4P6ZS

Crystal structure of the human bst2 cytoplasmic domain and the hiv-1 vpu cytoplasmic domain bound to the clathrin adaptor protein complex 1 (ap1) core
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
147
structure length
147
Chain Sequence
b'MMRFMLLFSRRGKLRLQKWYLATSDKERKKMVRELMQVVLARKPKMCSFLEWRDLKVVYKRYASLYFCCAIEGQDNELITLELIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLMGGDVQDTSKKSVLKAIEQADLLQEEDES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AP-1 complex subunit gamma-1
publication title Structural basis of HIV-1 Vpu-mediated BST2 antagonism via hijacking of the clathrin adaptor protein complex 1.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein transport
total genus 53
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2014-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01217 Clat_adaptor_s Clathrin adaptor complex small chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.60 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4p6zS00
1NRJA 2JKTI 2FH5A 2VGLS 2VGLM 4NEED 2HF6A 1W63M 2XA7S 2XA7M 2JKTM 2JKRI 2JKRM 5MC7A 4P6ZS 4P6ZM 1W63Q 4UQIS 4UQIM 3TJZC
chains in the Genus database with same CATH superfamily
2VX8A 3VMAA 1RCJA 3U4LP 3WS4A 2J8YA 5HD5A 4LLOB 4HNBA 3M6BA 4OPYA 2J3TC 2KLIA 1L2SA 1DP9A 3WS5A 4X69A 3CLOA 2Y2NA 3O87A 2WK0A 4GLQA 5AQBA 2I72A 4I3JA 1BYWA 4NG2A 4IUHA 2A2LA 4MCWA 5CHMA 1S6RA 1C3BA 4M3KA 5AVEA 1LL8A 4QD4A 1HD8A 3N8SA 1HTZA 3LUQA 2HZ5A 2XD1A 4DDSA 3LIDA 2XLNA 4KZ8A 4BD1A 3G31A 2EXBA 3D9YA 3TE8A 1N9NA 4JF6A 4AFIA 4FD8A 4IHQA 5HW3A 1FR1A 1IYQA 4OH0A 4O0PA 1PWGA 2XF3A 3QP4A 3UE0A 2XD5A 3KSFA 2ZM2A 4RX3A 3PBTA 1ZHHB 2DMWA 3C4OA 3OPHA 3QP8A 5HAIA 3BFCA 1ONGA 3I7JA 4YWZA 1IKGA 4X53A 3DTKA 3T4QA 3L9KA 2GX5A 1FILA 3C7VA 3ZQ5A 5HL6A 4S2JA 5JYOA 5DTTA 4DXBA 2HF6A 1TF1A 1YLWA 5HWVA 3GV9A 3HUOA 5G4ZA 3UB5P 3RH8B 1MBLA 3IBRA 2Y2MA 1SKOA 1YAXA 3CWFA 1VEUB 4ESPA 2Z2LB 4HOIA 4E3NA 3OCNA 1JVJA 2W3HA 4QY5A 1J9MA 1LI0A 1ODVA 5EVEA 3MFDA 3MZFA 1S0WA 4UA7A 3C8CA 2V1AA 3OC2A 3P09A 5HPIA 2EX9A 1FSYA 3UPOA 3BFGA 4KG2A 3EQVA 4NXEA 4R1GA 4DMZA 2Y8HA 2GNXA 3GSGA 2J9OA 3E2KA 1JTDA 4IBXA 2GZAA 3F1NB 3NOPC 2EX8A 2P7JA 3HVFA 5HFOA 5HWTA 5DJTA 4UAAA 1VETB 4GD8A 3NOUC 4F3LA 4UQIM 3ZGAB 4JGOA 4KQOA 4LV1A 3V3RA 5FEGA 2J7VA 4LFUA 1XJ4A 2JHEA 1MKMA 4WEJA 4YINA 1WYCA 3MR0A 3KSHA 3NOTC 4KZ5A 5CHJA 4GB7A 2JKRI 4K91A 1K25A 3OPLA 2PD8A 4NXBA 4ZBEA 3AGFA 1OT6A 1TD5A 1ZTUA 2L4RA 2HP5A 5J7EA 4HI4A 4DXCA 3TW8A 3FWLA 4EU0A 3LICA 4BBUA 2Y2LA 1ALQA 4PHTA 3UE1A 5A90A 2WAFA 3SZTA 1FCMA 1JWZA 2PR5A 3IWIA 3IWOA 1YM1A 4WLAA 3BM6A 2FH5A 2VGLS 1XX2A 3G2ZA 3T12B 3T1QB 1RGZA 1FQGA 2A3UA 5HAQA 1KDSA 1LL5A 4UEYA 3T1SA 3D72A 2ZMVA 2W3DA 4MEZA 3MZDA 4EXOA 1W7FA 5EVID 1EROA 3LR5A 2R9XA 4L9EA 2O0YA 2XR0A 2V1BA 3PHYA 1IOUA 4RVAA 1I2WA 3A3JA 4JXGA 3G35A 4O7DA 4ZDXA 4OQGA 4WZ5A 3RXWA 3G2YA 3CUEC 3ICYA 4HHDA 2O9CA 3WS2A 3ZCZA 1OMEA 3T50A 4O01A 4UHUA 3QP1A 5FDHA 4LRYC 4OQHA 5GHXA 3NULA 1S4SA 1TDGA 3HLGA 2V2FF 4H8RA 5AQ9A 3ITAA 3M2JA 3BWLA 3F1PA 3R7WA 5FEFA 5BOHA 3A0VA 4NXFA 5FQKA 4Q0IA 3IH9A 1OT9A 1Q2QA 2HV1A 3BFDA 3QNBA 2ACGA 2FFYA 4JPMA 3T4SA 3UE3A 1U60A 3LIEA 1XA7A 2JKGA 5EM1A 2J9PA 5F82A 4OQ0A 3F1OA 5E2FA 4B88A 3HCYA 3EGDC 4E04A 1DJBA 2GDNA 2ZQ9A 5E43A 1VQQA 1OTEA 2NUTC 2XDMA 4HIAA 1I2SA 5IS1A 2XRNA 4K0XA 4DE1A 3B42A 4EUZA 2KOIA 4C3QA 4K08A 5EVLA 5L2FA 2P04A 1Z09A 2Q9NA 4Y17A 4N1HA 3MXQA 3FPWA 2H0TA 2P9VA 4EWFA 2C5WB 3CUEA 3T4JA 3V67A 4UA6A 2OV5A 2I9VA 4OPZA 3ISGA 2Z6DA 2R9WA 2G2WA 2EFXA 2VLGA 2ZQCA 5CTNA 2H28A 4Q0JA 4JF5A 1L0EA 1NRJA 3FPVA 1ES3A 4DJ3A 4PM6A 3H7WA 3W4OA 5EVIC 3WS1A 3FC7A 4WEKA 2HGVA 4DF6A 5HZHA 1BLCA 5EE8A 2FZ0A 1NYMA 3ZG0A 2O99A 2UWXA 3LIFA 1XJ6A 4P6BA 3UDXA 4EERA 4BL3A 3GECA 5EM0A 2Q0OA 2Z2MB 3LEZA 5FAOA 3RFBA 3CMZA 5DTKA 3PR6A 3PYPA 3BQAA 3QP5A 5I5LA 2PBDP 1CEGA 3UB7A 2IWBA 1MPLA 3ZG8B 1O07A 2Y2JA 4NK3A 3FYZA 3HLBA 1MC0A 3VP3A 2E8JA 4Z1WA 1NY0A 1SZVA 3AGEA 5J8XA 5E2HA 1FCOA 3GQZA 3Q1FA 5HPFA 4E6XA 5J3WA 5KSCA 3S7QA 3NY4A 4LV2A 4JGPA 5MC7A 4GDNA 2OWJA 3UY6A 1E3UD 2ZM8A 2WUQA 3UMEA 2W1TB 1W8QA 2VV8A 3DBAA 4X55A 2XA7S 1RP5A 3IF5A 1K6SA 3BW6A 2ZL1B 4S2KA 3OPRA 4N1XA 4OQIA 3LO7A 4HJ3A 4UQIS 5EVIA 5HWWA 2ZQDA 1XJ2A 1IFQA 3KYZA 1SDNA 3BFFA 1VB6A 1RGYA 3LCEA 2D02A 1KOUA 3VSKA 2EX6A 1YLJA 4FH4A 4GCZA 1PZPA 5TBMA 3F1PB 3R7WB 1NLYA 1SHVA 4OONA 3SH7A 4KZBA 1IEMA 3TJZC 2K7SA 5DF7A 5HDCA 2PBYA 3BEBA 4WYYA 4IEDA 2WYXA 3HLDA 3QP2A 4FOFA 4YFMA 3ZG5A 1KE3A 1MWTA 2FFFB 1ESIA 3BY9A 3CPTB 1ZKJA 1PZOA 1NXYA 3F1OB 4R38A 4Y5FA 3SOIA 4EETB 2WAEA 1XKZA 1T1AA 2MJ6A 4MN5A 1K38A 3IX8A 5GLBA 4OVDA 5FI7A 4FTXA 2ZC3B 3E98A 1E4DA 2QJ5A 1IKIA 2JKRM 4PM5A 1OTBA 2YKFA 3IQAA 3A0RA 4D60A 2P9VB 2ZMFA 3FZCA 4C6YA 3KSGA 2JKTI 5D3OA 1NJ4A 2QYBA 1H8MA 1XFQA 4LV3A 4PAUA 4N9LA 3NCKA 2WGIA 1HVBA 4GHIA 4QU3A 2Y55A 3PBOA 4C75A 4WMCD 3O5YA 3GDIA 1XGIA 3MZEA 4GKUA 5AJGA 1K4FA 3E0YA 2WKQA 4BJPA 2ZC6B 4KZAA 4EV4A 2PDRA 3BRMA 4HJ6A 2E8IA 3OBFA 4S2MA 4EQ1A 4OP5A 5F5YA 4FH2A 1D1JA 4XUXA 4LGWA 4Y15A 1LT0A 4IVKA 5CGWA 2EWVA 4CLCD 3ZVTA 4X56A 4IBRA 2R78A 1K55C 3MF0A 2PD7A 5DKLA 4CJNA 3DAVA 2V0UA 1BZAA 5AVFA 5GLDA 3VE4A 4KZ7A 3ZYTA 5DJUA 4EBPA 3BLSA 2VEAA 4OLDA 1MZUA 1H5XA 1VM1A 3IF6C 1GSXA 4E3LA 1H8YA 2ZQAA 3P98A 5CEDA 5KZHA 3UMDA 3A3FA 4R70A 2WGVA 2KX6A 1L0FA 2V20A 3KYEA 4HY8A 1P9RA 4MBHA 2OSUA 3G34A 4PMAA 5DVAA 3IXHA 4GZBA 4Y2FA 5GL9A 2WGWB 4X1MA 4HEFA 4ETXA 1V9YA 3V50A 1BTLA 5CGXA 4X25A 3LIAA 3LI9A 4ZJ1A 4PKYA 5GHYA 1AWIA 4QPRA 1E3UA 4HH2A 4S2LA 4R4RA 1GSWA 3ZHHA 5EOEA 1BULA 2QPNA 2HP6A 3K2NA 5TBMB 1MXOA 4KZ4A 1Y28A 3TG9A 3NI9A 3JVVA 4JKTA 4KUOA 4BWIA 4ID4A 4K0WA 1UGUA 3LGOA 1OJ5A 5FQMA 4QWOA 1Q2PA 4U0TA 5M19A 3V3SA 3W4QA 2B5RA 1M40A 1XJ3A 5DTSA 2PT7A 3DWZA 4I3IA 4M4XA 4ARZB 1A0KA 3D4FA 4IVIA 2LB5A 4BD0A 1KVLA 5FL3A 3PXPA 2PYRA 2Y4AA 5DFYA 5L09A 1CI8A 4Q8IA 1FSWA 1TS8A 1K57C 4OPQA 1K54C 1MY8A 4BBTA 4B4ZA 4OPRA 2VK3A 2WKPA 4DE2A 3VOLA 2X02A 3EWKA 1XFNA 1UWPX 3UDIA 1KE4A 4BENA 4GHIB 4P0MA 4NEED 5FSRA 2K31A 4XXRA 4BMWA 4OOLA 3P01A 2CC1A 4D2OA 1YLTA 4PM9A 1FIKA 4EQIA 3OCLA 3IXDA 4KZ6A 1YSPA 1CF0A 1H0MA 3MFXA 2JBFA 2BLSA 5A8BA 3T4LA 3A3DA 4ZJ3A 1JWPA 3OLOA 3HL9A 2W1RA 4WMCA 1ACFA 2LB9A 4II7A 1YLZA 4QB8A 3RJUA 5CHUA 3CJMA 5F6AA 3Q7VA 1K57A 3N6IA 1G6OA 2OAP1 5EECA 1GHPA 1ERQA 2YKHA 3WS0A 2HDRA 1NLZA 2V1ZA 2Y2OA 3H82A 1LSWA 1SKOB 3NHQA 2WZZA 3QP6A 2HDSA 2QJ7A 4Z9QA 3VE3A 1N9OA 4H6JA 2Y2PA 1L0GA 1IYSA 2D01A 2JCHA 3MQQA 5FI2A 1LSVA 4JXSA 1BLHA 2OLVA 1LI9A 1ZG4A 3T4KA 4QY6A 4KG5A 4LCLA 3HJIA 3NDEA 3MXRA 1GA0A 2WKIA 2RL3A 1PWDA 3PAGA 2Y59A 5TR7A 3FKWA 1S4RA 2IA2A 5E2GA 2H10A 5L10A 2EWWA 3NBLA 3Q07A 3LFVA 1PIOA 3JYIA 4F3LB 5HX9A 4GNUA 3W4PA 3NDGA 3FKVA 1G6AA 4R23A 2WKHA 3BLMA 4WELA 3MXSA 4EBNA 1MKIA 1K4EA 2A24A 2VGKA 3C30A 2OWHA 3NC8A 3UDFA 2INWA 1DP6A 5G4YA 2DNSA 2JKTM 2WKRA 4KUKA 3V39A 5KMWA 1XGJA 3QNCA 3ZDJA 4JBFA 2VV7A 3LI8A 4HP4A 4ZJ2A 4JGRA 1GCEA 1N9BA 2PRFA 3IWQA 1M6KA 5CERA 4L0LA 4LCMA 3HBRA 3BYDA 3R4KA 5FQIA 3D3OA 3BJNA 2JC7A 1KE0A 1S1ZA 1DP8A 3K3CA 2XQZA 4R3AA 2Y2GA 4XUZA 4HJ4A 4HQAA 4Y7PA 5CECA 1DY6A 4XT2A 4CLCE 4MLLA 2XFSA 2Z6CA 5F1FA 5DF9A 2HJEA 1X0OA 3VP2A 1SCWA 4RQ9A 1H3QA 1T1BA 3KO6A 1TEMA 1ZG6A 2EX2A 2QZ6A 1IELA 5F68A 3QHYA 2W3EA 3IXGA 5E2EA 4CPKA 3GVBA 1STZA 3IS2A 4WBGA 3UPNA 4KENB 3UN7A 4S2PA 1QMEA 1QMFA 3S7PA 1MWUA 1GA9A 3PBRA 2ZQ8A 4BLMA 4WN5A 1K6RA 4GDBA 3IBJA 4NKPA 4E3OA 3B47A 4IUKA 1EW0A 4KZ9A 3UPPA 4OOYA 1D06A 2ZC7A 1VEUA 1LSXA 3SS4A 1ZC2A 2G2UA 4HBUA 2Y2IA 1TVFA 3IT9A 3JPUA 3LR3A 3LY4A 4GW9A 2JKFA 1SKFA 3C4PA 3H82B 3LYXA 4MN7A 4DRTA 2V9AA 5GHZA 2GJ3A 3HUMA 2OLUA 4KQQA 4H6JB 3NJAA 5C5KA 1OPXA 1V9ZA 3MSHA 3VSLA 1S66L 3S4XA 4F94A 4E3KA 2O9BA 1H8ZA 2H0YA 3F1NA 1JTGA 2JN7A 5I94A 5HL1A 1N9LA 1Z6FA 3VOYA 2KDKA 1VETA 1YT4A 2ZOHA 2XROA 4LENA 5F83A 5FASA 2V0WA 5FAQA 3BY8A 3EGXC 3SS3A 3C38A 1SDEA 3MKEA 3LEQA 3ZNYA 4G3WA 4PKYG 1UWNX 1DJAA 1PW8A 4S2NC 1PNEA 3E2LA 3E4OA 4Y13A 4Y0OA 2A24B 1KVMA 4KG6A 5TFQA 2ZD8A 3UB8A 2EA9A 4HP9A 3U2AA 3HJKA 5AQ7A 1CQAA 1K56D 3W2ZA 3H7WB 4LRXC 3LY3A 1G5UA 4YNRA 1CJFA 2XEPA 3DTMA 3GTCA 2HP9A 2RCXA 4OP8A 3S22A 3O88A 4E3MA 4PPRA 3A3EA 4P6ZM 2Q9MA 4U3TA 4X68A 3Q81A 3VP0A 5A91A 4IJGA 1CEFA 4E3JA 1Y54A 1YLPA 2OAQ1 3HLEA 1MWRA 4JGQA 3PBQA 2M7UA 4P87A 4N9KA 2BTFP 5F1GA 4XT2B 5CGSA 3ZFZA 1NRFA 2M7VA 3DW0A 1YQSA 3BQ8A 3WWXA 3OPPA 2VJWA 5DFXA 3MBZA 4PM7A 4S2OA 4HBTA 3TOIA 1IYOA 1N4OA 4Y0UA 4S2NA 3MS6A 1PI5A 3BECA 3VV4A 3G32A 1GSVA 4B93A 3IS2B 5HD3A 2Y2KA 4HESA 4U0XA 3L7HA 2P08A 2ZM0A 2DRWA 1F2KA 1TS0A 2HDUA 3AGDA 5EVIB 5DKKA 2PHYA 5TGFA 4GS9A 2XGNA 4R3BA 3UB6A 3FV7A 2ZQ7A 1ES5A 4EEPA 2W3FA 1G28A 3G6OA 1I5QA 1L0DA 3ZVWA 2WZXA 2EFUA 5FQJA 2H5SA 5FA7A 3ITBA 3VP1A 3SS5A 2ZLYA 1G68A 4L9GA 3RXXA 1GHMA 5FDSA 1PW1A 1PFLA 4Y3IA 1K55A 4KZ3A 1W63Q 1JWVA 1P9WA 3N8LA 1P97A 1Y4OA 2BASA 5FAPA 1XXMA 2XH9A 2XA7M 3S1YA 4EESA 3WRTA 1L3LA 4MMNA 2CMNA 3IF6A 4GD6A 4MBFA 1FCNA 3MQ0A 3BFEA 4MDZA 4WM9A 5G18A 3VFFA 4MN6A 4O8GA 1BSGA 1ES4A 1P0ZA 1E25A 1XPBA 3T1RA 1F98A 4WUJA 4WZ5C 3UO9A 5HARA 3EQUA 3MMHA 5CXWA 3CZDA 1TS7A 3LIBA 4RX2A 4CLCC 3GR2A 2WADA 1OTIA 1BLSA 2PU2A 2JE5A 1TS6A 4Q0HA 3PBNA 1CK3A 1MWSA 5TJJA 4FSFA 4ZTKA 4BBVA 5L8MA 3GRJA 3WRZA 4WZ4A 4Y0TA 1YMXA 4ZAMA 4JXWA 4I38A 4A5RA 2BG1A 4UA9A 5IHVA 3CI6A 3W8KA 3TRCA 2VV6A 5EUAA 2W0NA 2V8CA 3EOIA 4PM8A 3Q7ZA 2QHKA 4L9FA 5EFWA 4EUVA 4BL2A 1FR6A 4EBLA 3IHAA 3GMWA 4R0QA 1OTDA 4P85A 2J3WA 2K2NA 1WA9A 3T4OA 5FQ9A 2WKEA 4R4SA 3O86A 1KGGA 1KDWA 3A0SA 3VP4A 4X6TA 3MKFA 4DJ2A 4ETZA 4RA7A 1K56A 1W8YA 3N4IA 3TSGA 5GLAA 2XK1A 3Q82A 2XSSA 4OLGA 2HDQA 4DDYA 5J4EA 3KYQA 3SW1A 5IT5A 2XFTA 4KQRA 5F69A 2A49A 2W1TA 1K54A 4FUWA 4E6WA 3T1XA 4GOGA 2Y2HA 3IX4A 5HDSA 4ME4A 3G4PA 3RTYA 2ZL1A 4B4XA 3NECA 1LL9A 4HH3A 4CLCA 3ULFA 2VA0A 4GN2A 1W5DA 4OKPA 4YOFA 3ZG9B 3CHWP 2PU4A 1GHIA 3HLWA 3HREA 4MNRA 4ZRRA 3K3DA 1VHMA 4I3AA 1FOFA 1T1CA 4BQMA 1DJCA 1KGEA 3CITA 3O3VA 3LR4A 4GS9B 3DWKA 3N8RA 1EWZA 1T18A 2X01A 3MQOA 2VZWA 1LLBA 5HSQA 1KGFA 3IX3A 2PYPA 4N92A 5FQQA 3PAEA 5CTMA 2W27A 3IXBA 3DTEA 3CPTA 5M1AA 2L1MA 2OOLA 3P7NA 1NYYA 1YPRA 4RYEA 2IWCA 1S1YA 3NIAA 1CI9A 5A92A 1J3WA 1S67L 3S7OA 2ZC4B 1HZOA 1ESUA 3N7WA 4P6ZS 4DE0A 2ZOIA 4DN0A 4JF4A 1YMSA 4E3IA 1PYYA 1PI4A 3KSIA 3M6HA 5FATA 3C2WA 3HLCA 3IF6B 1LHYA 3SH9A 5AQAA 2QKPA 3UE6A 4GJ4A 2PAVP 3ZNTA 3C5AA 2O9AA 3HLFA 1JNUA 5HDDA 4KQDA 4QJGA 2IWDA 4MBKA 1ERMA 4R3JA 4OOMA 4G3VA 4B9OA 5LBRA 4JLFA 4JXVA 4WL9A 2P74A 1DRMA 5A93A 4I5SA 4S2IA 1HLUP 3MJQA 1PRQA 4NXGA 5FI6A 5EOOA 1YLYA 2ZC5B 3G30A 4LPZA 2G7UA 3E4PA 3VFHA 3PBSA 3LR0A 1IYPA 1D7EA 1YSQA 1BLPA 4EW7A 2AVXA 2J3TD 1O7EA 1TDLA 2NUPC 2B18A 3KX0X 1W63M 2Y2QA 1WE4A 1YKDA 1PWCA 2C6WB 3EEAA 1XP4A 5K5BA 4EEUA 2ZJ9A 2DCFA 2HJ9C 2VKSA 5CRFA 2ZMAA 4R6LA 5M18A 4LRZE 3CG5A 4NETA 4DE3A 3IHBA 3PTEA 5CEBA 2V8FA 3A3IA 3VOZA 2L0WA 2M1CA 3OOVA 2VGJA 4DKIA 3CAXA 3JVUA 5DF8A 2B95A 3HUNA 3C7UA 3M2KA 3B3XA 3UB9A 5IU1A 2EXAA 2Y91A 2ZBBA 3Q7VB 3OZHA 3V5MA 5KIZA 4QHCA 2VGLM 2QWSA 2X71A 3DTIA 1BUEA 1OJGA 3SH8A 3S7NA 3E4QA 1ES2A 2WGWA 3EEHA 5EV0A 4CLCB 5JYPA 1AXBA 1BT5A 1OTAA 1ONHA 1XA1A 4WF0A 2Y79A 1K0KA 3ZG7B 3H9WA 1W79A 3IH8A 3FG8A 4LV0A 1NZOA 3B33A 3UNWA 2QMIA 1WYBA 1EI5A 1NZUA 2W3GA 1NWZA 2HPBA 2UV0E 5KSHA 1F9IA 2J80A 5U47A 4FCFA 4I39A 4G3KA 3T4TA 5GLCA 2B02A 4CQHA 2PR6A 5HAPA 5CX7A 4X1LA 5EPHA 5L07A 4ARZA 1T19A 1F5MA
chains in the Genus database with same CATH topology
4EERA 2VX8A 3GECA 3RFBA 5F6AA 3PR6A 5HD5A 3PYPA 1G6OA 4LLOB 4HNBA 3BQAA 4L9GA 5I5LA 2J3TC 2KLIA 1DP9A 2OAP1 4Y3IA 3UB7A 1W63Q 3CLOA 1P9WA 2YKHA 1P97A 4GLQA 2BASA 1NLZA 4I3JA 1BYWA 4IUHA 1MC0A 2A2LA 2XA7M 3H82A 4MCWA 4Z1WA 4EESA 1LSWA 3NHQA 4MMNA 2CMNA 5HPFA 2QJ7A 3VE3A 1N9OA 5J3WA 3S7QA 5AVEA 3MQ0A 4H6JA 1LL8A 4JGPA 5MC7A 4MDZA 3LUQA 2OWJA 2D01A 3LIDA 4MN6A 4O8GA 1P0ZA 3MQQA 1LSVA 1F98A 3UMEA 4WUJA 3TE8A 1N9NA 2W1TB 2VV8A 3DBAA 2XA7S 4AFIA 3EQUA 3MMHA 3T4KA 1TS7A 3LIBA 3BW6A 3HJIA 4IHQA 4CLCC 1OTIA 4O0PA 4HJ3A 4UQIS 3KSFA 1S4RA 1TS6A 4Q0HA 5HWWA 3PBNA 5TJJA 2IA2A 4FSFA 1XJ2A 4BBVA 1IFQA 3KYZA 5L8MA 3PBTA 1VB6A 2EWWA 2D02A 1KOUA 3LFVA 1ZHHB 2DMWA 4F3LB 4GCZA 4I38A 3CI6A 5TBMA 3F1PB 3R7WB 3TRCA 2VV6A 4WELA 4YWZA 2W0NA 1NLYA 3EOIA 2A24A 3T4QA 2QHKA 4L9FA 5EFWA 4EUVA 2GX5A 3C30A 2OWHA 3ZQ5A 3TJZC 5HL6A 2K7SA 1OTDA 2HF6A 1TF1A 2J3WA 5HDCA 2INWA 1DP6A 2K2NA 5G4YA 2JKTM 1WA9A 3T4OA 2WKRA 4KUKA 5HWVA 4FOFA 5G4ZA 3RH8B 3IBRA 2VV7A 3A0SA 3BY9A 3LI8A 4HP4A 4DJ2A 4ETZA 3F1OB 1YAXA 4R38A 3CWFA 4JGRA 4HOIA 4Y5FA 4EETB 3OCNA 2W3HA 1T1AA 2MJ6A 2XSSA 4MN5A 1ODVA 4L0LA 5J4EA 3KYQA 3R4KA 3SW1A 3E98A 5IT5A 3C8CA 2QJ5A 2V1AA 3D3OA 3OC2A 3BJNA 5HPIA 5F69A 2W1TA 1S1ZA 1DP8A 2JKRM 1OTBA 2YKFA 3EQVA 4NXEA 4DMZA 3K3CA 3A0RA 5HDSA 2Y8HA 2GNXA 4ME4A 3RTYA 4R3AA 2ZMFA 3KSGA 4HH3A 2JKTI 4CLCA 3ULFA 4HJ4A 2VA0A 2QYBA 1H8MA 1XFQA 4HQAA 4PAUA 2GZAA 4XT2A 3F1NB 4YOFA 4CLCE 3NOPC 2P7JA 2Z6CA 5HWTA 4GHIA 5DF9A 2HJEA 5DJTA 4ZRRA 3K3DA 3PBOA 1VHMA 1X0OA 3NOUC 4F3LA 3O5YA 3GDIA 4RQ9A 4I3AA 1H3QA 1T1BA 3KO6A 1T1CA 4UQIM 5AJGA 4JGOA 4KQOA 5F68A 3CITA 1XJ4A 2JHEA 2WKQA 3E0YA 2W3EA 1MKMA 4BJPA 3LR4A 4GS9B 4WEJA 2PDRA 1STZA 3IS2A 3MR0A 4HJ6A 1T18A 3KSHA 3NOTC 3MQOA 2VZWA 2JKRI 5HSQA 3OBFA 3S7PA 4NXBA 2PD8A 4EQ1A 5F5YA 3PBRA 2PYPA 1OT6A 1TD5A 1ZTUA 2L4RA 5J7EA 4HI4A 2W27A 4WN5A 3IBJA 1LT0A 4NKPA 3TW8A 3B47A 2L1MA 4EU0A 2OOLA 4IUKA 4CLCD 2EWVA 1EW0A 3P7NA 1D06A 3LICA 4BBUA 2R78A 4PHTA 1LSXA 1S1YA 3MF0A 2PD7A 5DKLA 2V0UA 3LR3A 1S67L 3S7OA 5AVFA 4GW9A 3VE4A 4P6ZS 2PR5A 2ZOIA 4DN0A 3ZYTA 5DJUA 3H82B 3LYXA 2VEAA 4WLAA 1MZUA 4MN7A 3KSIA 2V9AA 3C2WA 2GJ3A 1GSXA 2FH5A 2VGLS 2QKPA 3UE6A 4GJ4A 4H6JB 3NJAA 5C5KA 3UMDA 4R70A 1OPXA 1V9ZA 2O9AA 1JNUA 1S66L 2KX6A 5HDDA 4KQDA 4UEYA 2O9BA 3D72A 2ZMVA 2W3DA 3F1NA 4HY8A 4OOMA 1P9RA 4G3VA 2JN7A 4B9OA 1N9LA 5LBRA 4EXOA 3LR5A 2KDKA 4WL9A 1DRMA 2ZOHA 4Y2FA 2XROA 4L9EA 4I5SA 2O0YA 2V1BA 3PHYA 3MJQA 1IOUA 2V0WA 4NXGA 4ETXA 1V9YA 4LPZA 3BY8A 2G7UA 3EGXC 3E4PA 3LIAA 3LI9A 4PKYA 3PBSA 3CUEC 3LR0A 3C38A 1D7EA 1YSQA 3ICYA 4HHDA 4EW7A 4QPRA 2O9CA 4HH2A 4G3WA 1GSWA 2J3TD 4PKYG 1UWNX 3T50A 2NUPC 2B18A 3E4OA 1W63M 3K2NA 3KX0X 5TBMB 4O01A 1Y28A 1YKDA 3JVVA 2A24B 4KUOA 4LRYC 4BWIA 3EEAA 3UB8A 1UGUA 2EA9A 4HP9A 5K5BA 3U2AA 1OJ5A 4EEUA 3HJKA 2HJ9C 2VKSA 1S4SA 4R6LA 3W2ZA 4LRZE 3H7WB 4LRXC 3BWLA 3F1PA 4YNRA 3R7WA 1XJ3A 2PT7A 3A0VA 4NXFA 4I3IA 4Q0IA 4M4XA 4ARZB 2L0WA 2M1CA 3OOVA 2LB5A 1OT9A 2HV1A 3CAXA 3JVUA 3PXPA 5FL3A 2PYRA 5DFYA 4P6ZM 3T4SA 3UB9A 3UE3A 5IU1A 1TS8A 3LIEA 2ZBBA 5KIZA 4IJGA 2VGLM 2QWSA 3F1OA 3HCYA 4BBTA 3EGDC 2OAQ1 4E04A 1OJGA 1OTEA 2NUTC 4HIAA 3S7NA 3E4QA 4JGQA 2WKPA 3PBQA 5IS1A 2XRNA 3EEHA 2M7UA 3VOLA 3EWKA 3B42A 4CLCB 2KOIA 1XFNA 4K08A 1UWPX 4XT2B 1OTAA 2M7VA 2P04A 3BQ8A 4WF0A 2Y79A 4GHIB 3H9WA 2VJWA 3MXQA 5DFXA 3FPWA 4NEED 3FG8A 2K31A 4BMWA 4OOLA 3P01A 3CUEA 3T4JA 3V67A 3B33A 2I9VA 2Z6DA 2W3GA 3OCLA 1NWZA 3VV4A 1GSVA 2VLGA 4B93A 3IS2B 5KSHA 5HD3A 1F9IA 2H28A 4Q0JA 1YSPA 2J80A 1NRJA 3MFXA 3FPVA 5A8BA 3T4LA 4I39A 4DJ3A 4G3KA 3H7WA 2P08A 3T4TA 3FC7A 4WEKA 1TS0A 2B02A 4CQHA 3OLOA 2PR6A 5DKKA 2PHYA 5CX7A 4GS9A 4ARZA 2W1RA 2HGVA 3UB6A 5HZHA 2FZ0A 1T19A 1F5MA 2LB9A 4EEPA 2O99A 3LIFA 2W3FA 4II7A 1G28A 3G6OA 1XJ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NRJ A;  2JKT I;  2FH5 A;  2VGL S;  2VGL M;  4NEE D;  2HF6 A;  1W63 M;  2XA7 S;  2XA7 M;  2JKT M;  2JKR I;  2JKR M;  5MC7 A;  4P6Z S;  4P6Z M;  1W63 Q;  4UQI S;  4UQI M;  3TJZ C; 
#chains in the Genus database with same CATH topology
 2VX8 A;  3VMA A;  1RCJ A;  3U4L P;  3WS4 A;  2J8Y A;  5HD5 A;  4LLO B;  4HNB A;  3M6B A;  4OPY A;  2J3T C;  2KLI A;  1L2S A;  1DP9 A;  3WS5 A;  4X69 A;  3CLO A;  2Y2N A;  3O87 A;  2WK0 A;  4GLQ A;  5AQB A;  2I72 A;  4I3J A;  1BYW A;  4NG2 A;  4IUH A;  2A2L A;  4MCW A;  5CHM A;  1S6R A;  1C3B A;  4M3K A;  5AVE A;  1LL8 A;  4QD4 A;  1HD8 A;  3N8S A;  1HTZ A;  3LUQ A;  2HZ5 A;  2XD1 A;  4DDS A;  3LID A;  2XLN A;  4KZ8 A;  4BD1 A;  3G31 A;  2EXB A;  3D9Y A;  3TE8 A;  1N9N A;  4JF6 A;  4AFI A;  4FD8 A;  4IHQ A;  5HW3 A;  1FR1 A;  1IYQ A;  4OH0 A;  4O0P A;  1PWG A;  2XF3 A;  3QP4 A;  3UE0 A;  2XD5 A;  3KSF A;  2ZM2 A;  4RX3 A;  3PBT A;  1ZHH B;  2DMW A;  3C4O A;  3OPH A;  3QP8 A;  5HAI A;  3BFC A;  1ONG A;  3I7J A;  4YWZ A;  1IKG A;  4X53 A;  3DTK A;  3T4Q A;  3L9K A;  2GX5 A;  1FIL A;  3C7V A;  3ZQ5 A;  5HL6 A;  4S2J A;  5JYO A;  5DTT A;  4DXB A;  2HF6 A;  1TF1 A;  1YLW A;  5HWV A;  3GV9 A;  3HUO A;  5G4Z A;  3UB5 P;  3RH8 B;  1MBL A;  3IBR A;  2Y2M A;  1SKO A;  1YAX A;  3CWF A;  1VEU B;  4ESP A;  2Z2L B;  4HOI A;  4E3N A;  3OCN A;  1JVJ A;  2W3H A;  4QY5 A;  1J9M A;  1LI0 A;  1ODV A;  5EVE A;  3MFD A;  3MZF A;  1S0W A;  4UA7 A;  3C8C A;  2V1A A;  3OC2 A;  3P09 A;  5HPI A;  2EX9 A;  1FSY A;  3UPO A;  3BFG A;  4KG2 A;  3EQV A;  4NXE A;  4R1G A;  4DMZ A;  2Y8H A;  2GNX A;  3GSG A;  2J9O A;  3E2K A;  1JTD A;  4IBX A;  2GZA A;  3F1N B;  3NOP C;  2EX8 A;  2P7J A;  3HVF A;  5HFO A;  5HWT A;  5DJT A;  4UAA A;  1VET B;  4GD8 A;  3NOU C;  4F3L A;  4UQI M;  3ZGA B;  4JGO A;  4KQO A;  4LV1 A;  3V3R A;  5FEG A;  2J7V A;  4LFU A;  1XJ4 A;  2JHE A;  1MKM A;  4WEJ A;  4YIN A;  1WYC A;  3MR0 A;  3KSH A;  3NOT C;  4KZ5 A;  5CHJ A;  4GB7 A;  2JKR I;  4K91 A;  1K25 A;  3OPL A;  2PD8 A;  4NXB A;  4ZBE A;  3AGF A;  1OT6 A;  1TD5 A;  1ZTU A;  2L4R A;  2HP5 A;  5J7E A;  4HI4 A;  4DXC A;  3TW8 A;  3FWL A;  4EU0 A;  3LIC A;  4BBU A;  2Y2L A;  1ALQ A;  4PHT A;  3UE1 A;  5A90 A;  2WAF A;  3SZT A;  1FCM A;  1JWZ A;  2PR5 A;  3IWI A;  3IWO A;  1YM1 A;  4WLA A;  3BM6 A;  2FH5 A;  2VGL S;  1XX2 A;  3G2Z A;  3T12 B;  3T1Q B;  1RGZ A;  1FQG A;  2A3U A;  5HAQ A;  1KDS A;  1LL5 A;  4UEY A;  3T1S A;  3D72 A;  2ZMV A;  2W3D A;  4MEZ A;  3MZD A;  4EXO A;  1W7F A;  5EVI D;  1ERO A;  3LR5 A;  2R9X A;  4L9E A;  2O0Y A;  2XR0 A;  2V1B A;  3PHY A;  1IOU A;  4RVA A;  1I2W A;  3A3J A;  4JXG A;  3G35 A;  4O7D A;  4ZDX A;  4OQG A;  4WZ5 A;  3RXW A;  3G2Y A;  3CUE C;  3ICY A;  4HHD A;  2O9C A;  3WS2 A;  3ZCZ A;  1OME A;  3T50 A;  4O01 A;  4UHU A;  3QP1 A;  5FDH A;  4LRY C;  4OQH A;  5GHX A;  3NUL A;  1S4S A;  1TDG A;  3HLG A;  2V2F F;  4H8R A;  5AQ9 A;  3ITA A;  3M2J A;  3BWL A;  3F1P A;  3R7W A;  5FEF A;  5BOH A;  3A0V A;  4NXF A;  5FQK A;  4Q0I A;  3IH9 A;  1OT9 A;  1Q2Q A;  2HV1 A;  3BFD A;  3QNB A;  2ACG A;  2FFY A;  4JPM A;  3T4S A;  3UE3 A;  1U60 A;  3LIE A;  1XA7 A;  2JKG A;  5EM1 A;  2J9P A;  5F82 A;  4OQ0 A;  3F1O A;  5E2F A;  4B88 A;  3HCY A;  3EGD C;  4E04 A;  1DJB A;  2GDN A;  2ZQ9 A;  5E43 A;  1VQQ A;  1OTE A;  2NUT C;  2XDM A;  4HIA A;  1I2S A;  5IS1 A;  2XRN A;  4K0X A;  4DE1 A;  3B42 A;  4EUZ A;  2KOI A;  4C3Q A;  4K08 A;  5EVL A;  5L2F A;  2P04 A;  1Z09 A;  2Q9N A;  4Y17 A;  4N1H A;  3MXQ A;  3FPW A;  2H0T A;  2P9V A;  4EWF A;  2C5W B;  3CUE A;  3T4J A;  3V67 A;  4UA6 A;  2OV5 A;  2I9V A;  4OPZ A;  3ISG A;  2Z6D A;  2R9W A;  2G2W A;  2EFX A;  2VLG A;  2ZQC A;  5CTN A;  2H28 A;  4Q0J A;  4JF5 A;  1L0E A;  1NRJ A;  3FPV A;  1ES3 A;  4DJ3 A;  4PM6 A;  3H7W A;  3W4O A;  5EVI C;  3WS1 A;  3FC7 A;  4WEK A;  2HGV A;  4DF6 A;  5HZH A;  1BLC A;  5EE8 A;  2FZ0 A;  1NYM A;  3ZG0 A;  2O99 A;  2UWX A;  3LIF A;  1XJ6 A;  4P6B A;  3UDX A;  4EER A;  4BL3 A;  3GEC A;  5EM0 A;  2Q0O A;  2Z2M B;  3LEZ A;  5FAO A;  3RFB A;  3CMZ A;  5DTK A;  3PR6 A;  3PYP A;  3BQA A;  3QP5 A;  5I5L A;  2PBD P;  1CEG A;  3UB7 A;  2IWB A;  1MPL A;  3ZG8 B;  1O07 A;  2Y2J A;  4NK3 A;  3FYZ A;  3HLB A;  1MC0 A;  3VP3 A;  2E8J A;  4Z1W A;  1NY0 A;  1SZV A;  3AGE A;  5J8X A;  5E2H A;  1FCO A;  3GQZ A;  3Q1F A;  5HPF A;  4E6X A;  5J3W A;  5KSC A;  3S7Q A;  3NY4 A;  4LV2 A;  4JGP A;  5MC7 A;  4GDN A;  2OWJ A;  3UY6 A;  1E3U D;  2ZM8 A;  2WUQ A;  3UME A;  2W1T B;  1W8Q A;  2VV8 A;  3DBA A;  4X55 A;  2XA7 S;  1RP5 A;  3IF5 A;  1K6S A;  3BW6 A;  2ZL1 B;  4S2K A;  3OPR A;  4N1X A;  4OQI A;  3LO7 A;  4HJ3 A;  4UQI S;  5EVI A;  5HWW A;  2ZQD A;  1XJ2 A;  1IFQ A;  3KYZ A;  1SDN A;  3BFF A;  1VB6 A;  1RGY A;  3LCE A;  2D02 A;  1KOU A;  3VSK A;  2EX6 A;  1YLJ A;  4FH4 A;  4GCZ A;  1PZP A;  5TBM A;  3F1P B;  3R7W B;  1NLY A;  1SHV A;  4OON A;  3SH7 A;  4KZB A;  1IEM A;  3TJZ C;  2K7S A;  5DF7 A;  5HDC A;  2PBY A;  3BEB A;  4WYY A;  4IED A;  2WYX A;  3HLD A;  3QP2 A;  4FOF A;  4YFM A;  3ZG5 A;  1KE3 A;  1MWT A;  2FFF B;  1ESI A;  3BY9 A;  3CPT B;  1ZKJ A;  1PZO A;  1NXY A;  3F1O B;  4R38 A;  4Y5F A;  3SOI A;  4EET B;  2WAE A;  1XKZ A;  1T1A A;  2MJ6 A;  4MN5 A;  1K38 A;  3IX8 A;  5GLB A;  4OVD A;  5FI7 A;  4FTX A;  2ZC3 B;  3E98 A;  1E4D A;  2QJ5 A;  1IKI A;  2JKR M;  4PM5 A;  1OTB A;  2YKF A;  3IQA A;  3A0R A;  4D60 A;  2P9V B;  2ZMF A;  3FZC A;  4C6Y A;  3KSG A;  2JKT I;  5D3O A;  1NJ4 A;  2QYB A;  1H8M A;  1XFQ A;  4LV3 A;  4PAU A;  4N9L A;  3NCK A;  2WGI A;  1HVB A;  4GHI A;  4QU3 A;  2Y55 A;  3PBO A;  4C75 A;  4WMC D;  3O5Y A;  3GDI A;  1XGI A;  3MZE A;  4GKU A;  5AJG A;  1K4F A;  3E0Y A;  2WKQ A;  4BJP A;  2ZC6 B;  4KZA A;  4EV4 A;  2PDR A;  3BRM A;  4HJ6 A;  2E8I A;  3OBF A;  4S2M A;  4EQ1 A;  4OP5 A;  5F5Y A;  4FH2 A;  1D1J A;  4XUX A;  4LGW A;  4Y15 A;  1LT0 A;  4IVK A;  5CGW A;  2EWV A;  4CLC D;  3ZVT A;  4X56 A;  4IBR A;  2R78 A;  1K55 C;  3MF0 A;  2PD7 A;  5DKL A;  4CJN A;  3DAV A;  2V0U A;  1BZA A;  5AVF A;  5GLD A;  3VE4 A;  4KZ7 A;  3ZYT A;  5DJU A;  4EBP A;  3BLS A;  2VEA A;  4OLD A;  1MZU A;  1H5X A;  1VM1 A;  3IF6 C;  1GSX A;  4E3L A;  1H8Y A;  2ZQA A;  3P98 A;  5CED A;  5KZH A;  3UMD A;  3A3F A;  4R70 A;  2WGV A;  2KX6 A;  1L0F A;  2V20 A;  3KYE A;  4HY8 A;  1P9R A;  4MBH A;  2OSU A;  3G34 A;  4PMA A;  5DVA A;  3IXH A;  4GZB A;  4Y2F A;  5GL9 A;  2WGW B;  4X1M A;  4HEF A;  4ETX A;  1V9Y A;  3V50 A;  1BTL A;  5CGX A;  4X25 A;  3LIA A;  3LI9 A;  4ZJ1 A;  4PKY A;  5GHY A;  1AWI A;  4QPR A;  1E3U A;  4HH2 A;  4S2L A;  4R4R A;  1GSW A;  3ZHH A;  5EOE A;  1BUL A;  2QPN A;  2HP6 A;  3K2N A;  5TBM B;  1MXO A;  4KZ4 A;  1Y28 A;  3TG9 A;  3NI9 A;  3JVV A;  4JKT A;  4KUO A;  4BWI A;  4ID4 A;  4K0W A;  1UGU A;  3LGO A;  1OJ5 A;  5FQM A;  4QWO A;  1Q2P A;  4U0T A;  5M19 A;  3V3S A;  3W4Q A;  2B5R A;  1M40 A;  1XJ3 A;  5DTS A;  2PT7 A;  3DWZ A;  4I3I A;  4M4X A;  4ARZ B;  1A0K A;  3D4F A;  4IVI A;  2LB5 A;  4BD0 A;  1KVL A;  5FL3 A;  3PXP A;  2PYR A;  2Y4A A;  5DFY A;  5L09 A;  1CI8 A;  4Q8I A;  1FSW A;  1TS8 A;  1K57 C;  4OPQ A;  1K54 C;  1MY8 A;  4BBT A;  4B4Z A;  4OPR A;  2VK3 A;  2WKP A;  4DE2 A;  3VOL A;  2X02 A;  3EWK A;  1XFN A;  1UWP X;  3UDI A;  1KE4 A;  4BEN A;  4GHI B;  4P0M A;  4NEE D;  5FSR A;  2K31 A;  4XXR A;  4BMW A;  4OOL A;  3P01 A;  2CC1 A;  4D2O A;  1YLT A;  4PM9 A;  1FIK A;  4EQI A;  3OCL A;  3IXD A;  4KZ6 A;  1YSP A;  1CF0 A;  1H0M A;  3MFX A;  2JBF A;  2BLS A;  5A8B A;  3T4L A;  3A3D A;  4ZJ3 A;  1JWP A;  3OLO A;  3HL9 A;  2W1R A;  4WMC A;  1ACF A;  2LB9 A;  4II7 A;  1YLZ A;  4QB8 A;  3RJU A;  5CHU A;  3CJM A;  5F6A A;  3Q7V A;  1K57 A;  3N6I A;  1G6O A;  2OAP 1;  5EEC A;  1GHP A;  1ERQ A;  2YKH A;  3WS0 A;  2HDR A;  1NLZ A;  2V1Z A;  2Y2O A;  3H82 A;  1LSW A;  1SKO B;  3NHQ A;  2WZZ A;  3QP6 A;  2HDS A;  2QJ7 A;  4Z9Q A;  3VE3 A;  1N9O A;  4H6J A;  2Y2P A;  1L0G A;  1IYS A;  2D01 A;  2JCH A;  3MQQ A;  5FI2 A;  1LSV A;  4JXS A;  1BLH A;  2OLV A;  1LI9 A;  1ZG4 A;  3T4K A;  4QY6 A;  4KG5 A;  4LCL A;  3HJI A;  3NDE A;  3MXR A;  1GA0 A;  2WKI A;  2RL3 A;  1PWD A;  3PAG A;  2Y59 A;  5TR7 A;  3FKW A;  1S4R A;  2IA2 A;  5E2G A;  2H10 A;  5L10 A;  2EWW A;  3NBL A;  3Q07 A;  3LFV A;  1PIO A;  3JYI A;  4F3L B;  5HX9 A;  4GNU A;  3W4P A;  3NDG A;  3FKV A;  1G6A A;  4R23 A;  2WKH A;  3BLM A;  4WEL A;  3MXS A;  4EBN A;  1MKI A;  1K4E A;  2A24 A;  2VGK A;  3C30 A;  2OWH A;  3NC8 A;  3UDF A;  2INW A;  1DP6 A;  5G4Y A;  2DNS A;  2JKT M;  2WKR A;  4KUK A;  3V39 A;  5KMW A;  1XGJ A;  3QNC A;  3ZDJ A;  4JBF A;  2VV7 A;  3LI8 A;  4HP4 A;  4ZJ2 A;  4JGR A;  1GCE A;  1N9B A;  2PRF A;  3IWQ A;  1M6K A;  5CER A;  4L0L A;  4LCM A;  3HBR A;  3BYD A;  3R4K A;  5FQI A;  3D3O A;  3BJN A;  2JC7 A;  1KE0 A;  1S1Z A;  1DP8 A;  3K3C A;  2XQZ A;  4R3A A;  2Y2G A;  4XUZ A;  4HJ4 A;  4HQA A;  4Y7P A;  5CEC A;  1DY6 A;  4XT2 A;  4CLC E;  4MLL A;  2XFS A;  2Z6C A;  5F1F A;  5DF9 A;  2HJE A;  1X0O A;  3VP2 A;  1SCW A;  4RQ9 A;  1H3Q A;  1T1B A;  3KO6 A;  1TEM A;  1ZG6 A;  2EX2 A;  2QZ6 A;  1IEL A;  5F68 A;  3QHY A;  2W3E A;  3IXG A;  5E2E A;  4CPK A;  3GVB A;  1STZ A;  3IS2 A;  4WBG A;  3UPN A;  4KEN B;  3UN7 A;  4S2P A;  1QME A;  1QMF A;  3S7P A;  1MWU A;  1GA9 A;  3PBR A;  2ZQ8 A;  4BLM A;  4WN5 A;  1K6R A;  4GDB A;  3IBJ A;  4NKP A;  4E3O A;  3B47 A;  4IUK A;  1EW0 A;  4KZ9 A;  3UPP A;  4OOY A;  1D06 A;  2ZC7 A;  1VEU A;  1LSX A;  3SS4 A;  1ZC2 A;  2G2U A;  4HBU A;  2Y2I A;  1TVF A;  3IT9 A;  3JPU A;  3LR3 A;  3LY4 A;  4GW9 A;  2JKF A;  1SKF A;  3C4P A;  3H82 B;  3LYX A;  4MN7 A;  4DRT A;  2V9A A;  5GHZ A;  2GJ3 A;  3HUM A;  2OLU A;  4KQQ A;  4H6J B;  3NJA A;  5C5K A;  1OPX A;  1V9Z A;  3MSH A;  3VSL A;  1S66 L;  3S4X A;  4F94 A;  4E3K A;  2O9B A;  1H8Z A;  2H0Y A;  3F1N A;  1JTG A;  2JN7 A;  5I94 A;  5HL1 A;  1N9L A;  1Z6F A;  3VOY A;  2KDK A;  1VET A;  1YT4 A;  2ZOH A;  2XRO A;  4LEN A;  5F83 A;  5FAS A;  2V0W A;  5FAQ A;  3BY8 A;  3EGX C;  3SS3 A;  3C38 A;  1SDE A;  3MKE A;  3LEQ A;  3ZNY A;  4G3W A;  4PKY G;  1UWN X;  1DJA A;  1PW8 A;  4S2N C;  1PNE A;  3E2L A;  3E4O A;  4Y13 A;  4Y0O A;  2A24 B;  1KVM A;  4KG6 A;  5TFQ A;  2ZD8 A;  3UB8 A;  2EA9 A;  4HP9 A;  3U2A A;  3HJK A;  5AQ7 A;  1CQA A;  1K56 D;  3W2Z A;  3H7W B;  4LRX C;  3LY3 A;  1G5U A;  4YNR A;  1CJF A;  2XEP A;  3DTM A;  3GTC A;  2HP9 A;  2RCX A;  4OP8 A;  3S22 A;  3O88 A;  4E3M A;  4PPR A;  3A3E A;  4P6Z M;  2Q9M A;  4U3T A;  4X68 A;  3Q81 A;  3VP0 A;  5A91 A;  4IJG A;  1CEF A;  4E3J A;  1Y54 A;  1YLP A;  2OAQ 1;  3HLE A;  1MWR A;  4JGQ A;  3PBQ A;  2M7U A;  4P87 A;  4N9K A;  2BTF P;  5F1G A;  4XT2 B;  5CGS A;  3ZFZ A;  1NRF A;  2M7V A;  3DW0 A;  1YQS A;  3BQ8 A;  3WWX A;  3OPP A;  2VJW A;  5DFX A;  3MBZ A;  4PM7 A;  4S2O A;  4HBT A;  3TOI A;  1IYO A;  1N4O A;  4Y0U A;  4S2N A;  3MS6 A;  1PI5 A;  3BEC A;  3VV4 A;  3G32 A;  1GSV A;  4B93 A;  3IS2 B;  5HD3 A;  2Y2K A;  4HES A;  4U0X A;  3L7H A;  2P08 A;  2ZM0 A;  2DRW A;  1F2K A;  1TS0 A;  2HDU A;  3AGD A;  5EVI B;  5DKK A;  2PHY A;  5TGF A;  4GS9 A;  2XGN A;  4R3B A;  3UB6 A;  3FV7 A;  2ZQ7 A;  1ES5 A;  4EEP A;  2W3F A;  1G28 A;  3G6O A;  1I5Q A;  1L0D A;  3ZVW A;  2WZX A;  2EFU A;  5FQJ A;  2H5S A;  5FA7 A;  3ITB A;  3VP1 A;  3SS5 A;  2ZLY A;  1G68 A;  4L9G A;  3RXX A;  1GHM A;  5FDS A;  1PW1 A;  1PFL A;  4Y3I A;  1K55 A;  4KZ3 A;  1W63 Q;  1JWV A;  1P9W A;  3N8L A;  1P97 A;  1Y4O A;  2BAS A;  5FAP A;  1XXM A;  2XH9 A;  2XA7 M;  3S1Y A;  4EES A;  3WRT A;  1L3L A;  4MMN A;  2CMN A;  3IF6 A;  4GD6 A;  4MBF A;  1FCN A;  3MQ0 A;  3BFE A;  4MDZ A;  4WM9 A;  5G18 A;  3VFF A;  4MN6 A;  4O8G A;  1BSG A;  1ES4 A;  1P0Z A;  1E25 A;  1XPB A;  3T1R A;  1F98 A;  4WUJ A;  4WZ5 C;  3UO9 A;  5HAR A;  3EQU A;  3MMH A;  5CXW A;  3CZD A;  1TS7 A;  3LIB A;  4RX2 A;  4CLC C;  3GR2 A;  2WAD A;  1OTI A;  1BLS A;  2PU2 A;  2JE5 A;  1TS6 A;  4Q0H A;  3PBN A;  1CK3 A;  1MWS A;  5TJJ A;  4FSF A;  4ZTK A;  4BBV A;  5L8M A;  3GRJ A;  3WRZ A;  4WZ4 A;  4Y0T A;  1YMX A;  4ZAM A;  4JXW A;  4I38 A;  4A5R A;  2BG1 A;  4UA9 A;  5IHV A;  3CI6 A;  3W8K A;  3TRC A;  2VV6 A;  5EUA A;  2W0N A;  2V8C A;  3EOI A;  4PM8 A;  3Q7Z A;  2QHK A;  4L9F A;  5EFW A;  4EUV A;  4BL2 A;  1FR6 A;  4EBL A;  3IHA A;  3GMW A;  4R0Q A;  1OTD A;  4P85 A;  2J3W A;  2K2N A;  1WA9 A;  3T4O A;  5FQ9 A;  2WKE A;  4R4S A;  3O86 A;  1KGG A;  1KDW A;  3A0S A;  3VP4 A;  4X6T A;  3MKF A;  4DJ2 A;  4ETZ A;  4RA7 A;  1K56 A;  1W8Y A;  3N4I A;  3TSG A;  5GLA A;  2XK1 A;  3Q82 A;  2XSS A;  4OLG A;  2HDQ A;  4DDY A;  5J4E A;  3KYQ A;  3SW1 A;  5IT5 A;  2XFT A;  4KQR A;  5F69 A;  2A49 A;  2W1T A;  1K54 A;  4FUW A;  4E6W A;  3T1X A;  4GOG A;  2Y2H A;  3IX4 A;  5HDS A;  4ME4 A;  3G4P A;  3RTY A;  2ZL1 A;  4B4X A;  3NEC A;  1LL9 A;  4HH3 A;  4CLC A;  3ULF A;  2VA0 A;  4GN2 A;  1W5D A;  4OKP A;  4YOF A;  3ZG9 B;  3CHW P;  2PU4 A;  1GHI A;  3HLW A;  3HRE A;  4MNR A;  4ZRR A;  3K3D A;  1VHM A;  4I3A A;  1FOF A;  1T1C A;  4BQM A;  1DJC A;  1KGE A;  3CIT A;  3O3V A;  3LR4 A;  4GS9 B;  3DWK A;  3N8R A;  1EWZ A;  1T18 A;  2X01 A;  3MQO A;  2VZW A;  1LLB A;  5HSQ A;  1KGF A;  3IX3 A;  2PYP A;  4N92 A;  5FQQ A;  3PAE A;  5CTM A;  2W27 A;  3IXB A;  3DTE A;  3CPT A;  5M1A A;  2L1M A;  2OOL A;  3P7N A;  1NYY A;  1YPR A;  4RYE A;  2IWC A;  1S1Y A;  3NIA A;  1CI9 A;  5A92 A;  1J3W A;  1S67 L;  3S7O A;  2ZC4 B;  1HZO A;  1ESU A;  3N7W A;  4P6Z S;  4DE0 A;  2ZOI A;  4DN0 A;  4JF4 A;  1YMS A;  4E3I A;  1PYY A;  1PI4 A;  3KSI A;  3M6H A;  5FAT A;  3C2W A;  3HLC A;  3IF6 B;  1LHY A;  3SH9 A;  5AQA A;  2QKP A;  3UE6 A;  4GJ4 A;  2PAV P;  3ZNT A;  3C5A A;  2O9A A;  3HLF A;  1JNU A;  5HDD A;  4KQD A;  4QJG A;  2IWD A;  4MBK A;  1ERM A;  4R3J A;  4OOM A;  4G3V A;  4B9O A;  5LBR A;  4JLF A;  4JXV A;  4WL9 A;  2P74 A;  1DRM A;  5A93 A;  4I5S A;  4S2I A;  1HLU P;  3MJQ A;  1PRQ A;  4NXG A;  5FI6 A;  5EOO A;  1YLY A;  2ZC5 B;  3G30 A;  4LPZ A;  2G7U A;  3E4P A;  3VFH A;  3PBS A;  3LR0 A;  1IYP A;  1D7E A;  1YSQ A;  1BLP A;  4EW7 A;  2AVX A;  2J3T D;  1O7E A;  1TDL A;  2NUP C;  2B18 A;  3KX0 X;  1W63 M;  2Y2Q A;  1WE4 A;  1YKD A;  1PWC A;  2C6W B;  3EEA A;  1XP4 A;  5K5B A;  4EEU A;  2ZJ9 A;  2DCF A;  2HJ9 C;  2VKS A;  5CRF A;  2ZMA A;  4R6L A;  5M18 A;  4LRZ E;  3CG5 A;  4NET A;  4DE3 A;  3IHB A;  3PTE A;  5CEB A;  2V8F A;  3A3I A;  3VOZ A;  2L0W A;  2M1C A;  3OOV A;  2VGJ A;  4DKI A;  3CAX A;  3JVU A;  5DF8 A;  2B95 A;  3HUN A;  3C7U A;  3M2K A;  3B3X A;  3UB9 A;  5IU1 A;  2EXA A;  2Y91 A;  2ZBB A;  3Q7V B;  3OZH A;  3V5M A;  5KIZ A;  4QHC A;  2VGL M;  2QWS A;  2X71 A;  3DTI A;  1BUE A;  1OJG A;  3SH8 A;  3S7N A;  3E4Q A;  1ES2 A;  2WGW A;  3EEH A;  5EV0 A;  4CLC B;  5JYP A;  1AXB A;  1BT5 A;  1OTA A;  1ONH A;  1XA1 A;  4WF0 A;  2Y79 A;  1K0K A;  3ZG7 B;  3H9W A;  1W79 A;  3IH8 A;  3FG8 A;  4LV0 A;  1NZO A;  3B33 A;  3UNW A;  2QMI A;  1WYB A;  1EI5 A;  1NZU A;  2W3G A;  1NWZ A;  2HPB A;  2UV0 E;  5KSH A;  1F9I A;  2J80 A;  5U47 A;  4FCF A;  4I39 A;  4G3K A;  3T4T A;  5GLC A;  2B02 A;  4CQH A;  2PR6 A;  5HAP A;  5CX7 A;  4X1L A;  5EPH A;  5L07 A;  4ARZ A;  1T19 A;  1F5M A; 
#chains in the Genus database with same CATH homology
 4EER A;  2VX8 A;  3GEC A;  3RFB A;  5F6A A;  3PR6 A;  5HD5 A;  3PYP A;  1G6O A;  4LLO B;  4HNB A;  3BQA A;  4L9G A;  5I5L A;  2J3T C;  2KLI A;  1DP9 A;  2OAP 1;  4Y3I A;  3UB7 A;  1W63 Q;  3CLO A;  1P9W A;  2YKH A;  1P97 A;  4GLQ A;  2BAS A;  1NLZ A;  4I3J A;  1BYW A;  4IUH A;  1MC0 A;  2A2L A;  2XA7 M;  3H82 A;  4MCW A;  4Z1W A;  4EES A;  1LSW A;  3NHQ A;  4MMN A;  2CMN A;  5HPF A;  2QJ7 A;  3VE3 A;  1N9O A;  5J3W A;  3S7Q A;  5AVE A;  3MQ0 A;  4H6J A;  1LL8 A;  4JGP A;  5MC7 A;  4MDZ A;  3LUQ A;  2OWJ A;  2D01 A;  3LID A;  4MN6 A;  4O8G A;  1P0Z A;  3MQQ A;  1LSV A;  1F98 A;  3UME A;  4WUJ A;  3TE8 A;  1N9N A;  2W1T B;  2VV8 A;  3DBA A;  2XA7 S;  4AFI A;  3EQU A;  3MMH A;  3T4K A;  1TS7 A;  3LIB A;  3BW6 A;  3HJI A;  4IHQ A;  4CLC C;  1OTI A;  4O0P A;  4HJ3 A;  4UQI S;  3KSF A;  1S4R A;  1TS6 A;  4Q0H A;  5HWW A;  3PBN A;  5TJJ A;  2IA2 A;  4FSF A;  1XJ2 A;  4BBV A;  1IFQ A;  3KYZ A;  5L8M A;  3PBT A;  1VB6 A;  2EWW A;  2D02 A;  1KOU A;  3LFV A;  1ZHH B;  2DMW A;  4F3L B;  4GCZ A;  4I38 A;  3CI6 A;  5TBM A;  3F1P B;  3R7W B;  3TRC A;  2VV6 A;  4WEL A;  4YWZ A;  2W0N A;  1NLY A;  3EOI A;  2A24 A;  3T4Q A;  2QHK A;  4L9F A;  5EFW A;  4EUV A;  2GX5 A;  3C30 A;  2OWH A;  3ZQ5 A;  3TJZ C;  5HL6 A;  2K7S A;  1OTD A;  2HF6 A;  1TF1 A;  2J3W A;  5HDC A;  2INW A;  1DP6 A;  2K2N A;  5G4Y A;  2JKT M;  1WA9 A;  3T4O A;  2WKR A;  4KUK A;  5HWV A;  4FOF A;  5G4Z A;  3RH8 B;  3IBR A;  2VV7 A;  3A0S A;  3BY9 A;  3LI8 A;  4HP4 A;  4DJ2 A;  4ETZ A;  3F1O B;  1YAX A;  4R38 A;  3CWF A;  4JGR A;  4HOI A;  4Y5F A;  4EET B;  3OCN A;  2W3H A;  1T1A A;  2MJ6 A;  2XSS A;  4MN5 A;  1ODV A;  4L0L A;  5J4E A;  3KYQ A;  3R4K A;  3SW1 A;  3E98 A;  5IT5 A;  3C8C A;  2QJ5 A;  2V1A A;  3D3O A;  3OC2 A;  3BJN A;  5HPI A;  5F69 A;  2W1T A;  1S1Z A;  1DP8 A;  2JKR M;  1OTB A;  2YKF A;  3EQV A;  4NXE A;  4DMZ A;  3K3C A;  3A0R A;  5HDS A;  2Y8H A;  2GNX A;  4ME4 A;  3RTY A;  4R3A A;  2ZMF A;  3KSG A;  4HH3 A;  2JKT I;  4CLC A;  3ULF A;  4HJ4 A;  2VA0 A;  2QYB A;  1H8M A;  1XFQ A;  4HQA A;  4PAU A;  2GZA A;  4XT2 A;  3F1N B;  4YOF A;  4CLC E;  3NOP C;  2P7J A;  2Z6C A;  5HWT A;  4GHI A;  5DF9 A;  2HJE A;  5DJT A;  4ZRR A;  3K3D A;  3PBO A;  1VHM A;  1X0O A;  3NOU C;  4F3L A;  3O5Y A;  3GDI A;  4RQ9 A;  4I3A A;  1H3Q A;  1T1B A;  3KO6 A;  1T1C A;  4UQI M;  5AJG A;  4JGO A;  4KQO A;  5F68 A;  3CIT A;  1XJ4 A;  2JHE A;  2WKQ A;  3E0Y A;  2W3E A;  1MKM A;  4BJP A;  3LR4 A;  4GS9 B;  4WEJ A;  2PDR A;  1STZ A;  3IS2 A;  3MR0 A;  4HJ6 A;  1T18 A;  3KSH A;  3NOT C;  3MQO A;  2VZW A;  2JKR I;  5HSQ A;  3OBF A;  3S7P A;  4NXB A;  2PD8 A;  4EQ1 A;  5F5Y A;  3PBR A;  2PYP A;  1OT6 A;  1TD5 A;  1ZTU A;  2L4R A;  5J7E A;  4HI4 A;  2W27 A;  4WN5 A;  3IBJ A;  1LT0 A;  4NKP A;  3TW8 A;  3B47 A;  2L1M A;  4EU0 A;  2OOL A;  4IUK A;  4CLC D;  2EWV A;  1EW0 A;  3P7N A;  1D06 A;  3LIC A;  4BBU A;  2R78 A;  4PHT A;  1LSX A;  1S1Y A;  3MF0 A;  2PD7 A;  5DKL A;  2V0U A;  3LR3 A;  1S67 L;  3S7O A;  5AVF A;  4GW9 A;  3VE4 A;  4P6Z S;  2PR5 A;  2ZOI A;  4DN0 A;  3ZYT A;  5DJU A;  3H82 B;  3LYX A;  2VEA A;  4WLA A;  1MZU A;  4MN7 A;  3KSI A;  2V9A A;  3C2W A;  2GJ3 A;  1GSX A;  2FH5 A;  2VGL S;  2QKP A;  3UE6 A;  4GJ4 A;  4H6J B;  3NJA A;  5C5K A;  3UMD A;  4R70 A;  1OPX A;  1V9Z A;  2O9A A;  1JNU A;  1S66 L;  2KX6 A;  5HDD A;  4KQD A;  4UEY A;  2O9B A;  3D72 A;  2ZMV A;  2W3D A;  3F1N A;  4HY8 A;  4OOM A;  1P9R A;  4G3V A;  2JN7 A;  4B9O A;  1N9L A;  5LBR A;  4EXO A;  3LR5 A;  2KDK A;  4WL9 A;  1DRM A;  2ZOH A;  4Y2F A;  2XRO A;  4L9E A;  4I5S A;  2O0Y A;  2V1B A;  3PHY A;  3MJQ A;  1IOU A;  2V0W A;  4NXG A;  4ETX A;  1V9Y A;  4LPZ A;  3BY8 A;  2G7U A;  3EGX C;  3E4P A;  3LIA A;  3LI9 A;  4PKY A;  3PBS A;  3CUE C;  3LR0 A;  3C38 A;  1D7E A;  1YSQ A;  3ICY A;  4HHD A;  4EW7 A;  4QPR A;  2O9C A;  4HH2 A;  4G3W A;  1GSW A;  2J3T D;  4PKY G;  1UWN X;  3T50 A;  2NUP C;  2B18 A;  3E4O A;  1W63 M;  3K2N A;  3KX0 X;  5TBM B;  4O01 A;  1Y28 A;  1YKD A;  3JVV A;  2A24 B;  4KUO A;  4LRY C;  4BWI A;  3EEA A;  3UB8 A;  1UGU A;  2EA9 A;  4HP9 A;  5K5B A;  3U2A A;  1OJ5 A;  4EEU A;  3HJK A;  2HJ9 C;  2VKS A;  1S4S A;  4R6L A;  3W2Z A;  4LRZ E;  3H7W B;  4LRX C;  3BWL A;  3F1P A;  4YNR A;  3R7W A;  1XJ3 A;  2PT7 A;  3A0V A;  4NXF A;  4I3I A;  4Q0I A;  4M4X A;  4ARZ B;  2L0W A;  2M1C A;  3OOV A;  2LB5 A;  1OT9 A;  2HV1 A;  3CAX A;  3JVU A;  3PXP A;  5FL3 A;  2PYR A;  5DFY A;  4P6Z M;  3T4S A;  3UB9 A;  3UE3 A;  5IU1 A;  1TS8 A;  3LIE A;  2ZBB A;  5KIZ A;  4IJG A;  2VGL M;  2QWS A;  3F1O A;  3HCY A;  4BBT A;  3EGD C;  2OAQ 1;  4E04 A;  1OJG A;  1OTE A;  2NUT C;  4HIA A;  3S7N A;  3E4Q A;  4JGQ A;  2WKP A;  3PBQ A;  5IS1 A;  2XRN A;  3EEH A;  2M7U A;  3VOL A;  3EWK A;  3B42 A;  4CLC B;  2KOI A;  1XFN A;  4K08 A;  1UWP X;  4XT2 B;  1OTA A;  2M7V A;  2P04 A;  3BQ8 A;  4WF0 A;  2Y79 A;  4GHI B;  3H9W A;  2VJW A;  3MXQ A;  5DFX A;  3FPW A;  4NEE D;  3FG8 A;  2K31 A;  4BMW A;  4OOL A;  3P01 A;  3CUE A;  3T4J A;  3V67 A;  3B33 A;  2I9V A;  2Z6D A;  2W3G A;  3OCL A;  1NWZ A;  3VV4 A;  1GSV A;  2VLG A;  4B93 A;  3IS2 B;  5KSH A;  5HD3 A;  1F9I A;  2H28 A;  4Q0J A;  1YSP A;  2J80 A;  1NRJ A;  3MFX A;  3FPV A;  5A8B A;  3T4L A;  4I39 A;  4DJ3 A;  4G3K A;  3H7W A;  2P08 A;  3T4T A;  3FC7 A;  4WEK A;  1TS0 A;  2B02 A;  4CQH A;  3OLO A;  2PR6 A;  5DKK A;  2PHY A;  5CX7 A;  4GS9 A;  4ARZ A;  2W1R A;  2HGV A;  3UB6 A;  5HZH A;  2FZ0 A;  1T19 A;  1F5M A;  2LB9 A;  4EEP A;  2O99 A;  3LIF A;  2W3F A;  4II7 A;  1G28 A;  3G6O A;  1XJ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...