3DAVA

Schizosaccharomyces pombe profilin crystallized from sodium formate
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
126
structure length
126
Chain Sequence
SWQAYVDTSLLGTGKIDRAAIVSRAGDSVWAASAGFNLSPQEIQGLAAGFQDPPSMFGTGIILAGQKYITIRAEGRSIYGKLQKEGIICVATKLCILVSHYPETTLPGEAAKITEALADYLVGVGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Profilin
publication title Incompatibility with Formin Cdc12p Prevents Human Profilin from Substituting for Fission Yeast Profilin: INSIGHTS FROM CRYSTAL STRUCTURES OF FISSION YEAST PROFILIN.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 36
structure length 126
sequence length 126
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00235 Profilin Profilin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 3davA00
3LEQA 5EM0A 4X1MA 4X25A 2B95A 1Z09A 3DAVA 3LGOA 1SKOA 1SZVA 2VK3A 5EV0A 1CF0A 3D9YA 1K0KA 3T1QB 5EVEA 3CPTB 1SKOB 3UB5P 3CHWP 3NECA 1HLUP 1CQAA 2ZL1B 3L7HA 2PAVP 3MSHA 3CPTA 4FUWA 3KYEA 2PRFA 2HZ5A 5FDSA 1CJFA 2ZL1A 1J3WA 1A0KA 5FEFA 4D60A 3T1SA 3U4LP 1ACFA 1PFLA 1Y4OA 1FILA 1FIKA 3MS6A 2V8CA 4X1LA 5EM1A 3T1XA 5FEGA 3T12B 2JKFA 1PNEA 1VEUB 2PBDP 1VETA 2ACGA 4FTXA 3L9KA 1AWIA 3NULA 1VEUA 1VETB 1PRQA 3T1RA 1YPRA 2JKGA 4QWOA 2V8FA 1D1JA 4ESPA 2E8JA 2BTFP 1G5UA 1F2KA
chains in the Genus database with same CATH superfamily
3LEQA 4BMWA 3HLEA 4JGRA 3T50A 2Y2NA 3QNBA 2OWHA 4K0WA 2L4RA 4QU3A 4FD8A 4KUOA 3D72A 2VA0A 3LY3A 3MQQA 1V9ZA 2W1TA 4IJGA 3M6HA 1Y54A 3QP6A 3RFBA 5IT5A 1S67L 2V1AA 1WYCA 5KIZA 4I3JA 3G31A 3UE3A 4FUWA 4E3MA 4HY8A 1H3QA 3OOVA 5GLBA 1PIOA 4Q8IA 4WF0A 3MZEA 3NHQA 1FCMA 3HLDA 1S4SA 1CK3A 2VGKA 2XA7M 2B02A 3G32A 3LI8A 3NIAA 4EBLA 4JGPA 1FIKA 1DP6A 2V8CA 2FZ0A 4YOFA 5G4ZA 1T1CA 3Q7VB 4P85A 1ALQA 2GZAA 4GKUA 1YLZA 2M7VA 3ZG7B 5MC7A 2WYXA 4U3TA 4MCWA 5HDSA 2O9AA 2ZOIA 2Y2JA 1T18A 1WYBA 4B9OA 2W3FA 1D1JA 1LI9A 3V3SA 3CI6A 4ARZA 3CMZA 1XA7A 5AQBA 3E4OA 4QY6A 1OJGA 2K31A 4WMCD 5FDHA 2M1CA 4A5RA 1XGJA 3IF6C 1FCNA 2EX6A 2Y59A 3BY9A 2HDQA 5CGWA 1LLBA 3IF6B 2H28A 3SOIA 1JTGA 4R3BA 3OLOA 3JVUA 4P6BA 5AQ7A 2H0TA 3S7NA 4DDSA 4II7A 2Y2KA 4HBUA 3UB5P 2Z6CA 1ZG6A 3BEBA 5HWVA 3C2WA 1SDNA 4JPMA 3ZG8B 4R38A 4BD1A 4JXGA 4ID4A 3UE6A 4LV0A 1BSGA 4LCMA 1A0KA 3LICA 1ACFA 5F1FA 4MN5A 4R1GA 2PT7A 2WKHA 1MKMA 1KOUA 4X56A 1EW0A 1I5QA 1IYSA 5E2FA 3ZFZA 5HWWA 1CI9A 3LR3A 4HP4A 4EBNA 3OPLA 4LRYC 3FV7A 3H82A 1KVMA 5CECA 4QJGA 3OPRA 1MWRA 2V1BA 4XT2B 3JYIA 4E3JA 2HDSA 3A0VA 4FTXA 4OOYA 3C5AA 4MN6A 3FC7A 3MQ0A 2W1RA 3CAXA 4IVKA 1YMSA 1GHIA 1KDWA 4JBFA 3UO9A 5J7EA 3PBQA 5AQAA 1PWDA 1ERMA 1S0WA 4Y0UA 1I2SA 3MZDA 4JLFA 1O07A 4N9LA 2ZLYA 3VFFA 1JVJA 2OSUA 4EETB 1XJ6A 4G3WA 4HJ3A 5TBMA 3A0RA 3KO6A 3C8CA 1GSWA 2O99A 1YT4A 4GD8A 5F82A 1SKOB 2WKRA 4EXOA 3T4LA 4YWZA 3LEZA 3Q82A 4P6ZM 4KZ4A 3T4KA 1CI8A 3BQ8A 4WMCA 3QP5A 4DE1A 3DWKA 5FDSA 4DRTA 3PBNA 2MJ6A 1YLWA 3UE0A 1IKGA 5GL9A 1E4DA 3EWKA 3IXGA 2VZWA 4KZ6A 1SDEA 3VP1A 4HOIA 4OPRA 2IWCA 4G3KA 4LV2A 5DJTA 2XEPA 3HJKA 4WELA 3TSGA 2JKRI 2ZBBA 4R0QA 4NEED 4Z1WA 1OTBA 4UA6A 2DMWA 5F1GA 1S1ZA 1S66L 1DJBA 1YSPA 1NZUA 4Q0JA 2D01A 3BY8A 5HAQA 5FI6A 3VP4A 2UWXA 2XD1A 2G2WA 5L8MA 4UA9A 2WKPA 1SKOA 3N8LA 4ETXA 2B5RA 5J8XA 3PAEA 3VMAA 5HD5A 4O8GA 5EVEA 4OPYA 4YINA 5CEDA 3IBRA 3LI9A 3T4OA 3M2KA 5TFQA 5EOOA 4DMZA 2V9AA 2I9VA 5JYOA 4Y13A 2PAVP 3EEAA 2HF6A 4EESA 4GZBA 2Y91A 4LLOB 5LBRA 4OH0A 1Z6FA 3RJUA 3VP3A 1K38A 3IBJA 3LY4A 5L10A 3UNWA 3U4LP 4DF6A 4M3KA 1XFNA 3NDEA 1TDLA 1TS8A 4HIAA 5IS1A 5FA7A 2J3TC 4UA7A 2Q0OA 1PW1A 4DE0A 3JVVA 1NLZA 5AVFA 3BECA 4OOLA 3IWOA 4WUJA 3D4FA 1EI5A 2JN7A 2VEAA 4KZBA 3SS5A 3T4JA 1TD5A 4NXFA 3FPWA 4CLCC 3BLSA 4C75A 3LFVA 2PD8A 3MZFA 4G3VA 3PHYA 4CLCB 3C38A 2X01A 3T1RA 2O0YA 3K2NA 3MXQA 1OT6A 3DBAA 3QP4A 3C4OA 4IUHA 2FH5A 3MMHA 4KG2A 3VP2A 2VGLS 5AVEA 3S7PA 1NRJA 1L3LA 5CEBA 4OQHA 4RVAA 3ULFA 5HPFA 3A3FA 4X68A 1BLPA 3M6BA 4GD6A 4MEZA 4ZDXA 1KE4A 4NG2A 4S2JA 1KGFA 3U2AA 2HP9A 3BM6A 3UPPA 1G6OA 4L9EA 1H8YA 4B4XA 4S2IA 2VJWA 4HNBA 1KDSA 2WADA 3C7VA 2PBYA 1STZA 2ZL1A 1LSXA 3FG8A 2QYBA 4R3AA 4O01A 1PFLA 1K57C 1L2SA 4PM5A 4F3LA 2H10A 5DF8A 1K6RA 3ZDJA 2CC1A 4CLCE 1PI4A 2ZJ9A 4O0PA 4RX3A 3T4SA 5GHXA 2ZQ9A 1RCJA 5IHVA 2XQZA 5FQJA 4P0MA 4KQOA 3B42A 4IBRA 1BLSA 5F68A 3IX8A 2H0YA 1JWPA 2PYRA 1S4RA 1VETB 1PRQA 4E6WA 4WBGA 1K54C 3V3RA 3G2YA 1HD8A 1YLYA 2IWBA 3OPHA 3WRTA 4HQAA 3O5YA 5D3OA 2A2LA 4FCFA 1Y28A 2E8IA 5HSQA 4WL9A 4X53A 5EV0A 1CEFA 4BWIA 5GLCA 3UB6A 3FPVA 5CTNA 5L09A 1NWZA 1T1AA 2ZC3B 1UGUA 2HPBA 5DTTA 3IT9A 1KGEA 3CPTB 1XPBA 1BT5A 3PYPA 2NUPC 1W63Q 1LHYA 2JE5A 3NDGA 1CQAA 5KZHA 2KX6A 2Q9MA 1G68A 1K6SA 1HVBA 4KZ3A 1L0FA 1BULA 3DTKA 2QZ6A 1FR6A 3GSGA 3WS5A 1K57A 3T1SA 5AQ9A 1DP8A 3P98A 5EE8A 5HL6A 1LI0A 4OQGA 3MS6A 2WKQA 3ZYTA 4EUZA 2Y2GA 5U47A 4HJ6A 1LL9A 3SS4A 4IUKA 4I3IA 2XD5A 4PAUA 4EQIA 3UMDA 2W0NA 4Y7PA 1VEUB 5HWTA 4GHIA 1VETA 3F1PB 4OPZA 4KZAA 1RGYA 1K56D 3AGDA 2WKEA 4E3NA 3RXWA 4GNUA 4QWOA 1FQGA 1YM1A 1K55C 3C30A 5DF9A 2KDKA 2Y2MA 1PZPA 4PM6A 2BTFP 4MBFA 5E43A 4GN2A 1VQQA 2XFTA 5FSRA 1EROA 3LGOA 5DKLA 1H5XA 3GMWA 1V9YA 3D9YA 1VHMA 1GHMA 3TW8A 2V0WA 2XSSA 3DW0A 4KZ8A 3H7WB 4KG5A 5EECA 3HLGA 2J9PA 3VFHA 3H9WA 3LR5A 4BJPA 2VGLM 3O88A 1NY0A 5GLAA 5DFXA 4PKYG 1GCEA 4JGQA 2OWJA 2V0UA 2O9CA 3LIFA 1W8YA 3BJNA 4D60A 2QKPA 4N1HA 4R4SA 3KYQA 4NXGA 3DTEA 4JXSA 5J4EA 3MQOA 4EEUA 1PW8A 5C5KA 1PWCA 2XGNA 3KYZA 3MF0A 2PYPA 3GTCA 2LB9A 4RQ9A 3A3JA 3FKVA 4QY5A 4ZJ1A 4KQRA 2K2NA 2ZM0A 3Q7VA 2QHKA 4ZTKA 2W3DA 3LIEA 1Q2PA 3CITA 2Z6DA 4UQIM 3SH8A 5F6AA 1KGGA 2JKGA 3PTEA 3G6OA 3MBZA 5DVAA 3W4QA 1FSYA 2E8JA 3MXSA 4BENA 3UB8A 3F1OB 4PM7A 1OMEA 4B88A 2WK0A 4OOMA 4DE3A 2M7UA 2G2UA 1DRMA 3NC8A 1YAXA 5M1AA 2VK3A 4ZJ3A 2WGWB 3UDIA 4RX2A 5EVIC 2EX9A 4N92A 3TRCA 5EVIB 5AJGA 3IF6A 1ZKJA 3VE4A 2DNSA 4Q0IA 3ZNYA 1HLUP 4E6XA 2XROA 2P7JA 3L7HA 3MSHA 2EFXA 2EXAA 2L0WA 4IVIA 2HZ5A 4K0XA 3F1NB 1W79A 1UWNX 3G2ZA 3PBTA 4LV3A 5GHZA 1ZC2A 2ZQCA 4LCLA 3K3DA 5FQIA 1NZOA 3R4KA 1P97A 4OPQA 3MKEA 4BBVA 4DDYA 4LRXC 4X1LA 1N4OA 3BWLA 2WGVA 4I38A 2OV5A 4CQHA 2I72A 2RCXA 2XK1A 4CPKA 4KZ9A 4S2KA 4FH2A 2VX8A 5FQQA 3CWFA 3UMEA 2Y79A 2BG1A 2GDNA 1S1YA 4GOGA 1JWZA 4PHTA 1MPLA 5HZHA 5FQKA 5CGXA 4MBHA 4OLGA 4PPRA 4Y5FA 5I94A 2V1ZA 5CTMA 4BBTA 2D02A 1JTDA 1YPRA 4XT2A 1OPXA 2J3WA 4ESPA 2PR6A 3ZGAB 5EUAA 4WM9A 3ZG0A 2HV1A 2V20A 3S4XA 3OCLA 1W7FA 2XR0A 1DJCA 1NRFA 1N9LA 3RXXA 2LB5A 4IEDA 1Z09A 3LCEA 4R3JA 4LFUA 4MLLA 5DKKA 3N7WA 1PZOA 2XRNA 4NXBA 4E3IA 3BW6A 1IELA 5CHMA 2OOLA 5TR7A 2B18A 2H5SA 3A0SA 2C6WB 2QJ5A 3IH8A 3CLOA 4UAAA 4KZ7A 4ZAMA 3BYDA 3QP8A 3VP0A 2J3TD 3S7OA 1FSWA 5M18A 1XJ2A 3BFEA 1K25A 3M2JA 1MBLA 4H6JB 2ZQ8A 1CJFA 5J3WA 3FZCA 3LIDA 4U0XA 1NLYA 1SKFA 2IWDA 4HI4A 3B3XA 1XJ4A 1LL8A 2J80A 1JNUA 4CLCD 5HL1A 1OTDA 2P74A 5FEGA 1IFQA 4EQ1A 1K4FA 3IHBA 3KX0X 2JKFA 3B47A 4HH3A 2HJEA 4LRZE 4BL2A 3ITBA 2A24B 5HAIA 4L9GA 3RH8B 4N9KA 4P87A 3P01A 5IU1A 1E3UD 1MWUA 4GCZA 5FL3A 5KSCA 2W27A 2VV7A 4S2LA 1YMXA 2ZQDA 1QMFA 4FSFA 3T4QA 3B33A 4OVDA 5HW3A 4WZ5C 3FKWA 1LSWA 1GSXA 3OC2A 5HDDA 5DTSA 3V50A 1BZAA 3V5MA 3IX3A 4Z9QA 3Q1FA 5E2GA 4MN7A 4L9FA 1BTLA 3VOYA 4M4XA 2V2FF 3C7UA 1DJAA 3HBRA 1NYMA 4B93A 3K3CA 3KYEA 4FOFA 1FCOA 2BLSA 4OQ0A 2Y2OA 3A3IA 1YSQA 3UPOA 3HUNA 4EU0A 1YLPA 2XFSA 1FOFA 4K91A 5F69A 5EFWA 3ISGA 3T12B 2A24A 3V39A 2ZC4B 3R7WB 1KE0A 2JKRM 1ONHA 2JBFA 4DN0A 1NXYA 4KUKA 4GS9B 4C6YA 5FI2A 3MR0A 3E4PA 3UPNA 2Y8HA 3E2LA 4MDZA 3HVFA 2PU2A 3ZVTA 4LPZA 3SS3A 1QMEA 3BLMA 3SW1A 1MC0A 3IXHA 2R9XA 3N4IA 5JYPA 4CLCA 2KLIA 3EOIA 1ESIA 4R70A 3WS4A 2ZMAA 3CZDA 1C3BA 2W1TB 1L0DA 1OTEA 4EV4A 2HGVA 2WAEA 5FAQA 5FQ9A 1M40A 5FASA 1PYYA 3Q7ZA 1SCWA 1XP4A 2EX2A 3LUQA 5A90A 3CHWP 1WA9A 3GRJA 3IXBA 3UN7A 5K5BA 4KQQA 4MMNA 1E3UA 4EUVA 4S2PA 3N8SA 4OLDA 2G7UA 2HDUA 1ESUA 5GLDA 4I3AA 1AXBA 4GW9A 3UE1A 4ME4A 3Q07A 1BUEA 2VGJA 1MKIA 1N9NA 1BLCA 3G30A 1ES2A 2P9VB 1ZG4A 5M19A 5G18A 2NUTC 1H0MA 5F83A 4P6ZS 2Y2PA 5CX7A 4HJ4A 4EWFA 4ARZB 3W4OA 1RGZA 3NOTC 2VKSA 2PR5A 4MNRA 3MXRA 3KSIA 4BL3A 2OAP1 4C3QA 3BFGA 3LR4A 3VOLA 4QD4A 3OZHA 4PM8A 5DTKA 2PD7A 1G5UA 3BRMA 3ZNTA 5EM0A 4X25A 3WS2A 1EWZA 4Y17A 5F5YA 1K54A 4I39A 1W5DA 4HP9A 2HJ9C 2VV8A 4DXBA 3MJQA 5FI7A 3C4PA 4E3OA 1GSVA 4R23A 2QMIA 5EPHA 3DTMA 3DTIA 3BFDA 1W63M 3ZCZA 3ZG5A 4EW7A 3CPTA 3TOIA 4GDNA 1ODVA 3ZVWA 3GQZA 3SH7A 3W8KA 5CRFA 4OQIA 4YNRA 3EGXC 5FAOA 1J3WA 3T4TA 4NK3A 1N9OA 2IA2A 4NETA 3EQVA 3NI9A 2P9VA 4GB7A 1XA1A 1Y4OA 5DJUA 4JF5A 1FILA 1S6RA 2Q9NA 3GECA 3H82B 4EBPA 4DJ2A 4NXEA 4Y2FA 3QHYA 1N9BA 1TS0A 1MWTA 1SHVA 4JF4A 3I7JA 3T1XA 1BYWA 1IYOA 1K4EA 3VSLA 3P09A 5A8BA 5HPIA 4HBTA 1YLJA 2JCHA 3ZHHA 3WS0A 2J9OA 5L07A 3L9KA 2PHYA 1AWIA 5HD3A 2WKIA 3HUOA 4HEFA 4Q0HA 3P7NA 1VEUA 4ZBEA 3QP1A 4Y0OA 2EWWA 4Y3IA 4JGOA 4BQMA 3LYXA 3A3EA 3F1PA 3TE8A 4NKPA 4LGWA 2K7SA 5EVID 3ITAA 1IYQA 1DP9A 2VV6A 5TBMB 5KMWA 2Z2MB 3PBSA 5EOEA 2X02A 3PR6A 4DJ3A 4QB8A 2HDRA 2HP5A 1F98A 2B95A 2Z2LB 2EWVA 3LR0A 3UDXA 1UWPX 3DAVA 4JXVA 2ZM2A 4S2MA 1SZVA 1K55A 3HCYA 1E25A 2J7VA 5I5LA 2UV0E 3NOPC 2BASA 3D3OA 2GNXA 1J9MA 2JKTM 3WS1A 2P04A 3QP2A 4PKYA 3EEHA 4WEJA 3NECA 3OBFA 2DRWA 1ONGA 1XJ3A 4WYYA 3IS2B 3EQUA 3O87A 1ES5A 1GHPA 1OTIA 5CHJA 3CG5A 1D7EA 5E2HA 4KZ5A 3H7WA 4CJNA 1IOUA 1VB6A 4D2OA 3IX4A 1K56A 2QPNA 2R78A 1Q2QA 1NJ4A 3PXPA 3NJAA 3BFCA 2C5WB 3N6IA 2Y2HA 4QHCA 2XDMA 2ZD8A 4BLMA 3G34A 2J8YA 3KSFA 4RA7A 1T19A 1IKIA 3S22A 1PNEA 1OTAA 2R9WA 1TDGA 3BFFA 4PMAA 2ACGA 3TG9A 3BQAA 4E04A 2ZM8A 1KE3A 3UY6A 1XXMA 4WEKA 4ZRRA 5G4YA 1KVLA 2ZQAA 2FFYA 4RYEA 2HP6A 3SZTA 1YKDA 1OJ5A 2ZC7A 4HH2A 2WUQA 3CUEC 4DXCA 1ES3A 4X1MA 3UB9A 3IH9A 4I5SA 1LT0A 2FFFB 1O7EA 3Q81A 1PWGA 1PI5A 1U60A 4EERA 1RP5A 3F1OA 4OKPA 3FWLA 4XUZA 2JC7A 4LENA 1IYPA 3T1QB 2Y2LA 4AFIA 4U0TA 5FATA 3IS2A 4XUXA 4S2NC 1TVFA 2W3EA 1P9WA 5BOHA 1W8QA 4XXRA 2WGWA 5CERA 3VSKA 3IHAA 4KENB 3IXDA 4Y15A 1D06A 2CMNA 5FAPA 1MXOA 5CXWA 3HJIA 3MFDA 5CGSA 5EVIA 4KG6A 3E2KA 1G6AA 1OT9A 3HLCA 3S7QA 3GVBA 2PU4A 5FEFA 3A3DA 2OLVA 5E2EA 3OCNA 3CJMA 5TJJA 5TGFA 2KOIA 3KSGA 3VV4A 4R4RA 4WN5A 1XGIA 4WZ4A 3G4PA 5A91A 4K08A 3F1NA 2EA9A 3E0YA 4R6LA 3DWZA 2OLUA 2WZZA 3ZQ5A 4GLQA 5GHYA 2PBDP 4E3LA 3HLWA 5CHUA 4JKTA 5DF7A 3HL9A 5KSHA 3CUEA 1F5MA 4X55A 4OONA 4B4ZA 1I2WA 3IF5A 5HARA 3GDIA 3LIBA 4GJ4A 1T1BA 1F2KA 2L1MA 3IWIA 3RTYA 1LSVA 4N1XA 1BLHA 3NCKA 4E3KA 1JWVA 1ZTUA 4JF6A 4BD0A 3G35A 4X69A 4WLAA 3VOZA 1MWSA 1L0EA 1ERQA 4OP5A 5A93A 2XA7S 1K0KA 4S2NA 3UDFA 3HLFA 1H8ZA 5HAPA 2EX8A 4LV1A 3AGEA 2ZQ7A 4EEPA 1HTZA 1G28A 1WE4A 2ZL1B 2INWA 3AGFA 4Y0TA 1P0ZA 4MBKA 2PRFA 2XF3A 3EGDC 4F94A 4F3LB 3PBRA 2JHEA 3WRZA 3FYZA 1TF1A 1TS7A 3LO7A 4X6TA 2P08A 4YFMA 2DCFA 2PDRA 3ZG9B 5A92A 4IBXA 3GV9A 4H6JA 3S1YA 2QJ7A 3E4QA 3NBLA 5EM1A 2ZMVA 4JXWA 4H8RA 1FR1A 4ETZA 2WGIA 3OPPA 3UB7A 3JPUA 4FH4A 4QPRA 5FQMA 4DKIA 2X71A 1P9RA 5L2FA 2YKHA 3E98A 3NULA 2EFUA 3SH9A 3V67A 1IEMA 1ZHHB 1TS6A 4UHUA 3WWXA 2V8FA 3NY4A 4PM9A 2W3HA 5DFYA 3N8RA 2ZMFA 4DE2A 2OAQ1 4GDBA 2Y55A 1DY6A 1HZOA 2WAFA 1CF0A 1H8MA 4OP8A 5HDCA 5EVLA 4UEYA 3PBOA 2XLNA 2GJ3A 3O3VA 4WZ5A 2EXBA 2A49A 3TJZC 4BBUA 3IWQA 3LIAA 1MZUA 4UQIS 4S2OA 2Y2QA 1XX2A 4HESA 2ZC6B 1LL5A 2WZXA 1XFQA 4ZJ2A 2XH9A 3O86A 2W3GA 1CEGA 4HHDA 1X0OA 1GA9A 3PAGA 3HLBA 3IQAA 2YKFA 1M6KA 2GX5A 4IHQA 4GHIB 5HFOA 1NYYA 4O7DA 3GR2A 3KSHA 1YQSA 2AVXA 5HX9A 4KQDA 2QWSA 3MFXA 3MKFA 3QNCA 1XKZA 2RL3A 3ICYA 3HUMA 3W4PA 2ZOHA 1L0GA 1YLTA 3W2ZA 1GA0A 3R7WA 2VLGA 1F9IA 2Y2IA 2Y4AA 4GS9A 2O9BA 3VE3A 1TEMA 3HREA 2A3UA 2ZC5B 3NOUC 4L0LA 2JKTI 1ES4A 1VM1A 1MY8A
chains in the Genus database with same CATH topology
3LEQA 5EM0A 4X1MA 4X25A 2B95A 1Z09A 3DAVA 3LGOA 1SKOA 1SZVA 2VK3A 5EV0A 1CF0A 3D9YA 1K0KA 3T1QB 5EVEA 3CPTB 1SKOB 3UB5P 3CHWP 3NECA 1HLUP 1CQAA 2ZL1B 3L7HA 2PAVP 3MSHA 3CPTA 4FUWA 3KYEA 2PRFA 2HZ5A 5FDSA 1CJFA 2ZL1A 1J3WA 1A0KA 5FEFA 4D60A 3T1SA 3U4LP 1ACFA 1PFLA 1Y4OA 1FILA 1FIKA 3MS6A 2V8CA 4X1LA 5EM1A 3T1XA 5FEGA 3T12B 2JKFA 1PNEA 1VEUB 2PBDP 1VETA 2ACGA 4FTXA 3L9KA 1AWIA 3NULA 1VEUA 1VETB 1PRQA 3T1RA 1YPRA 2JKGA 4QWOA 2V8FA 1D1JA 4ESPA 2E8JA 2BTFP 1G5UA 1F2KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LEQ A;  5EM0 A;  4X1M A;  4X25 A;  2B95 A;  1Z09 A;  3DAV A;  3LGO A;  1SKO A;  1SZV A;  2VK3 A;  5EV0 A;  1CF0 A;  3D9Y A;  1K0K A;  3T1Q B;  5EVE A;  3CPT B;  1SKO B;  3UB5 P;  3CHW P;  3NEC A;  1HLU P;  1CQA A;  2ZL1 B;  3L7H A;  2PAV P;  3MSH A;  3CPT A;  4FUW A;  3KYE A;  2PRF A;  2HZ5 A;  5FDS A;  1CJF A;  2ZL1 A;  1J3W A;  1A0K A;  5FEF A;  4D60 A;  3T1S A;  3U4L P;  1ACF A;  1PFL A;  1Y4O A;  1FIL A;  1FIK A;  3MS6 A;  2V8C A;  4X1L A;  5EM1 A;  3T1X A;  5FEG A;  3T12 B;  2JKF A;  1PNE A;  1VEU B;  2PBD P;  1VET A;  2ACG A;  4FTX A;  3L9K A;  1AWI A;  3NUL A;  1VEU A;  1VET B;  1PRQ A;  3T1R A;  1YPR A;  2JKG A;  4QWO A;  2V8F A;  1D1J A;  4ESP A;  2E8J A;  2BTF P;  1G5U A;  1F2K A; 
#chains in the Genus database with same CATH topology
 3LEQ A;  4BMW A;  3HLE A;  4JGR A;  3T50 A;  2Y2N A;  3QNB A;  2OWH A;  4K0W A;  2L4R A;  4QU3 A;  4FD8 A;  4KUO A;  3D72 A;  2VA0 A;  3LY3 A;  3MQQ A;  1V9Z A;  2W1T A;  4IJG A;  3M6H A;  1Y54 A;  3QP6 A;  3RFB A;  5IT5 A;  1S67 L;  2V1A A;  1WYC A;  5KIZ A;  4I3J A;  3G31 A;  3UE3 A;  4FUW A;  4E3M A;  4HY8 A;  1H3Q A;  3OOV A;  5GLB A;  1PIO A;  4Q8I A;  4WF0 A;  3MZE A;  3NHQ A;  1FCM A;  3HLD A;  1S4S A;  1CK3 A;  2VGK A;  2XA7 M;  2B02 A;  3G32 A;  3LI8 A;  3NIA A;  4EBL A;  4JGP A;  1FIK A;  1DP6 A;  2V8C A;  2FZ0 A;  4YOF A;  5G4Z A;  1T1C A;  3Q7V B;  4P85 A;  1ALQ A;  2GZA A;  4GKU A;  1YLZ A;  2M7V A;  3ZG7 B;  5MC7 A;  2WYX A;  4U3T A;  4MCW A;  5HDS A;  2O9A A;  2ZOI A;  2Y2J A;  1T18 A;  1WYB A;  4B9O A;  2W3F A;  1D1J A;  1LI9 A;  3V3S A;  3CI6 A;  4ARZ A;  3CMZ A;  1XA7 A;  5AQB A;  3E4O A;  4QY6 A;  1OJG A;  2K31 A;  4WMC D;  5FDH A;  2M1C A;  4A5R A;  1XGJ A;  3IF6 C;  1FCN A;  2EX6 A;  2Y59 A;  3BY9 A;  2HDQ A;  5CGW A;  1LLB A;  3IF6 B;  2H28 A;  3SOI A;  1JTG A;  4R3B A;  3OLO A;  3JVU A;  4P6B A;  5AQ7 A;  2H0T A;  3S7N A;  4DDS A;  4II7 A;  2Y2K A;  4HBU A;  3UB5 P;  2Z6C A;  1ZG6 A;  3BEB A;  5HWV A;  3C2W A;  1SDN A;  4JPM A;  3ZG8 B;  4R38 A;  4BD1 A;  4JXG A;  4ID4 A;  3UE6 A;  4LV0 A;  1BSG A;  4LCM A;  1A0K A;  3LIC A;  1ACF A;  5F1F A;  4MN5 A;  4R1G A;  2PT7 A;  2WKH A;  1MKM A;  1KOU A;  4X56 A;  1EW0 A;  1I5Q A;  1IYS A;  5E2F A;  3ZFZ A;  5HWW A;  1CI9 A;  3LR3 A;  4HP4 A;  4EBN A;  3OPL A;  4LRY C;  3FV7 A;  3H82 A;  1KVM A;  5CEC A;  4QJG A;  3OPR A;  1MWR A;  2V1B A;  4XT2 B;  3JYI A;  4E3J A;  2HDS A;  3A0V A;  4FTX A;  4OOY A;  3C5A A;  4MN6 A;  3FC7 A;  3MQ0 A;  2W1R A;  3CAX A;  4IVK A;  1YMS A;  1GHI A;  1KDW A;  4JBF A;  3UO9 A;  5J7E A;  3PBQ A;  5AQA A;  1PWD A;  1ERM A;  1S0W A;  4Y0U A;  1I2S A;  3MZD A;  4JLF A;  1O07 A;  4N9L A;  2ZLY A;  3VFF A;  1JVJ A;  2OSU A;  4EET B;  1XJ6 A;  4G3W A;  4HJ3 A;  5TBM A;  3A0R A;  3KO6 A;  3C8C A;  1GSW A;  2O99 A;  1YT4 A;  4GD8 A;  5F82 A;  1SKO B;  2WKR A;  4EXO A;  3T4L A;  4YWZ A;  3LEZ A;  3Q82 A;  4P6Z M;  4KZ4 A;  3T4K A;  1CI8 A;  3BQ8 A;  4WMC A;  3QP5 A;  4DE1 A;  3DWK A;  5FDS A;  4DRT A;  3PBN A;  2MJ6 A;  1YLW A;  3UE0 A;  1IKG A;  5GL9 A;  1E4D A;  3EWK A;  3IXG A;  2VZW A;  4KZ6 A;  1SDE A;  3VP1 A;  4HOI A;  4OPR A;  2IWC A;  4G3K A;  4LV2 A;  5DJT A;  2XEP A;  3HJK A;  4WEL A;  3TSG A;  2JKR I;  2ZBB A;  4R0Q A;  4NEE D;  4Z1W A;  1OTB A;  4UA6 A;  2DMW A;  5F1G A;  1S1Z A;  1S66 L;  1DJB A;  1YSP A;  1NZU A;  4Q0J A;  2D01 A;  3BY8 A;  5HAQ A;  5FI6 A;  3VP4 A;  2UWX A;  2XD1 A;  2G2W A;  5L8M A;  4UA9 A;  2WKP A;  1SKO A;  3N8L A;  4ETX A;  2B5R A;  5J8X A;  3PAE A;  3VMA A;  5HD5 A;  4O8G A;  5EVE A;  4OPY A;  4YIN A;  5CED A;  3IBR A;  3LI9 A;  3T4O A;  3M2K A;  5TFQ A;  5EOO A;  4DMZ A;  2V9A A;  2I9V A;  5JYO A;  4Y13 A;  2PAV P;  3EEA A;  2HF6 A;  4EES A;  4GZB A;  2Y91 A;  4LLO B;  5LBR A;  4OH0 A;  1Z6F A;  3RJU A;  3VP3 A;  1K38 A;  3IBJ A;  3LY4 A;  5L10 A;  3UNW A;  3U4L P;  4DF6 A;  4M3K A;  1XFN A;  3NDE A;  1TDL A;  1TS8 A;  4HIA A;  5IS1 A;  5FA7 A;  2J3T C;  4UA7 A;  2Q0O A;  1PW1 A;  4DE0 A;  3JVV A;  1NLZ A;  5AVF A;  3BEC A;  4OOL A;  3IWO A;  4WUJ A;  3D4F A;  1EI5 A;  2JN7 A;  2VEA A;  4KZB A;  3SS5 A;  3T4J A;  1TD5 A;  4NXF A;  3FPW A;  4CLC C;  3BLS A;  4C75 A;  3LFV A;  2PD8 A;  3MZF A;  4G3V A;  3PHY A;  4CLC B;  3C38 A;  2X01 A;  3T1R A;  2O0Y A;  3K2N A;  3MXQ A;  1OT6 A;  3DBA A;  3QP4 A;  3C4O A;  4IUH A;  2FH5 A;  3MMH A;  4KG2 A;  3VP2 A;  2VGL S;  5AVE A;  3S7P A;  1NRJ A;  1L3L A;  5CEB A;  4OQH A;  4RVA A;  3ULF A;  5HPF A;  3A3F A;  4X68 A;  1BLP A;  3M6B A;  4GD6 A;  4MEZ A;  4ZDX A;  1KE4 A;  4NG2 A;  4S2J A;  1KGF A;  3U2A A;  2HP9 A;  3BM6 A;  3UPP A;  1G6O A;  4L9E A;  1H8Y A;  4B4X A;  4S2I A;  2VJW A;  4HNB A;  1KDS A;  2WAD A;  3C7V A;  2PBY A;  1STZ A;  2ZL1 A;  1LSX A;  3FG8 A;  2QYB A;  4R3A A;  4O01 A;  1PFL A;  1K57 C;  1L2S A;  4PM5 A;  4F3L A;  2H10 A;  5DF8 A;  1K6R A;  3ZDJ A;  2CC1 A;  4CLC E;  1PI4 A;  2ZJ9 A;  4O0P A;  4RX3 A;  3T4S A;  5GHX A;  2ZQ9 A;  1RCJ A;  5IHV A;  2XQZ A;  5FQJ A;  4P0M A;  4KQO A;  3B42 A;  4IBR A;  1BLS A;  5F68 A;  3IX8 A;  2H0Y A;  1JWP A;  2PYR A;  1S4R A;  1VET B;  1PRQ A;  4E6W A;  4WBG A;  1K54 C;  3V3R A;  3G2Y A;  1HD8 A;  1YLY A;  2IWB A;  3OPH A;  3WRT A;  4HQA A;  3O5Y A;  5D3O A;  2A2L A;  4FCF A;  1Y28 A;  2E8I A;  5HSQ A;  4WL9 A;  4X53 A;  5EV0 A;  1CEF A;  4BWI A;  5GLC A;  3UB6 A;  3FPV A;  5CTN A;  5L09 A;  1NWZ A;  1T1A A;  2ZC3 B;  1UGU A;  2HPB A;  5DTT A;  3IT9 A;  1KGE A;  3CPT B;  1XPB A;  1BT5 A;  3PYP A;  2NUP C;  1W63 Q;  1LHY A;  2JE5 A;  3NDG A;  1CQA A;  5KZH A;  2KX6 A;  2Q9M A;  1G68 A;  1K6S A;  1HVB A;  4KZ3 A;  1L0F A;  1BUL A;  3DTK A;  2QZ6 A;  1FR6 A;  3GSG A;  3WS5 A;  1K57 A;  3T1S A;  5AQ9 A;  1DP8 A;  3P98 A;  5EE8 A;  5HL6 A;  1LI0 A;  4OQG A;  3MS6 A;  2WKQ A;  3ZYT A;  4EUZ A;  2Y2G A;  5U47 A;  4HJ6 A;  1LL9 A;  3SS4 A;  4IUK A;  4I3I A;  2XD5 A;  4PAU A;  4EQI A;  3UMD A;  2W0N A;  4Y7P A;  1VEU B;  5HWT A;  4GHI A;  1VET A;  3F1P B;  4OPZ A;  4KZA A;  1RGY A;  1K56 D;  3AGD A;  2WKE A;  4E3N A;  3RXW A;  4GNU A;  4QWO A;  1FQG A;  1YM1 A;  1K55 C;  3C30 A;  5DF9 A;  2KDK A;  2Y2M A;  1PZP A;  4PM6 A;  2BTF P;  4MBF A;  5E43 A;  4GN2 A;  1VQQ A;  2XFT A;  5FSR A;  1ERO A;  3LGO A;  5DKL A;  1H5X A;  3GMW A;  1V9Y A;  3D9Y A;  1VHM A;  1GHM A;  3TW8 A;  2V0W A;  2XSS A;  3DW0 A;  4KZ8 A;  3H7W B;  4KG5 A;  5EEC A;  3HLG A;  2J9P A;  3VFH A;  3H9W A;  3LR5 A;  4BJP A;  2VGL M;  3O88 A;  1NY0 A;  5GLA A;  5DFX A;  4PKY G;  1GCE A;  4JGQ A;  2OWJ A;  2V0U A;  2O9C A;  3LIF A;  1W8Y A;  3BJN A;  4D60 A;  2QKP A;  4N1H A;  4R4S A;  3KYQ A;  4NXG A;  3DTE A;  4JXS A;  5J4E A;  3MQO A;  4EEU A;  1PW8 A;  5C5K A;  1PWC A;  2XGN A;  3KYZ A;  3MF0 A;  2PYP A;  3GTC A;  2LB9 A;  4RQ9 A;  3A3J A;  3FKV A;  4QY5 A;  4ZJ1 A;  4KQR A;  2K2N A;  2ZM0 A;  3Q7V A;  2QHK A;  4ZTK A;  2W3D A;  3LIE A;  1Q2P A;  3CIT A;  2Z6D A;  4UQI M;  3SH8 A;  5F6A A;  1KGG A;  2JKG A;  3PTE A;  3G6O A;  3MBZ A;  5DVA A;  3W4Q A;  1FSY A;  2E8J A;  3MXS A;  4BEN A;  3UB8 A;  3F1O B;  4PM7 A;  1OME A;  4B88 A;  2WK0 A;  4OOM A;  4DE3 A;  2M7U A;  2G2U A;  1DRM A;  3NC8 A;  1YAX A;  5M1A A;  2VK3 A;  4ZJ3 A;  2WGW B;  3UDI A;  4RX2 A;  5EVI C;  2EX9 A;  4N92 A;  3TRC A;  5EVI B;  5AJG A;  3IF6 A;  1ZKJ A;  3VE4 A;  2DNS A;  4Q0I A;  3ZNY A;  1HLU P;  4E6X A;  2XRO A;  2P7J A;  3L7H A;  3MSH A;  2EFX A;  2EXA A;  2L0W A;  4IVI A;  2HZ5 A;  4K0X A;  3F1N B;  1W79 A;  1UWN X;  3G2Z A;  3PBT A;  4LV3 A;  5GHZ A;  1ZC2 A;  2ZQC A;  4LCL A;  3K3D A;  5FQI A;  1NZO A;  3R4K A;  1P97 A;  4OPQ A;  3MKE A;  4BBV A;  4DDY A;  4LRX C;  4X1L A;  1N4O A;  3BWL A;  2WGV A;  4I38 A;  2OV5 A;  4CQH A;  2I72 A;  2RCX A;  2XK1 A;  4CPK A;  4KZ9 A;  4S2K A;  4FH2 A;  2VX8 A;  5FQQ A;  3CWF A;  3UME A;  2Y79 A;  2BG1 A;  2GDN A;  1S1Y A;  4GOG A;  1JWZ A;  4PHT A;  1MPL A;  5HZH A;  5FQK A;  5CGX A;  4MBH A;  4OLG A;  4PPR A;  4Y5F A;  5I94 A;  2V1Z A;  5CTM A;  4BBT A;  2D02 A;  1JTD A;  1YPR A;  4XT2 A;  1OPX A;  2J3W A;  4ESP A;  2PR6 A;  3ZGA B;  5EUA A;  4WM9 A;  3ZG0 A;  2HV1 A;  2V20 A;  3S4X A;  3OCL A;  1W7F A;  2XR0 A;  1DJC A;  1NRF A;  1N9L A;  3RXX A;  2LB5 A;  4IED A;  1Z09 A;  3LCE A;  4R3J A;  4LFU A;  4MLL A;  5DKK A;  3N7W A;  1PZO A;  2XRN A;  4NXB A;  4E3I A;  3BW6 A;  1IEL A;  5CHM A;  2OOL A;  5TR7 A;  2B18 A;  2H5S A;  3A0S A;  2C6W B;  2QJ5 A;  3IH8 A;  3CLO A;  4UAA A;  4KZ7 A;  4ZAM A;  3BYD A;  3QP8 A;  3VP0 A;  2J3T D;  3S7O A;  1FSW A;  5M18 A;  1XJ2 A;  3BFE A;  1K25 A;  3M2J A;  1MBL A;  4H6J B;  2ZQ8 A;  1CJF A;  5J3W A;  3FZC A;  3LID A;  4U0X A;  1NLY A;  1SKF A;  2IWD A;  4HI4 A;  3B3X A;  1XJ4 A;  1LL8 A;  2J80 A;  1JNU A;  4CLC D;  5HL1 A;  1OTD A;  2P74 A;  5FEG A;  1IFQ A;  4EQ1 A;  1K4F A;  3IHB A;  3KX0 X;  2JKF A;  3B47 A;  4HH3 A;  2HJE A;  4LRZ E;  4BL2 A;  3ITB A;  2A24 B;  5HAI A;  4L9G A;  3RH8 B;  4N9K A;  4P87 A;  3P01 A;  5IU1 A;  1E3U D;  1MWU A;  4GCZ A;  5FL3 A;  5KSC A;  2W27 A;  2VV7 A;  4S2L A;  1YMX A;  2ZQD A;  1QMF A;  4FSF A;  3T4Q A;  3B33 A;  4OVD A;  5HW3 A;  4WZ5 C;  3FKW A;  1LSW A;  1GSX A;  3OC2 A;  5HDD A;  5DTS A;  3V50 A;  1BZA A;  3V5M A;  3IX3 A;  4Z9Q A;  3Q1F A;  5E2G A;  4MN7 A;  4L9F A;  1BTL A;  3VOY A;  4M4X A;  2V2F F;  3C7U A;  1DJA A;  3HBR A;  1NYM A;  4B93 A;  3K3C A;  3KYE A;  4FOF A;  1FCO A;  2BLS A;  4OQ0 A;  2Y2O A;  3A3I A;  1YSQ A;  3UPO A;  3HUN A;  4EU0 A;  1YLP A;  2XFS A;  1FOF A;  4K91 A;  5F69 A;  5EFW A;  3ISG A;  3T12 B;  2A24 A;  3V39 A;  2ZC4 B;  3R7W B;  1KE0 A;  2JKR M;  1ONH A;  2JBF A;  4DN0 A;  1NXY A;  4KUK A;  4GS9 B;  4C6Y A;  5FI2 A;  3MR0 A;  3E4P A;  3UPN A;  2Y8H A;  3E2L A;  4MDZ A;  3HVF A;  2PU2 A;  3ZVT A;  4LPZ A;  3SS3 A;  1QME A;  3BLM A;  3SW1 A;  1MC0 A;  3IXH A;  2R9X A;  3N4I A;  5JYP A;  4CLC A;  2KLI A;  3EOI A;  1ESI A;  4R70 A;  3WS4 A;  2ZMA A;  3CZD A;  1C3B A;  2W1T B;  1L0D A;  1OTE A;  4EV4 A;  2HGV A;  2WAE A;  5FAQ A;  5FQ9 A;  1M40 A;  5FAS A;  1PYY A;  3Q7Z A;  1SCW A;  1XP4 A;  2EX2 A;  3LUQ A;  5A90 A;  3CHW P;  1WA9 A;  3GRJ A;  3IXB A;  3UN7 A;  5K5B A;  4KQQ A;  4MMN A;  1E3U A;  4EUV A;  4S2P A;  3N8S A;  4OLD A;  2G7U A;  2HDU A;  1ESU A;  5GLD A;  4I3A A;  1AXB A;  4GW9 A;  3UE1 A;  4ME4 A;  3Q07 A;  1BUE A;  2VGJ A;  1MKI A;  1N9N A;  1BLC A;  3G30 A;  1ES2 A;  2P9V B;  1ZG4 A;  5M19 A;  5G18 A;  2NUT C;  1H0M A;  5F83 A;  4P6Z S;  2Y2P A;  5CX7 A;  4HJ4 A;  4EWF A;  4ARZ B;  3W4O A;  1RGZ A;  3NOT C;  2VKS A;  2PR5 A;  4MNR A;  3MXR A;  3KSI A;  4BL3 A;  2OAP 1;  4C3Q A;  3BFG A;  3LR4 A;  3VOL A;  4QD4 A;  3OZH A;  4PM8 A;  5DTK A;  2PD7 A;  1G5U A;  3BRM A;  3ZNT A;  5EM0 A;  4X25 A;  3WS2 A;  1EWZ A;  4Y17 A;  5F5Y A;  1K54 A;  4I39 A;  1W5D A;  4HP9 A;  2HJ9 C;  2VV8 A;  4DXB A;  3MJQ A;  5FI7 A;  3C4P A;  4E3O A;  1GSV A;  4R23 A;  2QMI A;  5EPH A;  3DTM A;  3DTI A;  3BFD A;  1W63 M;  3ZCZ A;  3ZG5 A;  4EW7 A;  3CPT A;  3TOI A;  4GDN A;  1ODV A;  3ZVW A;  3GQZ A;  3SH7 A;  3W8K A;  5CRF A;  4OQI A;  4YNR A;  3EGX C;  5FAO A;  1J3W A;  3T4T A;  4NK3 A;  1N9O A;  2IA2 A;  4NET A;  3EQV A;  3NI9 A;  2P9V A;  4GB7 A;  1XA1 A;  1Y4O A;  5DJU A;  4JF5 A;  1FIL A;  1S6R A;  2Q9N A;  3GEC A;  3H82 B;  4EBP A;  4DJ2 A;  4NXE A;  4Y2F A;  3QHY A;  1N9B A;  1TS0 A;  1MWT A;  1SHV A;  4JF4 A;  3I7J A;  3T1X A;  1BYW A;  1IYO A;  1K4E A;  3VSL A;  3P09 A;  5A8B A;  5HPI A;  4HBT A;  1YLJ A;  2JCH A;  3ZHH A;  3WS0 A;  2J9O A;  5L07 A;  3L9K A;  2PHY A;  1AWI A;  5HD3 A;  2WKI A;  3HUO A;  4HEF A;  4Q0H A;  3P7N A;  1VEU A;  4ZBE A;  3QP1 A;  4Y0O A;  2EWW A;  4Y3I A;  4JGO A;  4BQM A;  3LYX A;  3A3E A;  3F1P A;  3TE8 A;  4NKP A;  4LGW A;  2K7S A;  5EVI D;  3ITA A;  1IYQ A;  1DP9 A;  2VV6 A;  5TBM B;  5KMW A;  2Z2M B;  3PBS A;  5EOE A;  2X02 A;  3PR6 A;  4DJ3 A;  4QB8 A;  2HDR A;  2HP5 A;  1F98 A;  2B95 A;  2Z2L B;  2EWV A;  3LR0 A;  3UDX A;  1UWP X;  3DAV A;  4JXV A;  2ZM2 A;  4S2M A;  1SZV A;  1K55 A;  3HCY A;  1E25 A;  2J7V A;  5I5L A;  2UV0 E;  3NOP C;  2BAS A;  3D3O A;  2GNX A;  1J9M A;  2JKT M;  3WS1 A;  2P04 A;  3QP2 A;  4PKY A;  3EEH A;  4WEJ A;  3NEC A;  3OBF A;  2DRW A;  1ONG A;  1XJ3 A;  4WYY A;  3IS2 B;  3EQU A;  3O87 A;  1ES5 A;  1GHP A;  1OTI A;  5CHJ A;  3CG5 A;  1D7E A;  5E2H A;  4KZ5 A;  3H7W A;  4CJN A;  1IOU A;  1VB6 A;  4D2O A;  3IX4 A;  1K56 A;  2QPN A;  2R78 A;  1Q2Q A;  1NJ4 A;  3PXP A;  3NJA A;  3BFC A;  2C5W B;  3N6I A;  2Y2H A;  4QHC A;  2XDM A;  2ZD8 A;  4BLM A;  3G34 A;  2J8Y A;  3KSF A;  4RA7 A;  1T19 A;  1IKI A;  3S22 A;  1PNE A;  1OTA A;  2R9W A;  1TDG A;  3BFF A;  4PMA A;  2ACG A;  3TG9 A;  3BQA A;  4E04 A;  2ZM8 A;  1KE3 A;  3UY6 A;  1XXM A;  4WEK A;  4ZRR A;  5G4Y A;  1KVL A;  2ZQA A;  2FFY A;  4RYE A;  2HP6 A;  3SZT A;  1YKD A;  1OJ5 A;  2ZC7 A;  4HH2 A;  2WUQ A;  3CUE C;  4DXC A;  1ES3 A;  4X1M A;  3UB9 A;  3IH9 A;  4I5S A;  1LT0 A;  2FFF B;  1O7E A;  3Q81 A;  1PWG A;  1PI5 A;  1U60 A;  4EER A;  1RP5 A;  3F1O A;  4OKP A;  3FWL A;  4XUZ A;  2JC7 A;  4LEN A;  1IYP A;  3T1Q B;  2Y2L A;  4AFI A;  4U0T A;  5FAT A;  3IS2 A;  4XUX A;  4S2N C;  1TVF A;  2W3E A;  1P9W A;  5BOH A;  1W8Q A;  4XXR A;  2WGW A;  5CER A;  3VSK A;  3IHA A;  4KEN B;  3IXD A;  4Y15 A;  1D06 A;  2CMN A;  5FAP A;  1MXO A;  5CXW A;  3HJI A;  3MFD A;  5CGS A;  5EVI A;  4KG6 A;  3E2K A;  1G6A A;  1OT9 A;  3HLC A;  3S7Q A;  3GVB A;  2PU4 A;  5FEF A;  3A3D A;  2OLV A;  5E2E A;  3OCN A;  3CJM A;  5TJJ A;  5TGF A;  2KOI A;  3KSG A;  3VV4 A;  4R4R A;  4WN5 A;  1XGI A;  4WZ4 A;  3G4P A;  5A91 A;  4K08 A;  3F1N A;  2EA9 A;  3E0Y A;  4R6L A;  3DWZ A;  2OLU A;  2WZZ A;  3ZQ5 A;  4GLQ A;  5GHY A;  2PBD P;  4E3L A;  3HLW A;  5CHU A;  4JKT A;  5DF7 A;  3HL9 A;  5KSH A;  3CUE A;  1F5M A;  4X55 A;  4OON A;  4B4Z A;  1I2W A;  3IF5 A;  5HAR A;  3GDI A;  3LIB A;  4GJ4 A;  1T1B A;  1F2K A;  2L1M A;  3IWI A;  3RTY A;  1LSV A;  4N1X A;  1BLH A;  3NCK A;  4E3K A;  1JWV A;  1ZTU A;  4JF6 A;  4BD0 A;  3G35 A;  4X69 A;  4WLA A;  3VOZ A;  1MWS A;  1L0E A;  1ERQ A;  4OP5 A;  5A93 A;  2XA7 S;  1K0K A;  4S2N A;  3UDF A;  3HLF A;  1H8Z A;  5HAP A;  2EX8 A;  4LV1 A;  3AGE A;  2ZQ7 A;  4EEP A;  1HTZ A;  1G28 A;  1WE4 A;  2ZL1 B;  2INW A;  3AGF A;  4Y0T A;  1P0Z A;  4MBK A;  2PRF A;  2XF3 A;  3EGD C;  4F94 A;  4F3L B;  3PBR A;  2JHE A;  3WRZ A;  3FYZ A;  1TF1 A;  1TS7 A;  3LO7 A;  4X6T A;  2P08 A;  4YFM A;  2DCF A;  2PDR A;  3ZG9 B;  5A92 A;  4IBX A;  3GV9 A;  4H6J A;  3S1Y A;  2QJ7 A;  3E4Q A;  3NBL A;  5EM1 A;  2ZMV A;  4JXW A;  4H8R A;  1FR1 A;  4ETZ A;  2WGI A;  3OPP A;  3UB7 A;  3JPU A;  4FH4 A;  4QPR A;  5FQM A;  4DKI A;  2X71 A;  1P9R A;  5L2F A;  2YKH A;  3E98 A;  3NUL A;  2EFU A;  3SH9 A;  3V67 A;  1IEM A;  1ZHH B;  1TS6 A;  4UHU A;  3WWX A;  2V8F A;  3NY4 A;  4PM9 A;  2W3H A;  5DFY A;  3N8R A;  2ZMF A;  4DE2 A;  2OAQ 1;  4GDB A;  2Y55 A;  1DY6 A;  1HZO A;  2WAF A;  1CF0 A;  1H8M A;  4OP8 A;  5HDC A;  5EVL A;  4UEY A;  3PBO A;  2XLN A;  2GJ3 A;  3O3V A;  4WZ5 A;  2EXB A;  2A49 A;  3TJZ C;  4BBU A;  3IWQ A;  3LIA A;  1MZU A;  4UQI S;  4S2O A;  2Y2Q A;  1XX2 A;  4HES A;  2ZC6 B;  1LL5 A;  2WZX A;  1XFQ A;  4ZJ2 A;  2XH9 A;  3O86 A;  2W3G A;  1CEG A;  4HHD A;  1X0O A;  1GA9 A;  3PAG A;  3HLB A;  3IQA A;  2YKF A;  1M6K A;  2GX5 A;  4IHQ A;  4GHI B;  5HFO A;  1NYY A;  4O7D A;  3GR2 A;  3KSH A;  1YQS A;  2AVX A;  5HX9 A;  4KQD A;  2QWS A;  3MFX A;  3MKF A;  3QNC A;  1XKZ A;  2RL3 A;  3ICY A;  3HUM A;  3W4P A;  2ZOH A;  1L0G A;  1YLT A;  3W2Z A;  1GA0 A;  3R7W A;  2VLG A;  1F9I A;  2Y2I A;  2Y4A A;  4GS9 A;  2O9B A;  3VE3 A;  1TEM A;  3HRE A;  2A3U A;  2ZC5 B;  3NOU C;  4L0L A;  2JKT I;  1ES4 A;  1VM1 A;  1MY8 A; 
#chains in the Genus database with same CATH homology
 3LEQ A;  5EM0 A;  4X1M A;  4X25 A;  2B95 A;  1Z09 A;  3DAV A;  3LGO A;  1SKO A;  1SZV A;  2VK3 A;  5EV0 A;  1CF0 A;  3D9Y A;  1K0K A;  3T1Q B;  5EVE A;  3CPT B;  1SKO B;  3UB5 P;  3CHW P;  3NEC A;  1HLU P;  1CQA A;  2ZL1 B;  3L7H A;  2PAV P;  3MSH A;  3CPT A;  4FUW A;  3KYE A;  2PRF A;  2HZ5 A;  5FDS A;  1CJF A;  2ZL1 A;  1J3W A;  1A0K A;  5FEF A;  4D60 A;  3T1S A;  3U4L P;  1ACF A;  1PFL A;  1Y4O A;  1FIL A;  1FIK A;  3MS6 A;  2V8C A;  4X1L A;  5EM1 A;  3T1X A;  5FEG A;  3T12 B;  2JKF A;  1PNE A;  1VEU B;  2PBD P;  1VET A;  2ACG A;  4FTX A;  3L9K A;  1AWI A;  3NUL A;  1VEU A;  1VET B;  1PRQ A;  3T1R A;  1YPR A;  2JKG A;  4QWO A;  2V8F A;  1D1J A;  4ESP A;  2E8J A;  2BTF P;  1G5U A;  1F2K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...