4P6ZS

Crystal structure of the human bst2 cytoplasmic domain and the hiv-1 vpu cytoplasmic domain bound to the clathrin adaptor protein complex 1 (ap1) core
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
147
structure length
147
Chain Sequence
MMRFMLLFSRRGKLRLQKWYLATSDKERKKMVRELMQVVLARKPKMCSFLEWRDLKVVYKRYASLYFCCAIEGQDNELITLELIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLMGGDVQDTSKKSVLKAIEQADLLQEEDES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords AP-1 complex subunit gamma-1
publication title Structural basis of HIV-1 Vpu-mediated BST2 antagonism via hijacking of the clathrin adaptor protein complex 1.
pubmed doi rcsb
source organism Mus musculus
total genus 53
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2014-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01217 Clat_adaptor_s Clathrin adaptor complex small chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.60 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4p6zS00
2JKTI 1NRJA 2FH5A 2XA7S 4NEED 2JKRI 4UQIM 2VGLS 4P6ZM 2JKTM 3TJZC 1W63M 2XA7M 5MC7A 2JKRM 2VGLM 1W63Q 4UQIS 2HF6A 4P6ZS
chains in the Genus database with same CATH superfamily
3N7WA 2K7SA 4GW9A 3A3JA 5EVID 5CERA 2XK1A 1HZOA 4PM9A 3LUQA 4DXBA 2ZJ9A 5EVIA 1LSWA 3W2ZA 5CECA 3KSGA 5E2GA 1TVFA 4XT2A 2QJ7A 3LFVA 3T4QA 5CGWA 3KSFA 4NXFA 4Q0JA 4WBGA 4E3IA 3PHYA 3RTYA 1G5UA 3S7OA 1S0WA 3N4IA 1DJBA 3UPOA 1N4OA 1N9LA 3T1QB 1YPRA 4X1MA 3LEZA 4EUZA 4UA9A 5CEBA 2O0YA 3ZG0A 3SH7A 2HDUA 2X02A 3HUOA 1YLPA 1YKDA 1N9OA 2Z6DA 1JWVA 3LIDA 4P85A 1H8ZA 5F82A 4WM9A 2WGWB 3Q1FA 1PI4A 3ZHHA 4HBUA 4ZJ2A 4F94A 1QMEA 5E43A 3UMEA 2GJ3A 2W3EA 3M2KA 2H10A 3ZVTA 3EQUA 2WK0A 2V0UA 4JXWA 3CUEC 3QP6A 5KZHA 2OLUA 5FASA 4B88A 1FQGA 4HESA 3O86A 4OKPA 3BFGA 1S6RA 1PNEA 2ZQ9A 3T4LA 5F6AA 4P0MA 5DVAA 3DWKA 2XGNA 1PIOA 3U2AA 4RX2A 5CTNA 1LL5A 4Y15A 3T1SA 3CLOA 5A8BA 5EV0A 3IF6B 1E4DA 3SZTA 5HWWA 2Y2JA 3BEBA 1ONGA 2ZQ8A 3G31A 2OAP1 1H3QA 4UAAA 2X01A 1P9RA 2PYRA 2WGWA 2HGVA 2FZ0A 1GHIA 2GX5A 3LY4A 1EROA 1V9ZA 3FPVA 5FAQA 5FQIA 2W1TA 3Q07A 4ZRRA 2G2WA 2O9CA 4NG2A 1FCMA 3KYZA 2HP5A 2J3TC 5DKLA 4WF0A 3GRJA 4DDYA 1EI5A 1NZUA 5FI6A 5IT5A 2XDMA 1H5XA 3FV7A 3UN7A 4E3OA 1I2WA 2OWJA 5TBMB 5EOOA 3TOIA 1RGYA 3U4LP 2Y2LA 4Q8IA 1MWRA 3EWKA 3TW8A 4MN6A 3G6OA 4BJPA 2G7UA 2ZMVA 3S7PA 5GLDA 5A92A 3GTCA 4NK3A 1FR1A 1KE0A 1YQSA 1GSXA 1OMEA 1Z09A 5EUAA 3ISGA 1MPLA 1G6AA 4X68A 4PPRA 4KG5A 5EVEA 1BSGA 3UNWA 2PRFA 2RL3A 4Z9QA 1Q2QA 2A24B 1HD8A 3PBNA 4S2IA 2ZQDA 3WS5A 2H5SA 5TBMA 2JCHA 1GA0A 3GV9A 2V1BA 3KSHA 3LGOA 4DE0A 2DNSA 2V0WA 3UMDA 2LB9A 4N92A 3PAEA 4MEZA 3MR0A 2XD5A 3VP1A 1P9WA 2PR5A 4Y5FA 4S2NC 5F5YA 2OSUA 5FEGA 2VV8A 5A91A 3VFFA 3ZG7B 3VV4A 3LIFA 4JGQA 3IX8A 3BJNA 3LICA 2WADA 4P6ZS 3MF0A 1JTDA 3EEHA 3CAXA 4OONA 2Y59A 3P98A 3LR5A 5HPFA 5HDSA 2PBDP 4E3KA 4QU3A 3NCKA 3B42A 4BMWA 5GLCA 3A3DA 1KVLA 2A24A 5L09A 5HDCA 3HLCA 1ONHA 3ZNTA 4GZBA 1TD5A 2A49A 4GS9B 1JVJA 4DRTA 3SH9A 3N8LA 1SKOB 5G18A 4EESA 4R6LA 4EQIA 3VE4A 5JYPA 3FKVA 1BLHA 2ZM0A 2E8IA 3PBOA 3C38A 4EBPA 4Y13A 3WS1A 3D4FA 4JPMA 3HLDA 3NECA 5U47A 1XP4A 3C5AA 1ES5A 4I3IA 3F1NB 2ZC6B 3SOIA 4OH0A 4PM5A 3P7NA 3ZDJA 5FQMA 2B5RA 2WUQA 5FQQA 4OPZA 3UB8A 4DDSA 3HLFA 3WS4A 4E6WA 3HLEA 3MSHA 4EETB 5EOEA 1S1ZA 2W3FA 1RP5A 4NXGA 3IXHA 4PM6A 3MKEA 3T4SA 1ES3A 4O0PA 2PU2A 1SKOA 2JKGA 3SH8A 1EWZA 2Y55A 3ZFZA 2JE5A 4UA6A 3WWXA 4LRZE 5HX9A 3F1NA 3L7HA 4GKUA 1OJ5A 4HIAA 5GHXA 4PAUA 3PYPA 1W8QA 3IXGA 1L3LA 1V9YA 1XGJA 4PHTA 1JWPA 4LENA 2XROA 3V39A 3FG8A 4X69A 4DJ3A 3HVFA 3D72A 3TJZC 3H9WA 5LBRA 2Y91A 4D2OA 3CITA 4QY5A 5DJUA 1F2KA 2Y2QA 3NHQA 4DJ2A 3QP8A 5GLBA 2NUPC 4O7DA 1J9MA 2INWA 4MNRA 3P01A 2P7JA 3A0SA 3RJUA 3IX4A 4WL9A 3T4JA 3WRTA 1W79A 3W8KA 4DMZA 1XJ6A 1LL8A 4S2KA 2WAEA 4PKYA 2V1ZA 1T18A 4GD6A 1LI9A 2PR6A 2DMWA 4JF5A 3ICYA 4WEKA 3ITBA 4X55A 4I3AA 3PR6A 1ZHHB 1PW8A 4E04A 4YINA 1T1AA 3VOZA 1L0DA 5DKKA 1IYPA 1PZPA 4JXSA 3D3OA 1TS7A 5AVFA 1NWZA 3R4KA 2J80A 2FH5A 1YLZA 1J3WA 1CQAA 5CHJA 1DJCA 1FOFA 2B18A 3ZVWA 4D60A 4BBVA 4ETXA 4JXGA 4KQOA 4XUXA 4KQQA 2X71A 1JTGA 2Y2HA 3CPTA 3FC7A 2ZM8A 2JKRM 4OLDA 1L0FA 1CEGA 4FD8A 1MBLA 3VP0A 1YLWA 3QHYA 1T19A 4EBNA 3IHAA 1VEUA 4ZJ3A 1FCNA 4OOMA 5DFXA 4KZ4A 4HI4A 4N1XA 5AQBA 4UA7A 1MZUA 3C4OA 3UB9A 5FQJA 2FFFB 3F1PB 3UE3A 2WGVA 4AFIA 3OLOA 1BYWA 5I5LA 1OT9A 4EBLA 3LIBA 5EVIB 2OAQ1 5FDHA 3ULFA 1BUEA 4QY6A 4RA7A 2QPNA 3IXDA 3MJQA 4GOGA 4S2LA 4EXOA 2HZ5A 4XT2B 3ZGAB 4S2PA 5DJTA 1Y4OA 4BD0A 3V3RA 1ES2A 1SZVA 1W7FA 3GR2A 2OV5A 5HFOA 4I38A 1MWSA 5L07A 2VGLS 2OWHA 4GN2A 3BFDA 4Y7PA 4CQHA 3D9YA 2FFYA 4GHIB 3BY9A 1W63Q 1TEMA 3NBLA 3ZYTA 4NKPA 4II7A 1W5DA 2H0TA 3NDGA 3F1PA 3JYIA 3NJAA 4UQIM 1DP9A 1F9IA 4H6JB 3UE6A 5CX7A 2ZC3B 5CTMA 3WS2A 4WZ5A 4N9KA 3Q7ZA 1LI0A 4OOYA 3HREA 1BLPA 5J3WA 2KOIA 4F3LB 3MXRA 4X1LA 4ARZB 1UGUA 3LIEA 3A0VA 2WAFA 3GSGA 5F68A 4JLFA 4BL2A 1CI9A 1KOUA 2XR0A 3ZG5A 3MZDA 1YMSA 2XFSA 4GHIA 4OQIA 2P74A 5GLAA 3HLGA 4GCZA 3A3IA 3TRCA 1JWZA 5DFYA 1VM1A 2R9XA 2XQZA 3HUMA 4WLAA 1SHVA 4H6JA 4YNRA 2J3WA 2W1TB 2WKPA 1IFQA 4KZ9A 5AQ7A 4I3JA 3KYQA 3VSKA 3LR0A 1MKIA 2HF6A 3UDFA 2O9BA 5FQ9A 5HSQA 3C30A 4IUHA 5CHMA 4F3LA 4ARZA 4KQRA 1GHPA 4FUWA 2EWWA 3DTIA 3EGDC 1XKZA 4QD4A 2QWSA 4ZTKA 3OCLA 4NETA 3Q81A 2XF3A 1A0KA 1XJ4A 1OTBA 4EERA 5M18A 1U60A 1IKGA 2H28A 2EFXA 3E4OA 3UB5P 1IOUA 4XXRA 2PAVP 2VX8A 5CRFA 1L0EA 4RYEA 4GD8A 1OT6A 1PW1A 3O88A 4HJ6A 4EEUA 4QB8A 1S1YA 1KGFA 2IWCA 3F1OB 2EX2A 3MQOA 4R70A 4MBKA 4OVDA 2DCFA 5AVEA 1ODVA 4Y17A 4R0QA 3SS4A 2QHKA 5IHVA 2M1CA 2VKSA 3CZDA 4OPRA 1OTEA 5EVLA 1S4SA 3PBRA 3E98A 5KSCA 4KZ8A 3GDIA 3ZCZA 5HAIA 4HH3A 4HJ4A 3VOLA 3A0RA 4ETZA 3DTMA 5HL1A 2XFTA 2UWXA 3EOIA 1GSWA 1KGGA 4UHUA 1K54C 1JNUA 4HEFA 4ZAMA 4EUVA 3PAGA 2V1AA 4RQ9A 4I5SA 2PHYA 2XD1A 2J9PA 2EX8A 3UB7A 5KIZA 4LCLA 5E2FA 1XFQA 2J8YA 1LSVA 1L0GA 3F1OA 4NEED 4Y0OA 2JKRI 2OOLA 1LSXA 3CUEA 4EQ1A 1E3UD 2W3GA 4OQGA 4Z1WA 2XRNA 1VHMA 3FPWA 1S66L 1E3UA 3MS6A 1MWUA 1GSVA 4LRXC 2XEPA 4BENA 2BG1A 1AXBA 2J9OA 1SDEA 4B4XA 3V50A 2XA7S 3LR3A 2ZQAA 3LCEA 5HAPA 3G2ZA 3MMHA 2L4RA 1ZC2A 3TSGA 3IS2A 3LI8A 3IF5A 2HJEA 4R4SA 1I5QA 4OLGA 1F98A 2VGLM 2Z2MB 1GCEA 2JKTI 2PD7A 1OTDA 2J3TD 3RH8B 1TDLA 4YWZA 4GNUA 3V3SA 2AVXA 2XH9A 4QWOA 1LL9A 4CPKA 2L1MA 2V8CA 3HJIA 3BFFA 5L8MA 1BULA 4X25A 4B4ZA 3IX3A 1CJFA 1ACFA 2ZQ7A 3T50A 2XSSA 5HWTA 3HBRA 3CWFA 5CXWA 2WKIA 2BTFP 1D1JA 4HP4A 3G30A 2V9AA 5FAPA 4WN5A 4FCFA 1D7EA 5A93A 1ERQA 1D06A 3SS5A 2M7VA 3LIAA 4H8RA 4CJNA 3MZEA 3RXWA 4OP5A 3HL9A 3EGXC 4GB7A 3O87A 4FTXA 4DE1A 2UV0E 3VP2A 3IH9A 4L9EA 5EM1A 3T12B 4JGPA 4UQIS 3RXXA 3PBTA 3C2WA 1CI8A 5HAQA 5DF7A 3GECA 2W1RA 4LCMA 4JBFA 1PWGA 1N9NA 5AQ9A 4ZJ1A 3IXBA 2HJ9C 4S2NA 4R3BA 3NC8A 4DN0A 4MBHA 1K38A 4CLCE 2ZOHA 4JXVA 5FI2A 3N8SA 1PWCA 3NI9A 2Y79A 3OCNA 3BFCA 5DF8A 5EE8A 1GHMA 4LV2A 2IA2A 1WE4A 1K57C 3H7WB 2I72A 2Y8HA 5F1GA 4IEDA 4HH2A 2VEAA 4ID4A 2O9AA 1UWNX 1MY8A 2ACGA 3DTKA 1XGIA 2IWDA 2EX6A 4DKIA 1MKMA 1RGZA 1K6SA 4MBFA 4PM7A 4U0TA 5KMWA 2PYPA 3NIAA 4MDZA 3T4TA 4C6YA 4NXBA 4CLCC 1IYQA 1EW0A 1Y28A 3IQAA 4BWIA 3OC2A 2GDNA 4E3LA 3LY3A 2VA0A 1HLUP 4O01A 4WEJA 1TS0A 3CPTB 4K0XA 4RVAA 1FCOA 1XXMA 5FEFA 3H7WA 2MJ6A 3FKWA 2QJ5A 4BBUA 5M19A 4C75A 4EV4A 2V2FF 4OPYA 2P04A 5HARA 1K6RA 1VEUB 3KX0X 3OZHA 3SS3A 5K5BA 3NULA 3Q7VB 2WKQA 1S4RA 4RX3A 3S7NA 3GVBA 1BLCA 5E2HA 3SW1A 3VSLA 3WS0A 3ZG8B 3OPHA 3KYEA 1M40A 5GHYA 4R23A 5FDSA 3NOUC 4UEYA 1H8MA 2A2LA 5G4YA 4Y0TA 3HUNA 3WRZA 2ZMFA 2H0YA 1N9BA 2W3HA 4HJ3A 5EFWA 2VK3A 2C5WB 5EM0A 4IJGA 2B95A 1T1CA 4MN7A 5TGFA 4P6BA 3BLMA 2XA7M 1CEFA 1S67L 1FSYA 1TS6A 4BL3A 1NLZA 5IS1A 4JGOA 1PRQA 1WA9A 4IVKA 1T1BA 4KZ7A 5EVIC 1XJ3A 2QZ6A 2L0WA 1Z6FA 1YLJA 3PBQA 1LT0A 2Y2OA 3Q7VA 4X56A 5F83A 3UE0A 3N8RA 4PM8A 1FILA 2WKRA 1K0KA 2ZQCA 2K2NA 3BECA 3QP5A 1LLBA 1NRJA 3LO7A 1YSQA 4L0LA 3BRMA 1ESUA 2ZBBA 3QNCA 1C3BA 2V20A 4BBTA 3BLSA 4PMAA 2JKTM 2OLVA 5HZHA 2KDKA 3BQ8A 3QP1A 3MFXA 3W4OA 4EW7A 5J8XA 3M6HA 5HDDA 5GHZA 1YSPA 3BWLA 4NXEA 4S2MA 5I94A 2BLSA 2PDRA 1K56D 1ALQA 4Y2FA 2XLNA 4EU0A 1K56A 5D3OA 1Y54A 3I7JA 4M3KA 5DF9A 5DTSA 2G2UA 2Y2GA 3W4QA 4OQHA 4JF6A 3UY6A 1OPXA 2HV1A 4BLMA 3S4XA 5G4ZA 4XUZA 1L2SA 4LFUA 3BM6A 4JF4A 4KUOA 5TJJA 3T4OA 2HP9A 1IKIA 2ZLYA 2HDRA 1H8YA 4U0XA 1BLSA 2VV7A 4YOFA 3HJKA 3EQVA 2WYXA 4X53A 2JBFA 3TG9A 1NYYA 3CI6A 4WZ4A 1VETA 2QYBA 2QKPA 5AJGA 2YKHA 3MBZA 4ZDXA 3BW6A 2I9VA 4G3VA 5DTTA 3BQAA 2EX9A 1W63M 4IHQA 2M7UA 5L2FA 3IF6C 4GDBA 2PD8A 3G35A 4HP9A 3MXQA 2YKFA 4LLOB 4KZAA 1NZOA 2HDSA 3MFDA 4GDNA 5FL3A 2Y4AA 4LGWA 5JYOA 5TR7A 3QP4A 2R9WA 4FH2A 1VB6A 1NRFA 5L10A 5FA7A 2Y2MA 3S1YA 3FZCA 4LV1A 4B93A 4ESPA 3HCYA 5KSHA 2LB5A 1OTIA 4BD1A 2ZL1B 2GNXA 3IWIA 3GQZA 5DTKA 1NYMA 3ZNYA 1NLYA 5FATA 4S2OA 3KSIA 5HD5A 2IWBA 2Z2LB 3AGEA 5BOHA 3G2YA 4R1GA 4R4RA 2KX6A 2Q9MA 3ITAA 4WMCD 3KO6A 4LV0A 2NUTC 4HQAA 3DW0A 1IYSA 4K0WA 4WMCA 3DTEA 2R78A 1IELA 4A5RA 3OOVA 2A3UA 4KUKA 3BYDA 1KE4A 1G68A 1MXOA 1DY6A 4Y0UA 3T1XA 2K31A 2GZAA 3N6IA 1MWTA 1PZOA 1STZA 3MQQA 3BY8A 3IS2B 2JC7A 2ZM2A 1WYBA 2D02A 2ZL1A 1DRMA 2DRWA 4KQDA 4Y3IA 5M1AA 3Q82A 4KENB 2Q9NA 1FR6A 1TS8A 1I2SA 2KLIA 3IF6A 3K3DA 1ES4A 1FIKA 4FSFA 4E3NA 3ZG9B 4I39A 3E2KA 1QMFA 1YT4A 2JKFA 1SKFA 3IT9A 3MXSA 4HBTA 3JVVA 5AQAA 3PXPA 3VMAA 5J4EA 2V8FA 1W8YA 3S7QA 1CF0A 2HP6A 4B9OA 1YMXA 3VOYA 2VV6A 3VP4A 3UDXA 1RCJA 4IBRA 3TE8A 4DF6A 1OTAA 1DP8A 1O07A 3E2LA 4S2JA 2Y2NA 4MLLA 3CG5A 4G3WA 2WGIA 3UB6A 3HLBA 4X6TA 3EEAA 3JVUA 3E4PA 4DE3A 3LEQA 4EEPA 1VQQA 2VGKA 3H82B 2ZC7A 2D01A 4R38A 4MMNA 1ZKJA 2VZWA 4Q0IA 3MKFA 4LRYC 2PU4A 1KE3A 5FQKA 1KGEA 3FWLA 2J7VA 2RCXA 1OJGA 3CMZA 3T1RA 4N9LA 3LI9A 3VP3A 2WZZA 3G34A 1K54A 2VJWA 2WZXA 2EFUA 2HPBA 5HL6A 3L9KA 4OP8A 1K4FA 2HDQA 3AGFA 3A3EA 3NOPC 2VLGA 5IU1A 2Y2PA 2Z6CA 2ZC5B 5HD3A 1XPBA 5TFQA 1TF1A 3MQ0A 1YM1A 3OPLA 5EECA 4KZ6A 4M4XA 1P0ZA 2JN7A 1BTLA 1M6KA 3S22A 3H82A 1X0OA 3DWZA 3IBRA 4JGRA 2W3DA 2ZMAA 1BZAA 3G4PA 1WYCA 4KZBA 1XA7A 2P08A 2P9VB 3PTEA 4O8GA 1H0MA 3P09A 3LR4A 1G28A 4WELA 5CGSA 2C6WB 1KVMA 1Q2PA 3RFBA 5A90A 3VE3A 2O99A 3LYXA 3C7VA 1DP6A 4GS9A 3C4PA 2CMNA 3ZQ5A 4L9FA 3FYZA 2EWVA 1NXYA 5FI7A 1YLYA 4JKTA 1XFNA 4ME4A 2VGJA 4HY8A 3IWOA 5HWVA 2W27A 2ZOIA 5EPHA 3B33A 2B02A 1E25A 2W0NA 3E0YA 1P97A 4OOLA 4QHCA 4IVIA 4E6XA 4GJ4A 3BFEA 3CHWP 3MZFA 2P9VA 1XJ2A 1ESIA 1ERMA 5CEDA 3UPPA 2CC1A 2PBYA 1PFLA 1O7EA 3B47A 3NDEA 4BQMA 3IBJA 2ZC4B 4HOIA 4C3QA 3M6BA 4HNBA 1IYOA 3CJMA 1MC0A 4FOFA 5F69A 3GMWA 1GA9A 4YFMA 3IWQA 4R3JA 5FAOA 3QP2A 3G32A 1XX2A 3C7UA 1K25A 1TDGA 4DE2A 2E8JA 4KG6A 4G3KA 4N1HA 3R7WB 3O5YA 3NOTC 5MC7A 3UE1A 4CLCB 3A3FA 5GL9A 4LV3A 1ZTUA 3NY4A 4OQ0A 4L9GA 4OPQA 5F1FA 1K4EA 2ZD8A 4R3AA 3PBSA 4KZ5A 4Q0HA 3UDIA 1PYYA 1FSWA 4MN5A 3DBAA 5CHUA 1NY0A 4KG2A 3HLWA 4K08A 1SCWA 1K55C 1F5MA 1K57A 3E4QA 4WUJA 3V5MA 3K3CA 1YAXA 3W4PA 2EA9A 4U3TA 1HVBA 4E3JA 3B3XA 5HPIA 4WZ5C 2EXBA 3T4KA 2BASA 3OPPA 4PKYG 1AWIA 1BT5A 3QNBA 1NJ4A 4CLCD 2QMIA 1ZG6A 1XA1A 3R7WA 4CLCA 3V67A 2EXAA 1G6OA 3UPNA 2PT7A 3OPRA 4IBXA 3C8CA 1CK3A 4P6ZM 1IEMA 3UO9A 4P87A 3DAVA 3K2NA 4GLQA 3JPUA 5C5KA 3OBFA 1SDNA 1ZG4A 4E3MA 2Y2KA 1UWPX 1KDSA 4MCWA 2WKEA 4ZBEA 2Y2IA 4HHDA 4KZ3A 4DXCA 3IH8A 3VFHA 2WKHA 3O3VA 1HTZA 1YLTA 4QJGA 1VETB 5J7EA 4LPZA 4K91A 1KDWA 2Q0OA 1PWDA 1DJAA 4FH4A 5CGXA 5FSRA 4WYYA 3M2JA 2JHEA 5E2EA 4EWFA 1PI5A 5HW3A 3IHBA 3AGDA 4QPRA 4IUKA 1LHYA 1K55A
chains in the Genus database with same CATH topology
2M7VA 2GZAA 1T18A 2K7SA 4GW9A 2PR6A 1STZA 2DMWA 3ICYA 3MQQA 4WEKA 3LUQA 3BY8A 3IS2B 3LIAA 4I3AA 3PR6A 1ZHHB 2D02A 4E04A 1T1AA 1DRMA 3EGXC 4KQDA 1LSWA 3W2ZA 4L9EA 5DKKA 4Y3IA 3KSGA 4JGPA 4XT2A 4UQIS 2QJ7A 3LFVA 3T4QA 3D3OA 1TS7A 5AVFA 3KSFA 1NWZA 3R4KA 2J80A 2FH5A 4NXFA 4Q0JA 2B18A 1TS8A 3PHYA 3RTYA 3PBTA 3S7OA 4BBVA 3C2WA 2KLIA 4ETXA 3K3DA 3GECA 2W1RA 4KQOA 1N9LA 4FSFA 1N9NA 3FC7A 4I39A 2O0YA 2HJ9C 4DN0A 2JKRM 4CLCE 2ZOHA 1YKDA 1N9OA 2Z6DA 3LIDA 1T19A 3JVVA 2Y79A 3PXPA 5J4EA 3OCNA 3S7QA 4OOMA 2IA2A 4B9OA 3H7WB 5DFXA 2Y8HA 4HI4A 4HH2A 2VEAA 2VV6A 2O9AA 1MZUA 3UMEA 1UWNX 2GJ3A 2W3EA 3UB9A 3TE8A 3EQUA 2V0UA 3F1PB 3CUEC 3UE3A 4AFIA 1OTAA 1DP8A 1MKMA 3OLOA 1BYWA 5I5LA 1OT9A 3LIBA 2OAQ1 2PYPA 4G3WA 3ULFA 3UB6A 3T4LA 5F6AA 4MDZA 3T4TA 4NXBA 4CLCC 3EEAA 3MJQA 3JVUA 4EXOA 4XT2B 3E4PA 1EW0A 5DJTA 1Y28A 3U2AA 4EEPA 3H82B 2D01A 4BWIA 3OC2A 4R38A 4MMNA 3CLOA 5A8BA 2VA0A 2VZWA 4I38A 4Q0IA 4LRYC 5HWWA 4O01A 4WEJA 1TS0A 2VGLS 2OWHA 2OAP1 1H3QA 1P9RA 2PYRA 4CQHA 1OJGA 2HGVA 3H7WA 3LI9A 2FZ0A 4GHIB 2GX5A 2MJ6A 3BY9A 1V9ZA 2VJWA 3FPVA 2W1TA 2QJ5A 4ZRRA 4BBUA 1W63Q 2O9CA 5HL6A 3KYZA 5DKLA 2J3TC 2P04A 4WF0A 3ZYTA 4NKPA 4II7A 3KX0X 5K5BA 3NOPC 2VLGA 3F1PA 5IT5A 5IU1A 2WKQA 3NJAA 4UQIM 1DP9A 1S4RA 1F9IA 4H6JB 3S7NA 2Z6CA 3UE6A 5CX7A 5HD3A 2OWJA 3SW1A 5TBMB 1TF1A 3MQ0A 4M4XA 1P0ZA 2JN7A 3NOUC 4UEYA 1H8MA 2A2LA 5G4YA 5J3WA 2KOIA 4F3LB 3H82A 3EWKA 4ARZB 2ZMFA 1UGUA 1X0OA 3TW8A 3LIEA 4MN6A 2W3HA 3A0VA 3G6OA 4HJ3A 5EFWA 4BJPA 2G7UA 2ZMVA 3IBRA 4JGRA 4IJGA 2W3DA 3S7PA 5F68A 1T1CA 4MN7A 1KOUA 2P08A 4O8GA 2XA7M 1S67L 1GSXA 3LR4A 1G28A 4WELA 1TS6A 5IS1A 1NLZA 4JGOA 4GHIA 1WA9A 3RFBA 1T1BA 3VE3A 4GCZA 2O99A 3TRCA 3LYXA 4GS9A 1DP6A 1XJ3A 2L0WA 2CMNA 3ZQ5A 3PBQA 1LT0A 4L9FA 5DFYA 2EWVA 4WLAA 2A24B 4H6JA 4YNRA 2J3WA 2WKRA 3PBNA 2W1TB 1XFNA 2WKPA 4ME4A 1IFQA 5TBMA 4I3JA 2K2NA 4HY8A 3KYQA 2V1BA 3LR0A 2HF6A 3KSHA 2V0WA 3UMDA 2LB9A 2O9BA 1NRJA 5HWVA 2W27A 2ZOIA 3C30A 4IUHA 1YSQA 5HSQA 3MR0A 4L0LA 1P9WA 2PR5A 3B33A 2ZBBA 2B02A 4Y5FA 2W0NA 3E0YA 4F3LA 5F5YA 4ARZA 1P97A 4OOLA 4BBTA 2VV8A 2EWWA 3EGDC 3LIFA 3VV4A 2QWSA 2JKTM 4JGQA 4GJ4A 3OCLA 5HZHA 2KDKA 3BQ8A 1XJ2A 1XJ4A 3BJNA 1OTBA 3MFXA 4EERA 3LICA 4EW7A 4P6ZS 3MF0A 3EEHA 3CAXA 5HDDA 2H28A 3B47A 1YSPA 3E4OA 3LR5A 3IBJA 5HPFA 5HDSA 1IOUA 4HOIA 2VX8A 3B42A 3BWLA 4BMWA 4NXEA 4HNBA 1MC0A 1OT6A 4HJ6A 2PDRA 4FOFA 5F69A 2A24A 5HDCA 4Y2FA 4EEUA 1S1YA 3F1OB 3MQOA 4EU0A 4R70A 1TD5A 4GS9B 5DF9A 5AVEA 4EESA 1ODVA 2QHKA 4R6LA 3VE4A 2M1CA 2VKSA 1OTEA 1S4SA 3PBRA 3E98A 4G3KA 3R7WB 3O5YA 3NOTC 1OPXA 3PBOA 2HV1A 3C38A 5MC7A 4CLCB 1ZTUA 3GDIA 5G4ZA 4HH3A 4L9GA 4HJ4A 3VOLA 3A0RA 4R3AA 3PBSA 4ETZA 4KUOA 5TJJA 4I3IA 3T4OA 3F1NB 4Q0HA 3EOIA 1GSWA 4MN5A 3DBAA 1JNUA 4EUVA 3P7NA 2VV7A 4YOFA 3HJKA 3EQVA 4K08A 2V1AA 4RQ9A 4I5SA 2PHYA 1F5MA 3UB8A 3UB7A 3E4QA 4WUJA 5KIZA 3K3CA 1YAXA 1XFQA 3CI6A 2EA9A 1LSVA 4EETB 2QYBA 1S1ZA 3F1OA 2W3FA 4NXGA 2QKPA 5AJGA 2YKHA 3T4SA 5HPIA 4O0PA 4NEED 2JKRI 2OOLA 1LSXA 3BW6A 3CUEA 3T4KA 2BASA 4PKYG 2I9VA 4G3VA 4EQ1A 2W3GA 4Z1WA 2XRNA 3BQAA 1W63M 4IHQA 1VHMA 4CLCD 3FPWA 2M7UA 1S66L 1GSVA 4LRXC 3R7WA 4CLCA 4LRZE 3V67A 2PD8A 1G6OA 4HP9A 2PT7A 3MXQA 2YKFA 4LLOB 2XA7S 3LR3A 3C8CA 3MMHA 2L4RA 4P6ZM 5FL3A 3F1NA 3IS2A 3LI8A 3K2NA 2HJEA 4GLQA 5C5KA 1VB6A 1OJ5A 3OBFA 1F98A 4HIAA 2VGLM 4PAUA 3PYPA 1UWPX 4MCWA 4B93A 1V9YA 2JKTI 2PD7A 4PHTA 1OTDA 2J3TD 3HCYA 3RH8B 5KSHA 4HHDA 2LB5A 1OTIA 2XROA 4YWZA 3FG8A 4DJ3A 2GNXA 1NLYA 2L1MA 3HJIA 3D72A 3KSIA 3H9WA 3TJZC 5HD5A 5L8MA 5LBRA 3CITA 5DJUA 3NHQA 5J7EA 2KX6A 4DJ2A 4LPZA 2NUPC 3T50A 2XSSA 5HWTA 3KO6A 2INWA 2NUTC 3P01A 4HQAA 3CWFA 2P7JA 3A0SA 4WL9A 4HP4A 3T4JA 2JHEA 2V9AA 2R78A 4WN5A 4DMZA 3OOVA 1XJ6A 1LL8A 4KUKA 1D7EA 4QPRA 4IUKA 1D06A 4PKYA 2K31A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JKT I;  1NRJ A;  2FH5 A;  2XA7 S;  4NEE D;  2JKR I;  4UQI M;  2VGL S;  4P6Z M;  2JKT M;  3TJZ C;  1W63 M;  2XA7 M;  5MC7 A;  2JKR M;  2VGL M;  1W63 Q;  4UQI S;  2HF6 A;  4P6Z S; 
#chains in the Genus database with same CATH topology
 3N7W A;  2K7S A;  4GW9 A;  3A3J A;  5EVI D;  5CER A;  2XK1 A;  1HZO A;  4PM9 A;  3LUQ A;  4DXB A;  2ZJ9 A;  5EVI A;  1LSW A;  3W2Z A;  5CEC A;  3KSG A;  5E2G A;  1TVF A;  4XT2 A;  2QJ7 A;  3LFV A;  3T4Q A;  5CGW A;  3KSF A;  4NXF A;  4Q0J A;  4WBG A;  4E3I A;  3PHY A;  3RTY A;  1G5U A;  3S7O A;  1S0W A;  3N4I A;  1DJB A;  3UPO A;  1N4O A;  1N9L A;  3T1Q B;  1YPR A;  4X1M A;  3LEZ A;  4EUZ A;  4UA9 A;  5CEB A;  2O0Y A;  3ZG0 A;  3SH7 A;  2HDU A;  2X02 A;  3HUO A;  1YLP A;  1YKD A;  1N9O A;  2Z6D A;  1JWV A;  3LID A;  4P85 A;  1H8Z A;  5F82 A;  4WM9 A;  2WGW B;  3Q1F A;  1PI4 A;  3ZHH A;  4HBU A;  4ZJ2 A;  4F94 A;  1QME A;  5E43 A;  3UME A;  2GJ3 A;  2W3E A;  3M2K A;  2H10 A;  3ZVT A;  3EQU A;  2WK0 A;  2V0U A;  4JXW A;  3CUE C;  3QP6 A;  5KZH A;  2OLU A;  5FAS A;  4B88 A;  1FQG A;  4HES A;  3O86 A;  4OKP A;  3BFG A;  1S6R A;  1PNE A;  2ZQ9 A;  3T4L A;  5F6A A;  4P0M A;  5DVA A;  3DWK A;  2XGN A;  1PIO A;  3U2A A;  4RX2 A;  5CTN A;  1LL5 A;  4Y15 A;  3T1S A;  3CLO A;  5A8B A;  5EV0 A;  3IF6 B;  1E4D A;  3SZT A;  5HWW A;  2Y2J A;  3BEB A;  1ONG A;  2ZQ8 A;  3G31 A;  2OAP 1;  1H3Q A;  4UAA A;  2X01 A;  1P9R A;  2PYR A;  2WGW A;  2HGV A;  2FZ0 A;  1GHI A;  2GX5 A;  3LY4 A;  1ERO A;  1V9Z A;  3FPV A;  5FAQ A;  5FQI A;  2W1T A;  3Q07 A;  4ZRR A;  2G2W A;  2O9C A;  4NG2 A;  1FCM A;  3KYZ A;  2HP5 A;  2J3T C;  5DKL A;  4WF0 A;  3GRJ A;  4DDY A;  1EI5 A;  1NZU A;  5FI6 A;  5IT5 A;  2XDM A;  1H5X A;  3FV7 A;  3UN7 A;  4E3O A;  1I2W A;  2OWJ A;  5TBM B;  5EOO A;  3TOI A;  1RGY A;  3U4L P;  2Y2L A;  4Q8I A;  1MWR A;  3EWK A;  3TW8 A;  4MN6 A;  3G6O A;  4BJP A;  2G7U A;  2ZMV A;  3S7P A;  5GLD A;  5A92 A;  3GTC A;  4NK3 A;  1FR1 A;  1KE0 A;  1YQS A;  1GSX A;  1OME A;  1Z09 A;  5EUA A;  3ISG A;  1MPL A;  1G6A A;  4X68 A;  4PPR A;  4KG5 A;  5EVE A;  1BSG A;  3UNW A;  2PRF A;  2RL3 A;  4Z9Q A;  1Q2Q A;  2A24 B;  1HD8 A;  3PBN A;  4S2I A;  2ZQD A;  3WS5 A;  2H5S A;  5TBM A;  2JCH A;  1GA0 A;  3GV9 A;  2V1B A;  3KSH A;  3LGO A;  4DE0 A;  2DNS A;  2V0W A;  3UMD A;  2LB9 A;  4N92 A;  3PAE A;  4MEZ A;  3MR0 A;  2XD5 A;  3VP1 A;  1P9W A;  2PR5 A;  4Y5F A;  4S2N C;  5F5Y A;  2OSU A;  5FEG A;  2VV8 A;  5A91 A;  3VFF A;  3ZG7 B;  3VV4 A;  3LIF A;  4JGQ A;  3IX8 A;  3BJN A;  3LIC A;  2WAD A;  4P6Z S;  3MF0 A;  1JTD A;  3EEH A;  3CAX A;  4OON A;  2Y59 A;  3P98 A;  3LR5 A;  5HPF A;  5HDS A;  2PBD P;  4E3K A;  4QU3 A;  3NCK A;  3B42 A;  4BMW A;  5GLC A;  3A3D A;  1KVL A;  2A24 A;  5L09 A;  5HDC A;  3HLC A;  1ONH A;  3ZNT A;  4GZB A;  1TD5 A;  2A49 A;  4GS9 B;  1JVJ A;  4DRT A;  3SH9 A;  3N8L A;  1SKO B;  5G18 A;  4EES A;  4R6L A;  4EQI A;  3VE4 A;  5JYP A;  3FKV A;  1BLH A;  2ZM0 A;  2E8I A;  3PBO A;  3C38 A;  4EBP A;  4Y13 A;  3WS1 A;  3D4F A;  4JPM A;  3HLD A;  3NEC A;  5U47 A;  1XP4 A;  3C5A A;  1ES5 A;  4I3I A;  3F1N B;  2ZC6 B;  3SOI A;  4OH0 A;  4PM5 A;  3P7N A;  3ZDJ A;  5FQM A;  2B5R A;  2WUQ A;  5FQQ A;  4OPZ A;  3UB8 A;  4DDS A;  3HLF A;  3WS4 A;  4E6W A;  3HLE A;  3MSH A;  4EET B;  5EOE A;  1S1Z A;  2W3F A;  1RP5 A;  4NXG A;  3IXH A;  4PM6 A;  3MKE A;  3T4S A;  1ES3 A;  4O0P A;  2PU2 A;  1SKO A;  2JKG A;  3SH8 A;  1EWZ A;  2Y55 A;  3ZFZ A;  2JE5 A;  4UA6 A;  3WWX A;  4LRZ E;  5HX9 A;  3F1N A;  3L7H A;  4GKU A;  1OJ5 A;  4HIA A;  5GHX A;  4PAU A;  3PYP A;  1W8Q A;  3IXG A;  1L3L A;  1V9Y A;  1XGJ A;  4PHT A;  1JWP A;  4LEN A;  2XRO A;  3V39 A;  3FG8 A;  4X69 A;  4DJ3 A;  3HVF A;  3D72 A;  3TJZ C;  3H9W A;  5LBR A;  2Y91 A;  4D2O A;  3CIT A;  4QY5 A;  5DJU A;  1F2K A;  2Y2Q A;  3NHQ A;  4DJ2 A;  3QP8 A;  5GLB A;  2NUP C;  4O7D A;  1J9M A;  2INW A;  4MNR A;  3P01 A;  2P7J A;  3A0S A;  3RJU A;  3IX4 A;  4WL9 A;  3T4J A;  3WRT A;  1W79 A;  3W8K A;  4DMZ A;  1XJ6 A;  1LL8 A;  4S2K A;  2WAE A;  4PKY A;  2V1Z A;  1T18 A;  4GD6 A;  1LI9 A;  2PR6 A;  2DMW A;  4JF5 A;  3ICY A;  4WEK A;  3ITB A;  4X55 A;  4I3A A;  3PR6 A;  1ZHH B;  1PW8 A;  4E04 A;  4YIN A;  1T1A A;  3VOZ A;  1L0D A;  5DKK A;  1IYP A;  1PZP A;  4JXS A;  3D3O A;  1TS7 A;  5AVF A;  1NWZ A;  3R4K A;  2J80 A;  2FH5 A;  1YLZ A;  1J3W A;  1CQA A;  5CHJ A;  1DJC A;  1FOF A;  2B18 A;  3ZVW A;  4D60 A;  4BBV A;  4ETX A;  4JXG A;  4KQO A;  4XUX A;  4KQQ A;  2X71 A;  1JTG A;  2Y2H A;  3CPT A;  3FC7 A;  2ZM8 A;  2JKR M;  4OLD A;  1L0F A;  1CEG A;  4FD8 A;  1MBL A;  3VP0 A;  1YLW A;  3QHY A;  1T19 A;  4EBN A;  3IHA A;  1VEU A;  4ZJ3 A;  1FCN A;  4OOM A;  5DFX A;  4KZ4 A;  4HI4 A;  4N1X A;  5AQB A;  4UA7 A;  1MZU A;  3C4O A;  3UB9 A;  5FQJ A;  2FFF B;  3F1P B;  3UE3 A;  2WGV A;  4AFI A;  3OLO A;  1BYW A;  5I5L A;  1OT9 A;  4EBL A;  3LIB A;  5EVI B;  2OAQ 1;  5FDH A;  3ULF A;  1BUE A;  4QY6 A;  4RA7 A;  2QPN A;  3IXD A;  3MJQ A;  4GOG A;  4S2L A;  4EXO A;  2HZ5 A;  4XT2 B;  3ZGA B;  4S2P A;  5DJT A;  1Y4O A;  4BD0 A;  3V3R A;  1ES2 A;  1SZV A;  1W7F A;  3GR2 A;  2OV5 A;  5HFO A;  4I38 A;  1MWS A;  5L07 A;  2VGL S;  2OWH A;  4GN2 A;  3BFD A;  4Y7P A;  4CQH A;  3D9Y A;  2FFY A;  4GHI B;  3BY9 A;  1W63 Q;  1TEM A;  3NBL A;  3ZYT A;  4NKP A;  4II7 A;  1W5D A;  2H0T A;  3NDG A;  3F1P A;  3JYI A;  3NJA A;  4UQI M;  1DP9 A;  1F9I A;  4H6J B;  3UE6 A;  5CX7 A;  2ZC3 B;  5CTM A;  3WS2 A;  4WZ5 A;  4N9K A;  3Q7Z A;  1LI0 A;  4OOY A;  3HRE A;  1BLP A;  5J3W A;  2KOI A;  4F3L B;  3MXR A;  4X1L A;  4ARZ B;  1UGU A;  3LIE A;  3A0V A;  2WAF A;  3GSG A;  5F68 A;  4JLF A;  4BL2 A;  1CI9 A;  1KOU A;  2XR0 A;  3ZG5 A;  3MZD A;  1YMS A;  2XFS A;  4GHI A;  4OQI A;  2P74 A;  5GLA A;  3HLG A;  4GCZ A;  3A3I A;  3TRC A;  1JWZ A;  5DFY A;  1VM1 A;  2R9X A;  2XQZ A;  3HUM A;  4WLA A;  1SHV A;  4H6J A;  4YNR A;  2J3W A;  2W1T B;  2WKP A;  1IFQ A;  4KZ9 A;  5AQ7 A;  4I3J A;  3KYQ A;  3VSK A;  3LR0 A;  1MKI A;  2HF6 A;  3UDF A;  2O9B A;  5FQ9 A;  5HSQ A;  3C30 A;  4IUH A;  5CHM A;  4F3L A;  4ARZ A;  4KQR A;  1GHP A;  4FUW A;  2EWW A;  3DTI A;  3EGD C;  1XKZ A;  4QD4 A;  2QWS A;  4ZTK A;  3OCL A;  4NET A;  3Q81 A;  2XF3 A;  1A0K A;  1XJ4 A;  1OTB A;  4EER A;  5M18 A;  1U60 A;  1IKG A;  2H28 A;  2EFX A;  3E4O A;  3UB5 P;  1IOU A;  4XXR A;  2PAV P;  2VX8 A;  5CRF A;  1L0E A;  4RYE A;  4GD8 A;  1OT6 A;  1PW1 A;  3O88 A;  4HJ6 A;  4EEU A;  4QB8 A;  1S1Y A;  1KGF A;  2IWC A;  3F1O B;  2EX2 A;  3MQO A;  4R70 A;  4MBK A;  4OVD A;  2DCF A;  5AVE A;  1ODV A;  4Y17 A;  4R0Q A;  3SS4 A;  2QHK A;  5IHV A;  2M1C A;  2VKS A;  3CZD A;  4OPR A;  1OTE A;  5EVL A;  1S4S A;  3PBR A;  3E98 A;  5KSC A;  4KZ8 A;  3GDI A;  3ZCZ A;  5HAI A;  4HH3 A;  4HJ4 A;  3VOL A;  3A0R A;  4ETZ A;  3DTM A;  5HL1 A;  2XFT A;  2UWX A;  3EOI A;  1GSW A;  1KGG A;  4UHU A;  1K54 C;  1JNU A;  4HEF A;  4ZAM A;  4EUV A;  3PAG A;  2V1A A;  4RQ9 A;  4I5S A;  2PHY A;  2XD1 A;  2J9P A;  2EX8 A;  3UB7 A;  5KIZ A;  4LCL A;  5E2F A;  1XFQ A;  2J8Y A;  1LSV A;  1L0G A;  3F1O A;  4NEE D;  4Y0O A;  2JKR I;  2OOL A;  1LSX A;  3CUE A;  4EQ1 A;  1E3U D;  2W3G A;  4OQG A;  4Z1W A;  2XRN A;  1VHM A;  3FPW A;  1S66 L;  1E3U A;  3MS6 A;  1MWU A;  1GSV A;  4LRX C;  2XEP A;  4BEN A;  2BG1 A;  1AXB A;  2J9O A;  1SDE A;  4B4X A;  3V50 A;  2XA7 S;  3LR3 A;  2ZQA A;  3LCE A;  5HAP A;  3G2Z A;  3MMH A;  2L4R A;  1ZC2 A;  3TSG A;  3IS2 A;  3LI8 A;  3IF5 A;  2HJE A;  4R4S A;  1I5Q A;  4OLG A;  1F98 A;  2VGL M;  2Z2M B;  1GCE A;  2JKT I;  2PD7 A;  1OTD A;  2J3T D;  3RH8 B;  1TDL A;  4YWZ A;  4GNU A;  3V3S A;  2AVX A;  2XH9 A;  4QWO A;  1LL9 A;  4CPK A;  2L1M A;  2V8C A;  3HJI A;  3BFF A;  5L8M A;  1BUL A;  4X25 A;  4B4Z A;  3IX3 A;  1CJF A;  1ACF A;  2ZQ7 A;  3T50 A;  2XSS A;  5HWT A;  3HBR A;  3CWF A;  5CXW A;  2WKI A;  2BTF P;  1D1J A;  4HP4 A;  3G30 A;  2V9A A;  5FAP A;  4WN5 A;  4FCF A;  1D7E A;  5A93 A;  1ERQ A;  1D06 A;  3SS5 A;  2M7V A;  3LIA A;  4H8R A;  4CJN A;  3MZE A;  3RXW A;  4OP5 A;  3HL9 A;  3EGX C;  4GB7 A;  3O87 A;  4FTX A;  4DE1 A;  2UV0 E;  3VP2 A;  3IH9 A;  4L9E A;  5EM1 A;  3T12 B;  4JGP A;  4UQI S;  3RXX A;  3PBT A;  3C2W A;  1CI8 A;  5HAQ A;  5DF7 A;  3GEC A;  2W1R A;  4LCM A;  4JBF A;  1PWG A;  1N9N A;  5AQ9 A;  4ZJ1 A;  3IXB A;  2HJ9 C;  4S2N A;  4R3B A;  3NC8 A;  4DN0 A;  4MBH A;  1K38 A;  4CLC E;  2ZOH A;  4JXV A;  5FI2 A;  3N8S A;  1PWC A;  3NI9 A;  2Y79 A;  3OCN A;  3BFC A;  5DF8 A;  5EE8 A;  1GHM A;  4LV2 A;  2IA2 A;  1WE4 A;  1K57 C;  3H7W B;  2I72 A;  2Y8H A;  5F1G A;  4IED A;  4HH2 A;  2VEA A;  4ID4 A;  2O9A A;  1UWN X;  1MY8 A;  2ACG A;  3DTK A;  1XGI A;  2IWD A;  2EX6 A;  4DKI A;  1MKM A;  1RGZ A;  1K6S A;  4MBF A;  4PM7 A;  4U0T A;  5KMW A;  2PYP A;  3NIA A;  4MDZ A;  3T4T A;  4C6Y A;  4NXB A;  4CLC C;  1IYQ A;  1EW0 A;  1Y28 A;  3IQA A;  4BWI A;  3OC2 A;  2GDN A;  4E3L A;  3LY3 A;  2VA0 A;  1HLU P;  4O01 A;  4WEJ A;  1TS0 A;  3CPT B;  4K0X A;  4RVA A;  1FCO A;  1XXM A;  5FEF A;  3H7W A;  2MJ6 A;  3FKW A;  2QJ5 A;  4BBU A;  5M19 A;  4C75 A;  4EV4 A;  2V2F F;  4OPY A;  2P04 A;  5HAR A;  1K6R A;  1VEU B;  3KX0 X;  3OZH A;  3SS3 A;  5K5B A;  3NUL A;  3Q7V B;  2WKQ A;  1S4R A;  4RX3 A;  3S7N A;  3GVB A;  1BLC A;  5E2H A;  3SW1 A;  3VSL A;  3WS0 A;  3ZG8 B;  3OPH A;  3KYE A;  1M40 A;  5GHY A;  4R23 A;  5FDS A;  3NOU C;  4UEY A;  1H8M A;  2A2L A;  5G4Y A;  4Y0T A;  3HUN A;  3WRZ A;  2ZMF A;  2H0Y A;  1N9B A;  2W3H A;  4HJ3 A;  5EFW A;  2VK3 A;  2C5W B;  5EM0 A;  4IJG A;  2B95 A;  1T1C A;  4MN7 A;  5TGF A;  4P6B A;  3BLM A;  2XA7 M;  1CEF A;  1S67 L;  1FSY A;  1TS6 A;  4BL3 A;  1NLZ A;  5IS1 A;  4JGO A;  1PRQ A;  1WA9 A;  4IVK A;  1T1B A;  4KZ7 A;  5EVI C;  1XJ3 A;  2QZ6 A;  2L0W A;  1Z6F A;  1YLJ A;  3PBQ A;  1LT0 A;  2Y2O A;  3Q7V A;  4X56 A;  5F83 A;  3UE0 A;  3N8R A;  4PM8 A;  1FIL A;  2WKR A;  1K0K A;  2ZQC A;  2K2N A;  3BEC A;  3QP5 A;  1LLB A;  1NRJ A;  3LO7 A;  1YSQ A;  4L0L A;  3BRM A;  1ESU A;  2ZBB A;  3QNC A;  1C3B A;  2V20 A;  4BBT A;  3BLS A;  4PMA A;  2JKT M;  2OLV A;  5HZH A;  2KDK A;  3BQ8 A;  3QP1 A;  3MFX A;  3W4O A;  4EW7 A;  5J8X A;  3M6H A;  5HDD A;  5GHZ A;  1YSP A;  3BWL A;  4NXE A;  4S2M A;  5I94 A;  2BLS A;  2PDR A;  1K56 D;  1ALQ A;  4Y2F A;  2XLN A;  4EU0 A;  1K56 A;  5D3O A;  1Y54 A;  3I7J A;  4M3K A;  5DF9 A;  5DTS A;  2G2U A;  2Y2G A;  3W4Q A;  4OQH A;  4JF6 A;  3UY6 A;  1OPX A;  2HV1 A;  4BLM A;  3S4X A;  5G4Z A;  4XUZ A;  1L2S A;  4LFU A;  3BM6 A;  4JF4 A;  4KUO A;  5TJJ A;  3T4O A;  2HP9 A;  1IKI A;  2ZLY A;  2HDR A;  1H8Y A;  4U0X A;  1BLS A;  2VV7 A;  4YOF A;  3HJK A;  3EQV A;  2WYX A;  4X53 A;  2JBF A;  3TG9 A;  1NYY A;  3CI6 A;  4WZ4 A;  1VET A;  2QYB A;  2QKP A;  5AJG A;  2YKH A;  3MBZ A;  4ZDX A;  3BW6 A;  2I9V A;  4G3V A;  5DTT A;  3BQA A;  2EX9 A;  1W63 M;  4IHQ A;  2M7U A;  5L2F A;  3IF6 C;  4GDB A;  2PD8 A;  3G35 A;  4HP9 A;  3MXQ A;  2YKF A;  4LLO B;  4KZA A;  1NZO A;  2HDS A;  3MFD A;  4GDN A;  5FL3 A;  2Y4A A;  4LGW A;  5JYO A;  5TR7 A;  3QP4 A;  2R9W A;  4FH2 A;  1VB6 A;  1NRF A;  5L10 A;  5FA7 A;  2Y2M A;  3S1Y A;  3FZC A;  4LV1 A;  4B93 A;  4ESP A;  3HCY A;  5KSH A;  2LB5 A;  1OTI A;  4BD1 A;  2ZL1 B;  2GNX A;  3IWI A;  3GQZ A;  5DTK A;  1NYM A;  3ZNY A;  1NLY A;  5FAT A;  4S2O A;  3KSI A;  5HD5 A;  2IWB A;  2Z2L B;  3AGE A;  5BOH A;  3G2Y A;  4R1G A;  4R4R A;  2KX6 A;  2Q9M A;  3ITA A;  4WMC D;  3KO6 A;  4LV0 A;  2NUT C;  4HQA A;  3DW0 A;  1IYS A;  4K0W A;  4WMC A;  3DTE A;  2R78 A;  1IEL A;  4A5R A;  3OOV A;  2A3U A;  4KUK A;  3BYD A;  1KE4 A;  1G68 A;  1MXO A;  1DY6 A;  4Y0U A;  3T1X A;  2K31 A;  2GZA A;  3N6I A;  1MWT A;  1PZO A;  1STZ A;  3MQQ A;  3BY8 A;  3IS2 B;  2JC7 A;  2ZM2 A;  1WYB A;  2D02 A;  2ZL1 A;  1DRM A;  2DRW A;  4KQD A;  4Y3I A;  5M1A A;  3Q82 A;  4KEN B;  2Q9N A;  1FR6 A;  1TS8 A;  1I2S A;  2KLI A;  3IF6 A;  3K3D A;  1ES4 A;  1FIK A;  4FSF A;  4E3N A;  3ZG9 B;  4I39 A;  3E2K A;  1QMF A;  1YT4 A;  2JKF A;  1SKF A;  3IT9 A;  3MXS A;  4HBT A;  3JVV A;  5AQA A;  3PXP A;  3VMA A;  5J4E A;  2V8F A;  1W8Y A;  3S7Q A;  1CF0 A;  2HP6 A;  4B9O A;  1YMX A;  3VOY A;  2VV6 A;  3VP4 A;  3UDX A;  1RCJ A;  4IBR A;  3TE8 A;  4DF6 A;  1OTA A;  1DP8 A;  1O07 A;  3E2L A;  4S2J A;  2Y2N A;  4MLL A;  3CG5 A;  4G3W A;  2WGI A;  3UB6 A;  3HLB A;  4X6T A;  3EEA A;  3JVU A;  3E4P A;  4DE3 A;  3LEQ A;  4EEP A;  1VQQ A;  2VGK A;  3H82 B;  2ZC7 A;  2D01 A;  4R38 A;  4MMN A;  1ZKJ A;  2VZW A;  4Q0I A;  3MKF A;  4LRY C;  2PU4 A;  1KE3 A;  5FQK A;  1KGE A;  3FWL A;  2J7V A;  2RCX A;  1OJG A;  3CMZ A;  3T1R A;  4N9L A;  3LI9 A;  3VP3 A;  2WZZ A;  3G34 A;  1K54 A;  2VJW A;  2WZX A;  2EFU A;  2HPB A;  5HL6 A;  3L9K A;  4OP8 A;  1K4F A;  2HDQ A;  3AGF A;  3A3E A;  3NOP C;  2VLG A;  5IU1 A;  2Y2P A;  2Z6C A;  2ZC5 B;  5HD3 A;  1XPB A;  5TFQ A;  1TF1 A;  3MQ0 A;  1YM1 A;  3OPL A;  5EEC A;  4KZ6 A;  4M4X A;  1P0Z A;  2JN7 A;  1BTL A;  1M6K A;  3S22 A;  3H82 A;  1X0O A;  3DWZ A;  3IBR A;  4JGR A;  2W3D A;  2ZMA A;  1BZA A;  3G4P A;  1WYC A;  4KZB A;  1XA7 A;  2P08 A;  2P9V B;  3PTE A;  4O8G A;  1H0M A;  3P09 A;  3LR4 A;  1G28 A;  4WEL A;  5CGS A;  2C6W B;  1KVM A;  1Q2P A;  3RFB A;  5A90 A;  3VE3 A;  2O99 A;  3LYX A;  3C7V A;  1DP6 A;  4GS9 A;  3C4P A;  2CMN A;  3ZQ5 A;  4L9F A;  3FYZ A;  2EWV A;  1NXY A;  5FI7 A;  1YLY A;  4JKT A;  1XFN A;  4ME4 A;  2VGJ A;  4HY8 A;  3IWO A;  5HWV A;  2W27 A;  2ZOI A;  5EPH A;  3B33 A;  2B02 A;  1E25 A;  2W0N A;  3E0Y A;  1P97 A;  4OOL A;  4QHC A;  4IVI A;  4E6X A;  4GJ4 A;  3BFE A;  3CHW P;  3MZF A;  2P9V A;  1XJ2 A;  1ESI A;  1ERM A;  5CED A;  3UPP A;  2CC1 A;  2PBY A;  1PFL A;  1O7E A;  3B47 A;  3NDE A;  4BQM A;  3IBJ A;  2ZC4 B;  4HOI A;  4C3Q A;  3M6B A;  4HNB A;  1IYO A;  3CJM A;  1MC0 A;  4FOF A;  5F69 A;  3GMW A;  1GA9 A;  4YFM A;  3IWQ A;  4R3J A;  5FAO A;  3QP2 A;  3G32 A;  1XX2 A;  3C7U A;  1K25 A;  1TDG A;  4DE2 A;  2E8J A;  4KG6 A;  4G3K A;  4N1H A;  3R7W B;  3O5Y A;  3NOT C;  5MC7 A;  3UE1 A;  4CLC B;  3A3F A;  5GL9 A;  4LV3 A;  1ZTU A;  3NY4 A;  4OQ0 A;  4L9G A;  4OPQ A;  5F1F A;  1K4E A;  2ZD8 A;  4R3A A;  3PBS A;  4KZ5 A;  4Q0H A;  3UDI A;  1PYY A;  1FSW A;  4MN5 A;  3DBA A;  5CHU A;  1NY0 A;  4KG2 A;  3HLW A;  4K08 A;  1SCW A;  1K55 C;  1F5M A;  1K57 A;  3E4Q A;  4WUJ A;  3V5M A;  3K3C A;  1YAX A;  3W4P A;  2EA9 A;  4U3T A;  1HVB A;  4E3J A;  3B3X A;  5HPI A;  4WZ5 C;  2EXB A;  3T4K A;  2BAS A;  3OPP A;  4PKY G;  1AWI A;  1BT5 A;  3QNB A;  1NJ4 A;  4CLC D;  2QMI A;  1ZG6 A;  1XA1 A;  3R7W A;  4CLC A;  3V67 A;  2EXA A;  1G6O A;  3UPN A;  2PT7 A;  3OPR A;  4IBX A;  3C8C A;  1CK3 A;  4P6Z M;  1IEM A;  3UO9 A;  4P87 A;  3DAV A;  3K2N A;  4GLQ A;  3JPU A;  5C5K A;  3OBF A;  1SDN A;  1ZG4 A;  4E3M A;  2Y2K A;  1UWP X;  1KDS A;  4MCW A;  2WKE A;  4ZBE A;  2Y2I A;  4HHD A;  4KZ3 A;  4DXC A;  3IH8 A;  3VFH A;  2WKH A;  3O3V A;  1HTZ A;  1YLT A;  4QJG A;  1VET B;  5J7E A;  4LPZ A;  4K91 A;  1KDW A;  2Q0O A;  1PWD A;  1DJA A;  4FH4 A;  5CGX A;  5FSR A;  4WYY A;  3M2J A;  2JHE A;  5E2E A;  4EWF A;  1PI5 A;  5HW3 A;  3IHB A;  3AGD A;  4QPR A;  4IUK A;  1LHY A;  1K55 A; 
#chains in the Genus database with same CATH homology
 2M7V A;  2GZA A;  1T18 A;  2K7S A;  4GW9 A;  2PR6 A;  1STZ A;  2DMW A;  3ICY A;  3MQQ A;  4WEK A;  3LUQ A;  3BY8 A;  3IS2 B;  3LIA A;  4I3A A;  3PR6 A;  1ZHH B;  2D02 A;  4E04 A;  1T1A A;  1DRM A;  3EGX C;  4KQD A;  1LSW A;  3W2Z A;  4L9E A;  5DKK A;  4Y3I A;  3KSG A;  4JGP A;  4XT2 A;  4UQI S;  2QJ7 A;  3LFV A;  3T4Q A;  3D3O A;  1TS7 A;  5AVF A;  3KSF A;  1NWZ A;  3R4K A;  2J80 A;  2FH5 A;  4NXF A;  4Q0J A;  2B18 A;  1TS8 A;  3PHY A;  3RTY A;  3PBT A;  3S7O A;  4BBV A;  3C2W A;  2KLI A;  4ETX A;  3K3D A;  3GEC A;  2W1R A;  4KQO A;  1N9L A;  4FSF A;  1N9N A;  3FC7 A;  4I39 A;  2O0Y A;  2HJ9 C;  4DN0 A;  2JKR M;  4CLC E;  2ZOH A;  1YKD A;  1N9O A;  2Z6D A;  3LID A;  1T19 A;  3JVV A;  2Y79 A;  3PXP A;  5J4E A;  3OCN A;  3S7Q A;  4OOM A;  2IA2 A;  4B9O A;  3H7W B;  5DFX A;  2Y8H A;  4HI4 A;  4HH2 A;  2VEA A;  2VV6 A;  2O9A A;  1MZU A;  3UME A;  1UWN X;  2GJ3 A;  2W3E A;  3UB9 A;  3TE8 A;  3EQU A;  2V0U A;  3F1P B;  3CUE C;  3UE3 A;  4AFI A;  1OTA A;  1DP8 A;  1MKM A;  3OLO A;  1BYW A;  5I5L A;  1OT9 A;  3LIB A;  2OAQ 1;  2PYP A;  4G3W A;  3ULF A;  3UB6 A;  3T4L A;  5F6A A;  4MDZ A;  3T4T A;  4NXB A;  4CLC C;  3EEA A;  3MJQ A;  3JVU A;  4EXO A;  4XT2 B;  3E4P A;  1EW0 A;  5DJT A;  1Y28 A;  3U2A A;  4EEP A;  3H82 B;  2D01 A;  4BWI A;  3OC2 A;  4R38 A;  4MMN A;  3CLO A;  5A8B A;  2VA0 A;  2VZW A;  4I38 A;  4Q0I A;  4LRY C;  5HWW A;  4O01 A;  4WEJ A;  1TS0 A;  2VGL S;  2OWH A;  2OAP 1;  1H3Q A;  1P9R A;  2PYR A;  4CQH A;  1OJG A;  2HGV A;  3H7W A;  3LI9 A;  2FZ0 A;  4GHI B;  2GX5 A;  2MJ6 A;  3BY9 A;  1V9Z A;  2VJW A;  3FPV A;  2W1T A;  2QJ5 A;  4ZRR A;  4BBU A;  1W63 Q;  2O9C A;  5HL6 A;  3KYZ A;  5DKL A;  2J3T C;  2P04 A;  4WF0 A;  3ZYT A;  4NKP A;  4II7 A;  3KX0 X;  5K5B A;  3NOP C;  2VLG A;  3F1P A;  5IT5 A;  5IU1 A;  2WKQ A;  3NJA A;  4UQI M;  1DP9 A;  1S4R A;  1F9I A;  4H6J B;  3S7N A;  2Z6C A;  3UE6 A;  5CX7 A;  5HD3 A;  2OWJ A;  3SW1 A;  5TBM B;  1TF1 A;  3MQ0 A;  4M4X A;  1P0Z A;  2JN7 A;  3NOU C;  4UEY A;  1H8M A;  2A2L A;  5G4Y A;  5J3W A;  2KOI A;  4F3L B;  3H82 A;  3EWK A;  4ARZ B;  2ZMF A;  1UGU A;  1X0O A;  3TW8 A;  3LIE A;  4MN6 A;  2W3H A;  3A0V A;  3G6O A;  4HJ3 A;  5EFW A;  4BJP A;  2G7U A;  2ZMV A;  3IBR A;  4JGR A;  4IJG A;  2W3D A;  3S7P A;  5F68 A;  1T1C A;  4MN7 A;  1KOU A;  2P08 A;  4O8G A;  2XA7 M;  1S67 L;  1GSX A;  3LR4 A;  1G28 A;  4WEL A;  1TS6 A;  5IS1 A;  1NLZ A;  4JGO A;  4GHI A;  1WA9 A;  3RFB A;  1T1B A;  3VE3 A;  4GCZ A;  2O99 A;  3TRC A;  3LYX A;  4GS9 A;  1DP6 A;  1XJ3 A;  2L0W A;  2CMN A;  3ZQ5 A;  3PBQ A;  1LT0 A;  4L9F A;  5DFY A;  2EWV A;  4WLA A;  2A24 B;  4H6J A;  4YNR A;  2J3W A;  2WKR A;  3PBN A;  2W1T B;  1XFN A;  2WKP A;  4ME4 A;  1IFQ A;  5TBM A;  4I3J A;  2K2N A;  4HY8 A;  3KYQ A;  2V1B A;  3LR0 A;  2HF6 A;  3KSH A;  2V0W A;  3UMD A;  2LB9 A;  2O9B A;  1NRJ A;  5HWV A;  2W27 A;  2ZOI A;  3C30 A;  4IUH A;  1YSQ A;  5HSQ A;  3MR0 A;  4L0L A;  1P9W A;  2PR5 A;  3B33 A;  2ZBB A;  2B02 A;  4Y5F A;  2W0N A;  3E0Y A;  4F3L A;  5F5Y A;  4ARZ A;  1P97 A;  4OOL A;  4BBT A;  2VV8 A;  2EWW A;  3EGD C;  3LIF A;  3VV4 A;  2QWS A;  2JKT M;  4JGQ A;  4GJ4 A;  3OCL A;  5HZH A;  2KDK A;  3BQ8 A;  1XJ2 A;  1XJ4 A;  3BJN A;  1OTB A;  3MFX A;  4EER A;  3LIC A;  4EW7 A;  4P6Z S;  3MF0 A;  3EEH A;  3CAX A;  5HDD A;  2H28 A;  3B47 A;  1YSP A;  3E4O A;  3LR5 A;  3IBJ A;  5HPF A;  5HDS A;  1IOU A;  4HOI A;  2VX8 A;  3B42 A;  3BWL A;  4BMW A;  4NXE A;  4HNB A;  1MC0 A;  1OT6 A;  4HJ6 A;  2PDR A;  4FOF A;  5F69 A;  2A24 A;  5HDC A;  4Y2F A;  4EEU A;  1S1Y A;  3F1O B;  3MQO A;  4EU0 A;  4R70 A;  1TD5 A;  4GS9 B;  5DF9 A;  5AVE A;  4EES A;  1ODV A;  2QHK A;  4R6L A;  3VE4 A;  2M1C A;  2VKS A;  1OTE A;  1S4S A;  3PBR A;  3E98 A;  4G3K A;  3R7W B;  3O5Y A;  3NOT C;  1OPX A;  3PBO A;  2HV1 A;  3C38 A;  5MC7 A;  4CLC B;  1ZTU A;  3GDI A;  5G4Z A;  4HH3 A;  4L9G A;  4HJ4 A;  3VOL A;  3A0R A;  4R3A A;  3PBS A;  4ETZ A;  4KUO A;  5TJJ A;  4I3I A;  3T4O A;  3F1N B;  4Q0H A;  3EOI A;  1GSW A;  4MN5 A;  3DBA A;  1JNU A;  4EUV A;  3P7N A;  2VV7 A;  4YOF A;  3HJK A;  3EQV A;  4K08 A;  2V1A A;  4RQ9 A;  4I5S A;  2PHY A;  1F5M A;  3UB8 A;  3UB7 A;  3E4Q A;  4WUJ A;  5KIZ A;  3K3C A;  1YAX A;  1XFQ A;  3CI6 A;  2EA9 A;  1LSV A;  4EET B;  2QYB A;  1S1Z A;  3F1O A;  2W3F A;  4NXG A;  2QKP A;  5AJG A;  2YKH A;  3T4S A;  5HPI A;  4O0P A;  4NEE D;  2JKR I;  2OOL A;  1LSX A;  3BW6 A;  3CUE A;  3T4K A;  2BAS A;  4PKY G;  2I9V A;  4G3V A;  4EQ1 A;  2W3G A;  4Z1W A;  2XRN A;  3BQA A;  1W63 M;  4IHQ A;  1VHM A;  4CLC D;  3FPW A;  2M7U A;  1S66 L;  1GSV A;  4LRX C;  3R7W A;  4CLC A;  4LRZ E;  3V67 A;  2PD8 A;  1G6O A;  4HP9 A;  2PT7 A;  3MXQ A;  2YKF A;  4LLO B;  2XA7 S;  3LR3 A;  3C8C A;  3MMH A;  2L4R A;  4P6Z M;  5FL3 A;  3F1N A;  3IS2 A;  3LI8 A;  3K2N A;  2HJE A;  4GLQ A;  5C5K A;  1VB6 A;  1OJ5 A;  3OBF A;  1F98 A;  4HIA A;  2VGL M;  4PAU A;  3PYP A;  1UWP X;  4MCW A;  4B93 A;  1V9Y A;  2JKT I;  2PD7 A;  4PHT A;  1OTD A;  2J3T D;  3HCY A;  3RH8 B;  5KSH A;  4HHD A;  2LB5 A;  1OTI A;  2XRO A;  4YWZ A;  3FG8 A;  4DJ3 A;  2GNX A;  1NLY A;  2L1M A;  3HJI A;  3D72 A;  3KSI A;  3H9W A;  3TJZ C;  5HD5 A;  5L8M A;  5LBR A;  3CIT A;  5DJU A;  3NHQ A;  5J7E A;  2KX6 A;  4DJ2 A;  4LPZ A;  2NUP C;  3T50 A;  2XSS A;  5HWT A;  3KO6 A;  2INW A;  2NUT C;  3P01 A;  4HQA A;  3CWF A;  2P7J A;  3A0S A;  4WL9 A;  4HP4 A;  3T4J A;  2JHE A;  2V9A A;  2R78 A;  4WN5 A;  4DMZ A;  3OOV A;  1XJ6 A;  1LL8 A;  4KUK A;  1D7E A;  4QPR A;  4IUK A;  1D06 A;  4PKY A;  2K31 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...