBGA 4JF6A 3H7WA 4IBRA 1C3BA 3F1PA 1YT4A 4L9EA 4P6BA 1IKIA 2B18A 1VETA 1CEGA 1KE3A 1G6OA 4B4ZA 4E6WA 2HDSA 3H82A 3KX0X 4HJ4A 4OLGA 5EPHA 1QMFA 1V9ZA 2UV0E 5E2HA 1T19A 4WL9A 1ALQA 2PRFA 4UAAA 1FIKA 2ZC4B 5L8MA 4GHIB 4JGRA 1N4OA 3MQOA 4EBNA 4OQIA 3E2KA 4MCWA 3CPTB 4HY8A 3VV4A 3UNWA 1OPXA 4C6YA 5DF7A 2W0NA 4WZ5C 1BLHA 1VM1A 4ZTKA 2OAP1 4HH2A 3ZG9B 1Q2PA 3LIFA 2ZOHA 1MKMA 2Z6DA 2OWHA 1ONHA 3QP4A 4FCFA 5FDHA 1F98A 1S0WA 1ES3A 4ID4A 3TJZC 4Q8IA 1CJFA 2ZMVA 3JVVA 1STZA 1WA9A 3OOVA 4K0WA 2NUTC 5IS1A 3S1YA 2WGWA 2J7VA 2WKQA 4UA6A 3IXBA 2Y2MA 3OC2A 1YPRA 3DBAA 4HQAA 3JPUA 3FKWA 3ZNYA 1IYSA 3T1QB 3IH8A 3VOYA 4ZAMA 3OPLA 1GSXA 2XROA 1BULA 4DE2A 1BZAA 4O01A 2EX6A 5FASA 2E8IA 5AQ9A 4Y13A 2HP9A 3VE4A 3VFHA 4P0MA 3LEQA 1L0GA 2C6WB 3DTMA 4I5SA 2Y2KA 4YOFA 5EM1A 2LB5A 3OPRA 4JBFA 4DXBA 2H5SA 3TG9A 3GECA 1GHMA 3V50A 1K54A 5DJTA 2OV5A 5EVIC 1D1JA 1O07A 4KQQA 4Y0TA 1NY0A 2JN7A 3HREA 4Y7PA 4OH0A 5E2GA 4R38A 1UGUA 4N1HA 4OOYA 2O0YA 1Y54A 5CTNA 1G68A 5CX7A 4KZ8A 4MMNA 2Y91A 4PM8A 4NETA 4S2NC 1L0DA 3VP4A 3EQUA 2J9PA 4X68A 4DKIA 5AQAA 1NJ4A 3E0YA 4M4XA 4ZDXA 3D4FA 3EGDC 1ERQA 4OP8A 5CECA 1J3WA 3LICA 2X71A 3G34A 1FSYA 2ZL1A 3LEZA 4EETB 2KX6A 3CLOA 2ZM0A 1I2SA 2XK1A 3DAVA 3UPNA 4I3AA 5HWTA 4X25A 2WK0A 3MSHA 1EI5A 1LL9A 1TS0A 1TS7A 2ZQDA 4BL3A 2PD7A 4WLAA 4P87A 2WKIA 3BFCA 3D72A 4Y3IA 4MBFA 2XA7M 4FOFA 3ZVTA 1FILA 3UB8A 1ESUA 2OAQ1 1JTGA 3MQ0A 1JWZA 5FSRA 2DCFA 1TEMA 3RFBA 4L0LA 4KZAA 2A49A 4NXFA 4FD8A 1PWGA 5GHXA 3AGEA 5DKLA 2B5RA 2FFYA 4HP9A 3ZG8B 1CI9A 1KE4A 1ACFA 3IHBA 3JVUA 3BQAA 2BG1A 4S2OA 4N9KA 1K54C 4N92A 3BFGA 4X1LA 3UY6A 3CHWP 3G30A 2OLUA 5J3WA 1BLSA 5KMWA 4UHUA 3VFFA 4JGPA 1T18A 2XLNA 2Y4AA 3UB7A 3CZDA 3PR6A 4C3QA 5HD3A 1K4EA 3M6HA 3C5AA 2WKHA 1YLYA 3ISGA 4WM9A 4ZJ1A 2VGJA 4LCLA 4GW9A
chains in the Genus database with same CATH topology
4FTXA 1CJFA 1PNEA 1J3WA 2ZL1A 3T1RA 3CPTA 2HZ5A 1PRQA 3D9YA 3T12B 1SKOA 1Y4OA 1Z09A 1YPRA 2V8FA 3MS6A 1A0KA 3DAVA 5FEGA 1VETA 4X25A 3T1XA 3MSHA 3LGOA 3T1QB 2BTFP 2PBDP 4FUWA 2JKGA 5FDSA 1SKOB 1VEUB 5FEFA 3LEQA 2PRFA 1FILA 1FIKA 3L7HA 3L9KA 2B95A 2VK3A 1K0KA 5EVEA 5EM1A 2ZL1B 5EV0A 3CPTB 1SZVA 2V8CA 3T1SA 1AWIA 1D1JA 1CQAA 3KYEA 1ACFA 5EM0A 4D60A 4X1MA 2E8JA 3UB5P 1VETB 2JKFA 4X1LA 3CHWP 4QWOA 3NULA 1F2KA 3NECA 2ACGA 1HLUP 1CF0A 1VEUA 4ESPA 2PAVP 3U4LP 1PFLA 1G5UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FTX A;  1CJF A;  1PNE A;  1J3W A;  2ZL1 A;  3T1R A;  3CPT A;  2HZ5 A;  1PRQ A;  3D9Y A;  3T12 B;  1SKO A;  1Y4O A;  1Z09 A;  1YPR A;  2V8F A;  3MS6 A;  1A0K A;  3DAV A;  5FEG A;  1VET A;  4X25 A;  3T1X A;  3MSH A;  3LGO A;  3T1Q B;  2BTF P;  2PBD P;  4FUW A;  2JKG A;  5FDS A;  1SKO B;  1VEU B;  5FEF A;  3LEQ A;  2PRF A;  1FIL A;  1FIK A;  3L7H A;  3L9K A;  2B95 A;  2VK3 A;  1K0K A;  5EVE A;  5EM1 A;  2ZL1 B;  5EV0 A;  3CPT B;  1SZV A;  2V8C A;  3T1S A;  1AWI A;  1D1J A;  1CQA A;  3KYE A;  1ACF A;  5EM0 A;  4D60 A;  4X1M A;  2E8J A;  3UB5 P;  1VET B;  2JKF A;  4X1L A;  3CHW P;  4QWO A;  3NUL A;  1F2K A;  3NEC A;  2ACG A;  1HLU P;  1CF0 A;  1VEU A;  4ESP A;  2PAV P;  3U4L P;  1PFL A;  1G5U A; 
#chains in the Genus database with same CATH topology
 5DTT A;  4E3L A;  4JXW A;  1YAX A;  5DJU A;  5TR7 A;  2O9A A;  2HGV A;  3H9W A;  1VQQ A;  5F1G A;  1Y4O A;  5HDD A;  3BEB A;  2HDR A;  1H8Y A;  4EW7 A;  3VOZ A;  4GDN A;  4HP4 A;  2PBD P;  3MBZ A;  3C7V A;  1L2S A;  3WS1 A;  4CLC A;  2INW A;  1XGI A;  3QNC A;  4R1G A;  5J4E A;  5FA7 A;  5DFX A;  1XJ2 A;  2HP6 A;  4HHD A;  1YLZ A;  4GD6 A;  5TGF A;  2G7U A;  3L7H A;  2XGN A;  2M7U A;  4JF4 A;  4OQ0 A;  4LV1 A;  2JBF A;  2RL3 A;  5EV0 A;  4OQH A;  3ITA A;  1WYB A;  2V1B A;  5DF9 A;  3NHQ A;  2Y2O A;  1OTE A;  1I5Q A;  3T1S A;  1W63 M;  3DWZ A;  4R70 A;  3Q81 A;  3C38 A;  4DXC A;  4RYE A;  1KVL A;  3V39 A;  4BBU A;  3B33 A;  4S2L A;  3IS2 B;  4P85 A;  4IVK A;  3W4O A;  2VJW A;  1L3L A;  2ZC7 A;  1RCJ A;  2PYP A;  1BTL A;  4ME4 A;  2JCH A;  2QJ5 A;  4HES A;  3DTE A;  1WYC A;  5F82 A;  1VEU A;  1W63 Q;  5J7E A;  2HJ9 C;  1O7E A;  4FTX A;  2A24 B;  5M18 A;  4OOL A;  4QY5 A;  4ZBE A;  5CGX A;  2R9X A;  2W3H A;  2FFF B;  1OTI A;  4WEK A;  1NYY A;  3ZFZ A;  3S7N A;  4KQD A;  3NDE A;  3D9Y A;  1WE4 A;  1XJ6 A;  3UPP A;  1YLW A;  3VMA A;  3IXH A;  3T4S A;  1K57 A;  2DRW A;  3UE3 A;  3PAG A;  3EEH A;  3W4Q A;  3OCL A;  1PWC A;  4S2J A;  3C4O A;  4K91 A;  3H7W B;  4U0T A;  3F1P B;  1QME A;  4KZ4 A;  1H0M A;  4YWZ A;  4I39 A;  4X53 A;  5TFQ A;  3BLS A;  1K0K A;  5GLA A;  3H82 B;  3GTC A;  4X6T A;  1W8Y A;  1W79 A;  4QJG A;  1H3Q A;  4GKU A;  1YMX A;  3CAX A;  3ITB A;  3O3V A;  1FR6 A;  3B42 A;  2NUP C;  1FCM A;  3PTE A;  4XXR A;  5EE8 A;  1KGE A;  2JC7 A;  2KLI A;  3N7W A;  4WZ5 A;  1K56 A;  3ULF A;  4AFI A;  2VKS A;  1NRJ A;  2XA7 S;  2GDN A;  3RTY A;  3LR4 A;  4MNR A;  4Q0I A;  1YSQ A;  1DP9 A;  3UPO A;  1S1Z A;  3KSH A;  4Z1W A;  1PW1 A;  4HJ3 A;  1MXO A;  1VHM A;  1PNE A;  3BQ8 A;  4Z9Q A;  2B02 A;  3F1N A;  4FSF A;  2G2W A;  2Y2I A;  3PBT A;  2WUQ A;  3PBR A;  5MC7 A;  3RH8 B;  1MWU A;  1K25 A;  1SKF A;  1YKD A;  3GQZ A;  3ZG0 A;  2Y79 A;  1D7E A;  3PBQ A;  2Q9N A;  4F94 A;  5IU1 A;  3U2A A;  3UE6 A;  1UWN X;  2WAF A;  2K31 A;  5BOH A;  1K6S A;  2ZC5 B;  3R7W B;  2WGW B;  3NC8 A;  3AGF A;  4BD0 A;  2VGL M;  2P7J A;  3T4K A;  1T1B A;  3MFX A;  1S66 L;  2HV1 A;  3AGD A;  3ZYT A;  3A0R A;  3EQV A;  2WKP A;  2VA0 A;  4LCM A;  3W8K A;  2VK3 A;  2EXB A;  3IQA A;  1IEM A;  4ZJ2 A;  1MWT A;  1LL5 A;  3B47 A;  4PMA A;  1IYQ A;  4LGW A;  1MZU A;  1EW0 A;  3K3C A;  5K5B A;  3QP5 A;  3FKV A;  1NZO A;  3UE0 A;  4P6Z S;  2E8J A;  3S22 A;  3DWK A;  4LLO B;  3E4Q A;  1IOU A;  5AVF A;  4EQ1 A;  1ES2 A;  3TW8 A;  1ESI A;  5KIZ A;  3OPP A;  5EVI A;  2Z2L B;  3A3D A;  3PXP A;  2XEP A;  1HLU P;  3IBJ A;  3IWO A;  2WGI A;  1RP5 A;  4B93 A;  1BSG A;  4EXO A;  3U4L P;  3FYZ A;  3S7P A;  4IED A;  3O5Y A;  5G18 A;  4S2N A;  3N4I A;  4KZ7 A;  2VV8 A;  2VLG A;  1LSW A;  3GMW A;  3LIB A;  2XR0 A;  2Y8H A;  4WF0 A;  3SW1 A;  4B4X A;  5F69 A;  1Z09 A;  3C2W A;  3O87 A;  1IFQ A;  5HAQ A;  4HIA A;  4JXV A;  5FEG A;  2EFX A;  4QD4 A;  4MLL A;  2J9O A;  2J80 A;  3EWK A;  2ZM8 A;  1S6R A;  3BY9 A;  1LI0 A;  4G3V A;  5HX9 A;  1RGY A;  2EX9 A;  3NY4 A;  3P01 A;  5GHY A;  3M2J A;  3MJQ A;  2ZJ9 A;  1K56 D;  4DDS A;  5FQK A;  2WGV A;  1GSV A;  3KSF A;  1YMS A;  4RVA A;  1M6K A;  1NRF A;  3LID A;  2HPB A;  3BY8 A;  3HBR A;  4BEN A;  1MKI A;  1CQA A;  3UDI A;  2KDK A;  4LEN A;  1Z6F A;  2OOL A;  3Q7Z A;  3A3I A;  4ARZ A;  4CPK A;  3UB5 P;  1FR1 A;  4OLD A;  1MC0 A;  1DP8 A;  3I7J A;  4QWO A;  3NUL A;  2ZQC A;  3QP8 A;  4G3W A;  4X56 A;  2EXA A;  3BEC A;  3T50 A;  4JLF A;  1TS8 A;  4KZ9 A;  4MN5 A;  4Y0O A;  2R9W A;  4OP5 A;  1PZP A;  2DMW A;  2DNS A;  4OPY A;  2JKR M;  1LI9 A;  4GHI A;  4GCZ A;  3TOI A;  4KG2 A;  3IXD A;  1K38 A;  3WS5 A;  2K2N A;  5F5Y A;  3CPT A;  3FWL A;  2O99 A;  4Y0U A;  1S4S A;  1PRQ A;  2Y2G A;  3T4Q A;  4GJ4 A;  4EER A;  3LI9 A;  3IH9 A;  3CMZ A;  3MKE A;  3A3E A;  2QWS A;  4E3M A;  2VZW A;  2V1A A;  3NDG A;  2IWD A;  3LI8 A;  2Q0O A;  2PDR A;  2QMI A;  5CHM A;  5GLD A;  1FCN A;  3V3S A;  3N6I A;  1H8Z A;  2Y55 A;  3N8S A;  1L0E A;  1XFQ A;  3Q82 A;  1TDL A;  5FL3 A;  2W3F A;  3HLG A;  3G4P A;  5EVI D;  1N9L A;  3NOT C;  3MXR A;  3FPV A;  3E98 A;  4CLC B;  5FI2 A;  3NI9 A;  2WAD A;  3MKF A;  1S67 L;  4HBT A;  1ZTU A;  4MBH A;  3FC7 A;  3MZE A;  3QP2 A;  3S4X A;  1SDE A;  3FG8 A;  3UE1 A;  4MDZ A;  2Y59 A;  4LV2 A;  4F3L B;  3QP1 A;  1GSW A;  4PKY A;  2WKE A;  3TRC A;  4YNR A;  4EV4 A;  3HLW A;  3ZDJ A;  3HVF A;  4EEP A;  4DRT A;  2IA2 A;  5HPI A;  5EUA A;  3UO9 A;  3WRT A;  2J3T C;  4KZ3 A;  2EX2 A;  4HEF A;  4RA7 A;  1W8Q A;  1OJG A;  3EGX C;  3Q7V B;  3WS0 A;  3C7U A;  1PW8 A;  4WN5 A;  2VGK A;  1S4R A;  1SKO A;  3UB6 A;  5D3O A;  3MS6 A;  5FQI A;  4R6L A;  1A0K A;  3IXG A;  4DF6 A;  1VB6 A;  3HL9 A;  4BLM A;  5GHZ A;  1HZO A;  2G2U A;  2UWX A;  4JPM A;  1XJ4 A;  4FUW A;  3LYX A;  5FDS A;  2QHK A;  1NLZ A;  2CC1 A;  1TD5 A;  4QPR A;  2V1Z A;  4IUK A;  4NXB A;  2J3T D;  2ZM2 A;  3SH9 A;  2VV7 A;  3OBF A;  1XA7 A;  4H6J B;  2WZZ A;  2XF3 A;  3R4K A;  2H0Y A;  4WUJ A;  3NJA A;  3PAE A;  1SZV A;  5A93 A;  1AWI A;  4BQM A;  3CIT A;  4LV0 A;  1YSP A;  1D06 A;  3A3F A;  1MY8 A;  2ZQ9 A;  2W1T A;  1BLP A;  2QPN A;  3RXW A;  2QJ7 A;  4RX2 A;  2ZQ7 A;  1N9O A;  4MBK A;  5LBR A;  2M7V A;  1DP6 A;  5FAP A;  4R3J A;  2ACG A;  4JGO A;  1LSX A;  2PBY A;  4WMC D;  5CHJ A;  3VSL A;  3MXQ A;  5GLB A;  4ZJ3 A;  2FZ0 A;  2PAV P;  5TBM A;  2HP5 A;  3RJU A;  3T4T A;  1E3U D;  3N8R A;  5A90 A;  4L9G A;  2HJE A;  5DKK A;  3G35 A;  3IX4 A;  5EFW A;  4DE1 A;  5HPF A;  4OQG A;  4HI4 A;  1SDN A;  5HAI A;  4G3K A;  4Q0H A;  2V8F A;  4RX3 A;  1P97 A;  1U60 A;  2X02 A;  4XT2 B;  3ICY A;  4GB7 A;  4PPR A;  2D01 A;  1P9W A;  3F1N B;  4LFU A;  3IF6 B;  2BTF P;  4EBP A;  4LV3 A;  4DJ3 A;  4U3T A;  1I2W A;  2XRN A;  4K08 A;  3OPH A;  4X69 A;  1H5X A;  2H10 A;  3V5M A;  5A8B A;  4BMW A;  1W7F A;  1PWD A;  3UB9 A;  1JWP A;  3L9K A;  3QP6 A;  1YM1 A;  3P09 A;  4OPR A;  4D2O A;  5HAR A;  4GLQ A;  3P7N A;  5DFY A;  3C8C A;  1XP4 A;  3HLF A;  5EEC A;  3FV7 A;  4E3K A;  4S2P A;  3D3O A;  3HLB A;  1VET B;  3VP3 A;  1X0O A;  4BL2 A;  1P0Z A;  1KOU A;  4GS9 A;  1DJA A;  2JHE A;  1ZKJ A;  5IT5 A;  1OT6 A;  4UEY A;  5U47 A;  2H28 A;  3HJK A;  2WKR A;  3CUE C;  1HVB A;  1Y28 A;  2VX8 A;  2PYR A;  5FI7 A;  4UQI M;  1NXY A;  5HSQ A;  4IJG A;  5FQQ A;  2WZX A;  4OPQ A;  4ZRR A;  1G5U A;  4EUV A;  1G6A A;  2M1C A;  5EVI B;  5HL1 A;  4B9O A;  4EWF A;  1ERO A;  1OJ5 A;  3F1O A;  4OOM A;  5HAP A;  3G2Y A;  1BYW A;  4NXG A;  4MN7 A;  1GCE A;  1YLT A;  3SOI A;  4LRY C;  3HLE A;  3NCK A;  5GLC A;  5CGS A;  2QZ6 A;  2PHY A;  1P9R A;  4A5R A;  2GZA A;  2P08 A;  1IEL A;  1KDS A;  1T1A A;  2P74 A;  4JXS A;  4E04 A;  4DN0 A;  4R3B A;  1ONG A;  1OME A;  3LY3 A;  1LLB A;  2XH9 A;  5CED A;  2J3W A;  2JKT M;  3ZG5 A;  2P9V A;  5KSC A;  3W2Z A;  5EOO A;  3E4P A;  4QHC A;  3LR0 A;  2A3U A;  5FQM A;  1MWS A;  3ZQ5 A;  2BAS A;  2Y2P A;  4YIN A;  3FZC A;  3BJN A;  1OTA A;  3EEA A;  4FH4 A;  4OKP A;  4HJ6 A;  3A0V A;  2ZQA A;  3DTI A;  3K2N A;  1ZG6 A;  1ERM A;  4HNB A;  2GJ3 A;  2XQZ A;  5I5L A;  2W3E A;  3GV9 A;  4JGQ A;  5EOE A;  2WYX A;  5HW3 A;  4CLC E;  3LIE A;  4BD1 A;  1NZU A;  2AVX A;  3WS4 A;  3VSK A;  5G4Y A;  2GX5 A;  2V20 A;  4FH2 A;  2H0T A;  3UMD A;  5CGW A;  1LT0 A;  4YFM A;  4ARZ B;  4E3N A;  1BUE A;  1XFN A;  1F9I A;  2W27 A;  4DE3 A;  1PFL A;  4LPZ A;  4KQR A;  2X01 A;  5FAT A;  3PHY A;  4KUO A;  5J8X A;  4NG2 A;  4O0P A;  3C30 A;  1ES4 A;  1FCO A;  2W3G A;  2HZ5 A;  3SH8 A;  3KYZ A;  2MJ6 A;  1ES5 A;  3N8L A;  2VEA A;  2Y2N A;  3VP2 A;  3PBO A;  1K55 C;  2JKR I;  4U0X A;  3UN7 A;  1XPB A;  4GD8 A;  3NOP C;  2W3D A;  3GDI A;  2PU4 A;  3ZNT A;  5HWW A;  3BWL A;  3BFF A;  5HL6 A;  2JKG A;  4NKP A;  5FEF A;  3GVB A;  3KSG A;  4PAU A;  3S7Q A;  2XD1 A;  4OPZ A;  3OCN A;  3VP0 A;  4JF5 A;  5E43 A;  4KG6 A;  4BBT A;  2ZL1 B;  4E3O A;  3M6B A;  4BJP A;  3LO7 A;  2XD5 A;  3IF6 C;  1XJ3 A;  2EA9 A;  4GOG A;  3IWQ A;  4Y15 A;  3CWF A;  1JNU A;  1ODV A;  1FQG A;  3ZHH A;  3HUM A;  2ZOI A;  2CMN A;  2I9V A;  3BYD A;  3R7W A;  1GA9 A;  2ZLY A;  2HDQ A;  4PM5 A;  1GA0 A;  3HLC A;  1CI8 A;  1T1C A;  1H8M A;  5CRF A;  1XX2 A;  5CHU A;  5AJG A;  2O9C A;  1IKG A;  2V9A A;  5I94 A;  3OLO A;  4S2I A;  4DMZ A;  3Q07 A;  3SZT A;  3SS4 A;  4KEN B;  3LCE A;  5DTS A;  2P04 A;  3CI6 A;  4PHT A;  1OTD A;  3T12 B;  1LSV A;  2Y2H A;  5DTK A;  5L2F A;  4Y5F A;  2C5W B;  2OSU A;  4R0Q A;  1SHV A;  5F83 A;  1CEF A;  2PR6 A;  5M19 A;  2GNX A;  4PM6 A;  2XDM A;  3ZCZ A;  4IHQ A;  1PYY A;  2XSS A;  1Q2Q A;  1XGJ A;  3B3X A;  3IX8 A;  4UQI S;  2HF6 A;  2ZD8 A;  3KYQ A;  4DDY A;  5C5K A;  3LR3 A;  3MF0 A;  3IBR A;  1SKO B;  2V0U A;  5AVE A;  1PZO A;  4LRX C;  1N9B A;  3QHY A;  2B95 A;  4WMC A;  2YKH A;  3BRM A;  1FOF A;  1UWP X;  5HD5 A;  4JKT A;  1XA1 A;  3IT9 A;  5M1A A;  1E3U A;  4RQ9 A;  2XFT A;  3SS5 A;  4LRZ E;  4WEL A;  3V3R A;  3G32 A;  3T4L A;  4IBX A;  3KYE A;  1TDG A;  2O9B A;  2IWB A;  1XKZ A;  5KSH A;  1ZHH B;  2HDU A;  1SCW A;  2JKF A;  2Z2M B;  2J8Y A;  2Y2J A;  5L10 A;  4PKY G;  3IF5 A;  1L0F A;  1F2K A;  3LFV A;  5F68 A;  2Y2Q A;  4E3J A;  1EWZ A;  4UA9 A;  5HDS A;  4HH3 A;  2OWJ A;  3SS3 A;  2Q9M A;  1G28 A;  1E25 A;  2PT7 A;  3BW6 A;  2W1T B;  2D02 A;  4II7 A;  1KVM A;  4HOI A;  4WZ4 A;  3NBL A;  3WRZ A;  5EVL A;  5FQ9 A;  3QNB A;  5GL9 A;  4E3I A;  2RCX A;  2VGL S;  3HLD A;  3LUQ A;  4EQI A;  4KQO A;  5FAQ A;  3DTK A;  3VP1 A;  1KE0 A;  2PU2 A;  2PR5 A;  3GR2 A;  1TF1 A;  5TBM B;  3HCY A;  4ETZ A;  3HUO A;  1DJC A;  1M40 A;  4GDB A;  4MN6 A;  4EBL A;  4PM9 A;  1NLY A;  3O86 A;  2I72 A;  3C4P A;  4R4R A;  3V67 A;  3OZH A;  3VE3 A;  4K0X A;  2ZC6 B;  5FQJ A;  1VEU B;  4I3J A;  3G31 A;  2XFS A;  2QKP A;  4L9F A;  4IVI A;  2R78 A;  2VV6 A;  3T4O A;  1ZC2 A;  5EVE A;  1CK3 A;  3TE8 A;  3PYP A;  4S2K A;  3TSG A;  3LY4 A;  2FH5 A;  3PBS A;  4OON A;  1NWZ A;  5E2E A;  1S1Y A;  4KZ5 A;  1K6R A;  1PI4 A;  4R3A A;  5EM0 A;  5HDC A;  1MBL A;  3DW0 A;  5AQB A;  1AXB A;  5JYO A;  4QY6 A;  4R23 A;  4KG5 A;  3WS2 A;  1XXM A;  3MXS A;  2ZMA A;  4WYY A;  3S7O A;  4BWI A;  3UME A;  1HD8 A;  3MZF A;  1JWV A;  4X55 A;  1GHI A;  1RGZ A;  1CF0 A;  1KDW A;  1KGG A;  3PBN A;  1HTZ A;  4S2M A;  4DJ2 A;  3HJI A;  4ESP A;  3A0S A;  3IWI A;  3VOL A;  3CUE A;  5E2F A;  1YLP A;  4M3K A;  4P6Z M;  4GS9 B;  1DRM A;  2QYB A;  3E4O A;  3CJM A;  1IYO A;  4CQH A;  3T1R A;  3UDX A;  2EWV A;  1K4F A;  5FAO A;  4XUZ A;  2EFU A;  1YQS A;  1GHP A;  3G2Z A;  1N9N A;  1KGF A;  3LIA A;  3MZD A;  4IUH A;  3T1X A;  3GSG A;  4F3L A;  5CEB A;  3ZVW A;  4R4S A;  5HZH A;  4O8G A;  3F1O B;  2ZBB A;  3FPW A;  3KO6 A;  1J9M A;  4CJN A;  4MEZ A;  2OLV A;  2Z6C A;  4EEU A;  3SH7 A;  3P98 A;  3Q7V A;  2ZMF A;  4B88 A;  4NK3 A;  3NOU C;  5CER A;  4E6X A;  3BFE A;  2V8C A;  4N9L A;  2P9V B;  2JKT I;  4XUX A;  3K3D A;  4EU0 A;  5JYP A;  5L09 A;  4UA7 A;  3NIA A;  4X1M A;  4ETX A;  4I3I A;  5FI6 A;  2W1R A;  3RXX A;  4O7D A;  3NEC A;  3MQQ A;  4HBU A;  1NYM A;  1MPL A;  3EOI A;  5CTM A;  4C75 A;  1TVF A;  2ZC3 B;  1IYP A;  5F6A A;  1PIO A;  5L07 A;  3M2K A;  4GZB A;  4JXG A;  1F5M A;  4H6J A;  2L0W A;  1W5D A;  2KOI A;  3BFD A;  3O88 A;  4KZB A;  4EES A;  5TJJ A;  1YLJ A;  1E4D A;  3E2L A;  2EX8 A;  1BLC A;  2JE5 A;  3BLM A;  1LL8 A;  2Y2L A;  5A91 A;  4CLC C;  4QU3 A;  2V2F F;  2LB9 A;  4QB8 A;  5HWV A;  1FSW A;  5G4Z A;  3LGO A;  2PD8 A;  2EWW A;  2L1M A;  1PI5 A;  4KZ6 A;  3LR5 A;  5F1F A;  3Q1F A;  4Y17 A;  3MFD A;  2K7S A;  1OTB A;  4I38 A;  1K55 A;  3ZG7 B;  2BLS A;  2A2L A;  1OT9 A;  5IHV A;  1DY6 A;  1JVJ A;  2ZQ8 A;  4N1X A;  4OVD A;  4BBV A;  3JYI A;  3IS2 A;  3MR0 A;  4NEE D;  4H8R A;  1V9Y A;  1JTD A;  4KUK A;  2IWC A;  3W4P A;  2L4R A;  5DVA A;  4EUZ A;  2V0W A;  1TS6 A;  3WWX A;  5A92 A;  2WAE A;  3IHA A;  3CG5 A;  3IX3 A;  4GNU A;  4PM7 A;  5AQ7 A;  3G6O A;  4D60 A;  4XT2 A;  5DF8 A;  3MMH A;  4CLC D;  3ZGA B;  2A24 A;  3IF6 A;  3A3J A;  3BM6 A;  4GN2 A;  3T4J A;  3HUN A;  4DE0 A;  4NXE A;  1DJB A;  1ZG4 A;  3GRJ A;  1BT5 A;  4Q0J A;  5CXW A;  1MWR A;  1LHY A;  4WEJ A;  4Y2F A;  5KZH A;  3UDF A;  2YKF A;  3KSI A;  5HFO A;  1K57 C;  4WBG A;  4JF6 A;  3H7W A;  4IBR A;  1C3B A;  3F1P A;  1YT4 A;  4L9E A;  4P6B A;  1IKI A;  2B18 A;  1VET A;  1CEG A;  1KE3 A;  1G6O A;  4B4Z A;  4E6W A;  2HDS A;  3H82 A;  3KX0 X;  4HJ4 A;  4OLG A;  5EPH A;  1QMF A;  1V9Z A;  2UV0 E;  5E2H A;  1T19 A;  4WL9 A;  1ALQ A;  2PRF A;  4UAA A;  1FIK A;  2ZC4 B;  5L8M A;  4GHI B;  4JGR A;  1N4O A;  3MQO A;  4EBN A;  4OQI A;  3E2K A;  4MCW A;  3CPT B;  4HY8 A;  3VV4 A;  3UNW A;  1OPX A;  4C6Y A;  5DF7 A;  2W0N A;  4WZ5 C;  1BLH A;  1VM1 A;  4ZTK A;  2OAP 1;  4HH2 A;  3ZG9 B;  1Q2P A;  3LIF A;  2ZOH A;  1MKM A;  2Z6D A;  2OWH A;  1ONH A;  3QP4 A;  4FCF A;  5FDH A;  1F98 A;  1S0W A;  1ES3 A;  4ID4 A;  3TJZ C;  4Q8I A;  1CJF A;  2ZMV A;  3JVV A;  1STZ A;  1WA9 A;  3OOV A;  4K0W A;  2NUT C;  5IS1 A;  3S1Y A;  2WGW A;  2J7V A;  2WKQ A;  4UA6 A;  3IXB A;  2Y2M A;  3OC2 A;  1YPR A;  3DBA A;  4HQA A;  3JPU A;  3FKW A;  3ZNY A;  1IYS A;  3T1Q B;  3IH8 A;  3VOY A;  4ZAM A;  3OPL A;  1GSX A;  2XRO A;  1BUL A;  4DE2 A;  1BZA A;  4O01 A;  2EX6 A;  5FAS A;  2E8I A;  5AQ9 A;  4Y13 A;  2HP9 A;  3VE4 A;  3VFH A;  4P0M A;  3LEQ A;  1L0G A;  2C6W B;  3DTM A;  4I5S A;  2Y2K A;  4YOF A;  5EM1 A;  2LB5 A;  3OPR A;  4JBF A;  4DXB A;  2H5S A;  3TG9 A;  3GEC A;  1GHM A;  3V50 A;  1K54 A;  5DJT A;  2OV5 A;  5EVI C;  1D1J A;  1O07 A;  4KQQ A;  4Y0T A;  1NY0 A;  2JN7 A;  3HRE A;  4Y7P A;  4OH0 A;  5E2G A;  4R38 A;  1UGU A;  4N1H A;  4OOY A;  2O0Y A;  1Y54 A;  5CTN A;  1G68 A;  5CX7 A;  4KZ8 A;  4MMN A;  2Y91 A;  4PM8 A;  4NET A;  4S2N C;  1L0D A;  3VP4 A;  3EQU A;  2J9P A;  4X68 A;  4DKI A;  5AQA A;  1NJ4 A;  3E0Y A;  4M4X A;  4ZDX A;  3D4F A;  3EGD C;  1ERQ A;  4OP8 A;  5CEC A;  1J3W A;  3LIC A;  2X71 A;  3G34 A;  1FSY A;  2ZL1 A;  3LEZ A;  4EET B;  2KX6 A;  3CLO A;  2ZM0 A;  1I2S A;  2XK1 A;  3DAV A;  3UPN A;  4I3A A;  5HWT A;  4X25 A;  2WK0 A;  3MSH A;  1EI5 A;  1LL9 A;  1TS0 A;  1TS7 A;  2ZQD A;  4BL3 A;  2PD7 A;  4WLA A;  4P87 A;  2WKI A;  3BFC A;  3D72 A;  4Y3I A;  4MBF A;  2XA7 M;  4FOF A;  3ZVT A;  1FIL A;  3UB8 A;  1ESU A;  2OAQ 1;  1JTG A;  3MQ0 A;  1JWZ A;  5FSR A;  2DCF A;  1TEM A;  3RFB A;  4L0L A;  4KZA A;  2A49 A;  4NXF A;  4FD8 A;  1PWG A;  5GHX A;  3AGE A;  5DKL A;  2B5R A;  2FFY A;  4HP9 A;  3ZG8 B;  1CI9 A;  1KE4 A;  1ACF A;  3IHB A;  3JVU A;  3BQA A;  2BG1 A;  4S2O A;  4N9K A;  1K54 C;  4N92 A;  3BFG A;  4X1L A;  3UY6 A;  3CHW P;  3G30 A;  2OLU A;  5J3W A;  1BLS A;  5KMW A;  4UHU A;  3VFF A;  4JGP A;  1T18 A;  2XLN A;  2Y4A A;  3UB7 A;  3CZD A;  3PR6 A;  4C3Q A;  5HD3 A;  1K4E A;  3M6H A;  3C5A A;  2WKH A;  1YLY A;  3ISG A;  4WM9 A;  4ZJ1 A;  2VGJ A;  4LCL A;  4GW9 A; 
#chains in the Genus database with same CATH homology
 4FTX A;  1CJF A;  1PNE A;  1J3W A;  2ZL1 A;  3T1R A;  3CPT A;  2HZ5 A;  1PRQ A;  3D9Y A;  3T12 B;  1SKO A;  1Y4O A;  1Z09 A;  1YPR A;  2V8F A;  3MS6 A;  1A0K A;  3DAV A;  5FEG A;  1VET A;  4X25 A;  3T1X A;  3MSH A;  3LGO A;  3T1Q B;  2BTF P;  2PBD P;  4FUW A;  2JKG A;  5FDS A;  1SKO B;  1VEU B;  5FEF A;  3LEQ A;  2PRF A;  1FIL A;  1FIK A;  3L7H A;  3L9K A;  2B95 A;  2VK3 A;  1K0K A;  5EVE A;  5EM1 A;  2ZL1 B;  5EV0 A;  3CPT B;  1SZV A;  2V8C A;  3T1S A;  1AWI A;  1D1J A;  1CQA A;  3KYE A;  1ACF A;  5EM0 A;  4D60 A;  4X1M A;  2E8J A;  3UB5 P;  1VET B;  2JKF A;  4X1L A;  3CHW P;  4QWO A;  3NUL A;  1F2K A;  3NEC A;  2ACG A;  1HLU P;  1CF0 A;  1VEU A;  4ESP A;  2PAV P;  3U4L P;  1PFL A;  1G5U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...