4M4XA

Structure and dimerization properties of the aryl hydrocarbon receptor (ahr) pas-a domain
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
160
structure length
126
Chain Sequence
GSMLQEGEFLLQALNGFVLVVTADALVFYASSTIQDYLGFQQSDVIHQSVYELIHTEDRAEFQRQLHWALNPDNASFMERCFRCRLRCLLDNSSGFLAMNFQGRLKYLHGQNLPPQLALFAIATPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and dimerization properties of the aryl hydrocarbon receptor PAS-A domain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
molecule keywords Aryl hydrocarbon receptor
total genus 32
structure length 126
sequence length 160
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4m4xA00
1F98A 3K3CA 3SW1A 5IS1A 4PKYG 4R38A 4I38A 4MN6A 2ZOHA 5HDDA 5HD5A 3VE3A 3A0SA 4GS9A 4BBTA 1N9OA 1LL8A 2OOLA 2PHYA 4HP9A 4BBUA 3MFXA 2L4RA 4WUJA 3ULFA 4EEUA 4I39A 4KUKA 4I5SA 3H7WB 3UB8A 4F3LA 2QWSA 3GECA 5J3WA 3E4QA 2PYRA 2W0NA 1S4SA 4EXOA 1UWNX 3H82B 4KUOA 1N9LA 1TS8A 3NJAA 4HJ6A 3VE4A 1EW0A 2HV1A 4L9EA 1MZUA 1V9ZA 2V0UA 5KIZA 1S67L 4HI4A 4EERA 1T18A 3CAXA 4XT2A 3UB9A 2KDKA 2A24B 1OJ5A 4XT2B 1V9YA 5TBMA 1LT0A 1OTAA 1GSVA 1XFQA 2OWHA 4HQAA 4JGOA 4PKYA 3RTYA 5DJUA 1XJ6A 3MQQA 4HH3A 4RQ9A 1BYWA 4M4XA 3MXQA 5I5LA 1XJ3A 1GSXA 1D06A 2Z6CA 3A0VA 4GS9B 4HJ4A 1TS7A 1ODVA 2PYPA 1OTBA 3A0RA 3IBRA 4JGRA 1S4RA 1NWZA 1T19A 4LRZE 2PR5A 4I3IA 5DKKA 2V0WA 3H7WA 2QKPA 3LYXA 3ZQ5A 2J80A 1OJGA 2PR6A 2YKHA 4H6JA 2ZBBA 4HJ3A 3UB6A 3NOTC 4K08A 1LSVA 5HDSA 4GHIB 3UE6A 3MR0A 2PDRA 4HY8A 1T1BA 5A8BA 4R70A 5HZHA 1KOUA 2ZOIA 3OLOA 3UMDA 4HNBA 4LPZA 4LRYC 1F9IA 2VV6A 1OT9A 3KX0X 2PD7A 3F1PB 4WL9A 3F1PA 4I3AA 5AVFA 2VLGA 3T50A 3UMEA 3CLOA 4DJ3A 5HDCA 3IS2A 3GDIA 2KX6A 4EW7A 1UGUA 3H82A 4GHIA 3IS2B 2GJ3A 4JGPA 2L0WA 5DKLA 2PD8A 2VV8A 4HH2A 1S1ZA 2WKQA 2R78A 3E4PA 3HJIA 3LIFA 1OTIA 3E4OA 4NXEA 1XJ4A 3LI9A 3NHQA 2WKRA 3UB7A 3K3DA 2P7JA 4HIAA 1UWPX 2H28A 3LUQA 2V1AA 2Z6DA 1G28A 3H9WA 5AVEA 5F5YA 1D7EA 4LRXC 3HJKA 4NXBA 5EFWA 2BASA 1DP9A 4JGQA 4BBVA 3PYPA 1WA9A 1S66L 2QJ7A 2V9AA 3NOUC 4HP4A 5IU1A 5HSQA 3LICA 1GSWA 3NOPC 4EESA 1S1YA 2D02A 5F68A 5G4YA 1P97A 4HOIA 3F1NB 2JHEA 5J7EA 2M1CA 3VOLA 3ICYA 2VV7A 1T1CA 4NXGA 4DJ2A 5HWTA 4L9GA 3RH8B 2W27A 3BY8A 4I3JA 1N9NA 1TS6A 3F1OB 4YWZA 4B9OA 2JN7A 3FG8A 4R6LA 4NXFA 2YKFA 2I9VA 1XJ2A 5HD3A 4KQDA 5DJTA 4R3AA 4GCZA 1DP8A 3CWFA 2D01A 3LIBA 5G4ZA 4E04A 3C8CA 4EEPA 3BWLA 3P7NA 4WN5A 2VEAA 3C2WA 4EETB 5HWVA 1OTDA 2A24A 2CMNA 1OTEA 1X0OA 3LIAA 5TBMB 4EQ1A 2WKPA 1DP6A 3B33A 1P0ZA 3F1OA 5J4EA 1VB6A 2EA9A 4LLOB 3MJQA 3D72A 2QHKA 3LI8A 4HHDA 3BY9A 3G6OA 2B02A 3PHYA 3MQOA 1XFNA 1LSWA 2K7SA 3F1NA 1Y28A 2L1MA 2INWA 2V1BA 1T1AA 1DRMA 2QJ5A 4L9FA 4MN5A 5F6AA 1OT6A 1TS0A 4WLAA 5HWWA 1JNUA 4H6JB 3EWKA 4F3LB 2OWJA 3EEHA 3LIEA 4GW9A 4WF0A 5F69A 1LSXA 3FC7A 3LIDA
chains in the Genus database with same CATH superfamily
1F98A 4X25A 1HVBA 4ESPA 3NIAA 3G31A 2OOLA 3CJMA 4I5SA 5J3WA 2PYRA 4RX3A 4DF6A 3LGOA 1IYOA 1SDNA 3D4FA 4FTXA 3M2JA 4DMZA 3C7UA 3ZNYA 1P9RA 3MS6A 1YKDA 4ARZA 1OJ5A 1V9YA 1OTAA 1TVFA 1XFQA 4ZJ2A 3RJUA 3TOIA 4QJGA 4BQMA 1OTBA 2V0WA 3ZQ5A 1E25A 1PRQA 3IX3A 4WZ4A 4HY8A 3C4PA 4MBKA 4R4SA 1OT9A 4WZ5A 3G2ZA 4I3AA 1VETA 3IS2A 4CLCD 3ITBA 4DDYA 3LEZA 2XH9A 4LRXC 1P9WA 4OQGA 5HSQA 2W1TB 4LFUA 1YT4A 4N1HA 3NC8A 3VOLA 3GTCA 1K57C 3RH8B 4L9GA 3BY8A 4I3JA 1TS6A 4BL3A 3G4PA 4DDSA 1TEMA 2FFYA 1XA7A 4R3AA 1DP8A 2O9CA 3LIBA 4C75A 2ZQCA 1CJFA 4F94A 2CMNA 2HZ5A 4YNRA 3KSIA 1VETB 5TBMB 3VP3A 4OQHA 4NG2A 1NLYA 2EX8A 1FR6A 3VP0A 5HWWA 4FOFA 3T1XA 2PU4A 3EWKA 3FKVA 2OWJA 3BEBA 3LIDA 2GNXA 2QZ6A 5E2FA 2ZMVA 4Z1WA 4WUJA 3C7VA 3AGEA 2JKRM 2HDRA 4PM9A 3V67A 2XF3A 3ZNTA 1I5QA 3ZVWA 4LCMA 4HESA 1FILA 4U0XA 1MZUA 5IT5A 3IXHA 5HAPA 4X56A 4OQ0A 4R23A 1HLUP 2W3HA 2WKIA 1S4RA 1T19A 2XLNA 1MBLA 2J80A 3NDEA 4G3VA 2O9BA 1IELA 5GLDA 4R70A 2JE5A 1LLBA 3F1PB 3N7WA 4PAUA 3A3EA 4OPRA 1L0GA 3UO9A 5JYPA 2VV8A 3HJIA 1L0EA 1XJ4A 2A49A 3M6HA 1K25A 2RCXA 1MWUA 3LICA 3MZFA 1IKIA 5A92A 1Y54A 1NRFA 5C5KA 3TE8A 5E2EA 5DFXA 1YQSA 3S22A 3F1OB 4YWZA 2YKFA 2IWCA 4X53A 3QP1A 1CI9A 1K4EA 3DW0A 5HL1A 5EOEA 1VEUA 1MWTA 4BD0A 3IX4A 4GZBA 4HBTA 2Y2PA 3ZHHA 2QHKA 4IJGA 1Q2PA 1ERQA 3G6OA 4E3JA 1XFNA 5HPIA 1DRMA 3G2YA 1NZUA 4FH2A 1CQAA 4OLDA 5F69A 3IF6A 2K31A 4ZJ3A 2BLSA 3P98A 1BLCA 1L0DA 2PHYA 4HP9A 2VKSA 3T12B 2W0NA 2R9WA 1IYPA 4IBRA 3UE3A 4B4XA 4GD8A 4KZ6A 1G6AA 4S2IA 1KDSA 3SS4A 1KGFA 2ZL1B 4JXWA 1LI0A 1W79A 4HH3A 2Y2KA 3OCLA 3C30A 1BSGA 1O07A 2H0TA 1MWSA 3NOTC 5CEDA 3HLFA 4KZ9A 3O87A 1Y4OA 3UMDA 1C3BA 4EBLA 5HL6A 4DJ3A 1XX2A 3HVFA 5CEBA 1PW1A 3HLCA 2WKQA 2EFXA 3VOYA 1GA0A 3LR4A 3LY4A 4S2MA 3EQVA 4Z9QA 4RA7A 2VX8A 3UDFA 4PHTA 1Z6FA 1VEUB 1DP9A 3O86A 2QJ7A 3V39A 1SKFA 5TGFA 3IT9A 4DE0A 5TFQA 5CGWA 1P97A 1ZKJA 4NXGA 3LCEA 4B9OA 1RP5A 5GLBA 5CRFA 4E6XA 5E2HA 3HL9A 4WYYA 3E2LA 2P08A 2I72A 1EROA 4JLFA 3MKFA 2JKTM 3LIEA 3O3VA 1S0WA 4I38A 3C5AA 3UE0A 4BBTA 2LB9A 4EUVA 3EEAA 3AGFA 3H82B 3VE4A 3BFGA 3E0YA 3ZG9B 3Q7VB 5AQ7A 4XUXA 3BFFA 3B42A 1VQQA 2A2LA 2JKFA 2E8JA 1XJ6A 5K5BA 2HDQA 1YLWA 4Y2FA 3TW8A 1FCNA 1ZC2A 3UNWA 5HAQA 4MN7A 3PBTA 2HGVA 2Y2JA 3S7NA 3MZEA 3WRTA 5EUAA 2IWBA 2XRNA 1K0KA 4LRYC 2WGIA 3BRMA 4O01A 4LV3A 5HDCA 2WK0A 3E4PA 3E4OA 4WMCA 4JF5A 1DJAA 4JXGA 4B93A 3OZHA 4NKPA 4UAAA 4O7DA 3OPLA 5G4YA 1JVJA 2JHEA 2ZC6B 3CITA 2VV7A 4FCFA 2P74A 1J3WA 3QP5A 3Q81A 4N9LA 4KQDA 3VFFA 3W2ZA 5LBRA 3SZTA 3VSKA 1JTGA 2JCHA 1DP6A 5CGXA 1E3UA 4EUZA 3CUEC 4II7A 1PIOA 3ISGA 3R4KA 2C5WB 3FC7A 4E3LA 2Y2QA 4GS9A 4Q8IA 3D3OA 3ZFZA 1GHPA 3S7QA 3TG9A 2OLUA 5J8XA 1S67L 4DKIA 4HI4A 1PWDA 4OPQA 3UB9A 2KDKA 2V8CA 4XT2B 2OWHA 3PBOA 3MQQA 2VGLS 4X6TA 4GS9B 4E3OA 4HJ4A 1TS7A 4JGRA 1JTDA 2QKPA 2ZQ7A 1OJGA 2J7VA 2XSSA 4K08A 3MQ0A 5DVAA 5EECA 3T4QA 3TRCA 4UHUA 5EV0A 1F9IA 3KX0X 2VGKA 3OPPA 4Y13A 2KX6A 1ACFA 3H82A 4JGPA 1G5UA 1BLPA 4PPRA 5FI6A 2Y2IA 1PZPA 2UV0E 1K56D 4BBVA 4O0PA 2WAFA 1L3LA 1A0KA 3IWIA 5CGSA 5GHZA 4ID4A 1PZOA 2OAQ1 4DXCA 4OPYA 4S2NA 2BG1A 1K6RA 2PRFA 4PM8A 4GCZA 4WEJA 4UA9A 1PNEA 4GD6A 2VGJA 1X0OA 3CUEA 3CHWP 2O0YA 2B02A 1STZA 2INWA 2QJ5A 2X71A 5TJJA 4CLCC 1NLZA 3UY6A 4R38A 2DNSA 5HDDA 3VE3A 5EM1A 4P6ZS 3WS2A 4EEUA 4C6YA 1E3UD 3ULFA 1M40A 3RXXA 1BLSA 1TS8A 4HJ6A 1MPLA 3DTIA 1FSWA 1HZOA 2KOIA 4IVIA 3S4XA 1FQGA 2FFFB 3HUOA 2HJEA 4P85A 1GSVA 4UA7A 2WUQA 1SZVA 3MXQA 1SDEA 3G34A 4ETZA 1YLTA 2WZXA 3UN7A 3MXSA 1ES4A 3UE6A 3FPVA 2XD1A 1KOUA 4E3MA 3CZDA 3OOVA 5FI2A 1K4FA 3Q1FA 2GJ3A 4KZ4A 2EFUA 2HJ9C 3LIFA 1ZG6A 1H8MA 1YLZA 1K55A 3ZDJA 3PBSA 1PFLA 1TD5A 1K55C 3IHAA 4QY6A 3QHYA 5IU1A 3RXWA 3KYQA 1Q2QA 3GR2A 4KG5A 2NUPC 2W27A 3BFEA 4N9KA 2Y4AA 3GSGA 2I9VA 1XJ2A 3FPWA 5DJTA 3PAGA 3PXPA 2XFTA 4X1MA 4UQIM 2X02A 2Z2MB 2GDNA 4R3JA 5AJGA 5HAIA 4CQHA 4HHDA 1YLJA 4U0TA 4K0XA 1XXMA 4P6ZM 4YFMA 5HZHA 5F6AA 3LO7A 1OT6A 4LGWA 4GOGA 2X01A 3G35A 3A3JA 3L9KA 3P09A 4QU3A 3BQAA 1S4SA 5FQKA 3NJAA 1IKGA 5FQMA 2JKRI 1N4OA 5L09A 4L9EA 5CECA 2EWWA 2HPBA 4GB7A 4LV2A 5AQ9A 5CHJA 5TBMA 4DN0A 1LT0A 5FEGA 2WGWB 3Q7ZA 3GV9A 2PYPA 1SKOA 3EGDC 1NWZA 5FASA 2W3EA 4H6JA 2ZM2A 1MWRA 1QMFA 2HP6A 5FQJA 3T4JA 1HTZA 1OPXA 2JC7A 1XKZA 2ZD8A 2PD7A 1IFQA 3T50A 3N8LA 2OAP1 3IS2B 4NXEA 3JYIA 1W8YA 1GA9A 2XROA 2WYXA 2P9VA 2Y8HA 1N9BA 4Y3IA 3R7WA 3V3RA 3HREA 1HD8A 2H5SA 2VZWA 5CTMA 3CPTA 5F1GA 2QMIA 2Y2MA 4G3KA 4O8GA 3LEQA 1MKIA 4E3NA 4Q0IA 4IEDA 1BLHA 2ZL1A 4HEFA 2D01A 1K6SA 1LHYA 1OTEA 1P0ZA 1VB6A 3MJQA 1BZAA 2XR0A 4PM5A 3F1NA 5EOOA 4ZDXA 2Q9MA 4IUKA 1G68A 4OP5A 1LSXA 3MFXA 3VP1A 3SH8A 1WYCA 1BTLA 1PWCA 1ESIA 2B18A 4S2NC 4FSFA 2W3GA 3AGDA 4NK3A 4PKYA 4WM9A 3QP4A 3A0VA 1YLPA 3PR6A 4FUWA 5CHMA 5DF9A 5M1AA 4RYEA 1CEFA 4S2LA 2ZBBA 2HDUA 5DTKA 1LSVA 1M6KA 1L0FA 3MR0A 5A8BA 1S6RA 4QHCA 1UGUA 1BT5A 3MMHA 2H0YA 3LI9A 5M19A 1CK3A 4BMWA 2Z6DA 4R1GA 5A90A 1D7EA 4FH4A 1DY6A 1E4DA 3NOUC 1PYYA 4LV1A 1I2WA 5J7EA 2EX6A 3FZCA 4WELA 3ICYA 4XXRA 3E98A 2O9AA 4R6LA 2VGLM 1NYMA 3OPHA 4K0WA 3EOIA 3BWLA 4WN5A 1MXOA 3B3XA 1W63M 4Q0HA 2DMWA 4MDZA 2L1MA 3PBRA 4MN5A 2PAVP 2H10A 1YAXA 4MBHA 3SW1A 4JXVA 4MN6A 1KDWA 2GZAA 1LL8A 3EGXC 5EVIB 3UB8A 3GECA 3BW6A 3EQUA 2ZC5B 3IBJA 3Q82A 4KZ5A 2ZC7A 2CC1A 1YPRA 3BECA 4Y0OA 4GDBA 1ES3A 3VFHA 4KENB 4JKTA 5FEFA 4JPMA 1H8YA 2YKHA 4DXBA 3PTEA 3U4LP 4ZBEA 2G2UA 3K2NA 2ZOIA 3E2KA 1ERMA 3DTEA 1GCEA 3R7WB 4DE3A 2PD8A 1LI9A 2J3TD 5EPHA 5FQQA 5AVEA 2V1AA 4NXBA 5GLAA 4NEED 1EI5A 1SKOB 3F1NB 1FOFA 2ZMAA 5FAOA 2EX2A 4RX2A 2ZQ8A 3UPNA 2W3DA 2PU2A 4L0LA 1IYSA 1NY0A 5FSRA 1JWZA 1OTDA 4Y0TA 5EVIC 4PMAA 3BY9A 3O88A 3PHYA 3CI6A 4QD4A 3NECA 1T1AA 5FAPA 1TS0A 4QY5A 4WZ5C 3HBRA 1YM1A 2G7UA 3HLGA 3NCKA 4D2OA 3E4QA 2HP9A 2ZLYA 1O7EA 4KZAA 2ZM0A 4CLCE 4DE2A 4IHQA 4N1XA 3CAXA 3DTMA 4OOYA 1IEMA 4A5RA 5DJUA 1BYWA 2M7VA 2DRWA 2PBYA 5L07A 4UQIS 2Q9NA 5BOHA 3NI9A 1ZG4A 3LYXA 2E8IA 2Y2HA 5HDSA 3WS1A 5GL9A 3U2AA 5GLCA 3HLBA 4KG6A 3IXBA 3KSFA 5FL3A 2HF6A 1PI4A 3SH9A 3C38A 2WKRA 1J9MA 3ZG0A 3ZVTA 4YINA 5KSCA 2V8FA 4JXSA 2V9AA 5IHVA 2M7UA 3IX8A 4EESA 4MBFA 3QP2A 4HOIA 4BENA 1XGJA 3N6IA 5CERA 3WS4A 2ZMFA 5AQBA 4KZ7A 4GJ4A 3CWFA 2ZJ9A 5G4ZA 2AVXA 4N92A 4AFIA 4OQIA 4M3KA 1YMSA 2A24A 4IVKA 3N8SA 3B33A 1XP4A 3IF6B 3T4TA 2Z2LB 2XFSA 3D72A 2V2FF 3T1RA 3BJNA 3WS5A 1LSWA 4GDNA 2BTFP 3UB5P 3EEHA 2ZQ9A 4GW9A 3LFVA 3ZG5A 5HD5A 1D1JA 3LR0A 2Y2LA 2MJ6A 4I39A 3A3FA 1QMEA 3N8RA 3OC2A 4EXOA 1N9LA 4BJPA 1EW0A 3GVBA 5KIZA 2WZZA 3W8KA 2XK1A 3MXRA 3MBZA 4JGOA 4HQAA 4OP8A 1YMXA 1YSQA 1RGYA 1KE0A 4OVDA 5DF7A 4GN2A 1ODVA 4LRZE 2PR5A 3W4OA 1NJ4A 5EM0A 2UWXA 4OH0A 3UB6A 5KSHA 2EXAA 4HNBA 3KYEA 1FR1A 4WL9A 3S1YA 1NRJA 3WRZA 5CX7A 2WGWA 1BUEA 1OTIA 3KO6A 2WKHA 3H9WA 1G28A 4LV0A 1FIKA 4LENA 1TDGA 3IF6C 1JWPA 4EV4A 3GMWA 2BASA 2C6WB 4HP4A 4DE1A 2Y91A 5F68A 4C3QA 3Q07A 5L2FA 5DFYA 4OOLA 1ONGA 4FD8A 1N9NA 1KGEA 1ALQA 3IXDA 4EU0A 4EEPA 3C8CA 2J9PA 3TSGA 3C2WA 3IH8A 3V5MA 2WKPA 3F1OA 2EA9A 4JBFA 4QPRA 1KVMA 3NULA 4BD1A 4B4ZA 2J8YA 2K7SA 1Y28A 2V1BA 4EWFA 2KLIA 5AQAA 1H0MA 3K3CA 3FYZA 4PKYG 2JKTI 3A3IA 1NZOA 4BBUA 4CJNA 2L4RA 2DCFA 5G18A 1Z09A 1UWNX 2W1TA 1MC0A 3ZGAB 4S2KA 5D3OA 2A24B 3IH9A 1WE4A 4H8RA 3LR5A 1NYYA 1TF1A 1GSXA 4NETA 3WWXA 1PI5A 3G32A 3T1QB 4Y17A 5CHUA 4EBPA 4I3IA 2PR6A 2XD5A 3HUNA 1AWIA 4OLGA 1XA1A 5A91A 3JPUA 3FKWA 2J3WA 5DKLA 3KYZA 3NHQA 4HIAA 2P7JA 2OLVA 1KE4A 4EBNA 5E2GA 4JGQA 2V1ZA 1NXYA 2D02A 1H8ZA 2JBFA 3T4LA 1T1CA 5HWTA 5L10A 1JWVA 2B5RA 4ZAMA 5FATA 4UEYA 5L8MA 3DWZA 4OONA 5EVLA 4EETB 5HWVA 5EVEA 3KSHA 4EQ1A 5E43A 3JVVA 1G6OA 2IA2A 3HLDA 2ZQAA 5DF8A 3BLMA 1RGZA 1ES5A 3QP6A 5F1FA 1EWZA 1SCWA 4Y0UA 1H3QA 2P9VB 4KUKA 1FCOA 4X69A 2QWSA 3OBFA 2OV5A 2ZQDA 1K38A 1K57A 2HV1A 3NDGA 1V9ZA 1IOUA 5HPFA 2WGVA 4EERA 3TJZC 3RTYA 5FI7A 2NUTC 4RQ9A 5I5LA 4R0QA 5HX9A 1D06A 4UA6A 1VM1A 3RFBA 3UDXA 4MEZA 5A93A 2PDRA 2RL3A 4PM6A 3D9YA 3F1PA 2VLGA 4HBUA 2L0WA 1S1ZA 4R4RA 2R78A 3B47A 4Q0JA 3ZG8B 3DTKA 4LCLA 3LUQA 5FDHA 5F5YA 1K54C 3S7PA 3PBNA 4BLMA 1WA9A 4MCWA 4D60A 3LY3A 3NOPC 3SH7A 3CPTB 3QNBA 2LB5A 1MY8A 3L7HA 2V20A 3ZCZA 5HW3A 5EE8A 1FSYA 1AXBA 3VMAA 4G3WA 3DAVA 2HDSA 4S2JA 4U3TA 2JKGA 3IHBA 3OPRA 4X1LA 2VEAA 3LIAA 5TR7A 3T4KA 4QWOA 2J9OA 2J3TC 2Y2GA 1PWGA 5FQIA 3LR3A 4S2PA 4CLCA 2EX9A 4WLAA 1JNUA 4XUZA 4CPKA 3LI8A 3SOIA 3PAEA 1YLYA 3A0SA 2R9XA 4MNRA 4GNUA 4BL2A 3MSHA 3H7WB 5MC7A 2XEPA 3BYDA 1SHVA 4BWIA 3Q7VA 4MLLA 4DRTA 3DBAA 5CXWA 1ZHHB 4XT2A 3UE1A 2ZM8A 5EVID 2Y59A 5FAQA 4ZRRA 1PW8A 2XQZA 1GHMA 2XGNA 3SS3A 2QPNA 3G30A 3GDIA 4EW7A 1OMEA 4GHIA 4Y5FA 4HH2A 5IS1A 2FZ0A 4GLQA 5GHYA 4RVAA 1UWPX 2H28A 3N4IA 2PT7A 5EFWA 2XA7M 3VOZA 2Y2NA 2ACGA 1S66L 2B95A 4R3BA 4E3KA 4E3IA 1S1YA 3BFDA 4IUHA 4KZBA 2IWDA 4DJ2A 2JN7A 2PBDP 1U60A 3A3DA 3ITAA 5HD3A 4S2OA 5HARA 4E04A 4EQIA 3V50A 1XPBA 3HLEA 5F83A 2ZC4B 1H5XA 4Y15A 3M6BA 2Y55A 4KQQA 3W4QA 4L9FA 1CF0A 4WMCD 4Y7PA 3P01A 2ZOHA 3CG5A 1N9OA 2EXBA 2P04A 3BLSA 4F3LA 3UPOA 3SS5A 4KUOA 4GKUA 2HP5A 3V3SA 4JF6A 1T18A 2A3UA 3JVUA 3BFCA 4JF4A 5JYOA 1GHIA 4M4XA 1XJ3A 1W5DA 2Z6CA 3GRJA 3IWQA 5DKKA 4B88A 1I2SA 3VV4A 4HJ3A 2OSUA 3BM6A 5DTSA 4GHIB 2FH5A 4KQRA 1T1BA 5EVIA 3UMEA 4P0MA 3VP2A 1LL9A 3FWLA 5FDSA 4KG2A 3HJKA 3BQ8A 1WYBA 4KZ3A 3W4PA 1CEGA 2VA0A 3PYPA 1W8QA 1L2SA 3NY4A 1GSWA 3T4OA 1W63Q 3IWOA 4KZ8A 4K91A 2M1CA 2EWVA 2Y2OA 2WAEA 1KVLA 4MMNA 4YOFA 4NXFA 5GHXA 2W1RA 2VK3A 2WADA 3M2KA 3HCYA 3HUMA 1LL5A 3P7NA 3T4SA 4ARZB 5J4EA 5FQ9A 3IXGA 3T1SA 2XDMA 3UDIA 4E6WA 5U47A 1TDLA 1RCJA 3MQOA 1KGGA 3GQZA 5HFOA 1FCMA 4OKPA 5KMWA 2ZC3B 4F3LB 5FA7A 4WF0A 1K56A 3NBLA 1YSPA 3IF5A 4QB8A 4WBGA 4OOMA 1F5MA 4ZJ1A 3MF0A 3CMZA 2W3FA 1DJCA 3S7OA 4ETXA 2V0UA 1IYQA 3VP4A 2O99A 1F2KA 3MKEA 5CTNA 2Y79A 4ZTKA 2VJWA 1KE3A 3A0RA 3IBRA 1MKMA 5M18A 2K2NA 3H7WA 3WS0A 1ZTUA 3MZDA 4X55A 3OLOA 4LPZA 2VV6A 5AVFA 3UPPA 3DWKA 5F82A 3CLOA 3QNCA 3I7JA 1DJBA 3UB7A 3K3DA 3KSGA 3O5YA 1ES2A 1BULA 4X68A 4WEKA 1ONHA 2Q0OA 4CLCB 1VHMA 3C4OA 4P6BA 3QP8A 5I94A 3FG8A 4P87A 2WKEA 1ESUA 3OCNA 4OPZA 4PM7A 3HLWA 3FV7A 3ZG7B 1CI8A 1W7FA 5DTTA 1XGIA 3ZYTA 4LLOB 3VSLA 3PBQA 2GX5A 4KQOA 5KZHA 3IQAA 2G2WA 4ME4A 4IBXA 2QYBA 3MFDA 4H6JB 2XA7S 1K54A
chains in the Genus database with same CATH topology
1F98A 3SW1A 4MN6A 2GZAA 1H3QA 4GS9A 2OOLA 1LL8A 4KUKA 3EGXC 3D3OA 4I5SA 3UB8A 2QWSA 3BW6A 3GECA 3EQUA 3OBFA 5J3WA 2PYRA 3S7QA 3IBJA 2HV1A 1V9ZA 1IOUA 4DMZA 5HPFA 1S67L 1P9RA 4HI4A 4EERA 1YKDA 3UB9A 2KDKA 4XT2B 1OJ5A 3TJZC 1V9YA 4ARZA 2OWHA 1OTAA 3PBOA 1XFQA 3RTYA 3MQQA 2NUTC 4RQ9A 2VGLS 5I5LA 1D06A 4GS9B 4HJ4A 1TS7A 4JGRA 1OTBA 3RFBA 2V0WA 2QKPA 3ZQ5A 1OJGA 2YKHA 2XSSA 4K08A 3MQ0A 3T4QA 2PDRA 3K2NA 4HY8A 3TRCA 2ZOIA 1F9IA 1OT9A 3KX0X 3F1PA 4I3AA 2VLGA 3R7WB 3IS2A 2KX6A 3H82A 4JGPA 4CLCD 2L0WA 2PD8A 2J3TD 1S1ZA 2R78A 3B47A 4Q0JA 3LUQA 5AVEA 2V1AA 5F5YA 4LRXC 4NXBA 1P9WA 3PBNA 3S7PA 4BBVA 4O0PA 1WA9A 4NEED 4MCWA 5HSQA 2W1TB 3NOPC 3F1NB 2LB5A 3VOLA 3RH8B 4L9GA 3BY8A 4I3JA 2OAQ1 1TS6A 2W3DA 4R3AA 4GCZA 1DP8A 2O9CA 3LIBA 4G3WA 4WEJA 4L0LA 2VEAA 1OTDA 2CMNA 4YNRA 3LIAA 1X0OA 3KSIA 5TBMB 3CUEA 3T4KA 1NLYA 2J3TC 3BY9A 2O0YA 2B02A 3PHYA 1STZA 3CI6A 3LR3A 4CLCA 2INWA 1T1AA 2QJ5A 1TS0A 4WLAA 5HWWA 1JNUA 4FOFA 5TJJA 4CLCC 3EWKA 2OWJA 3LI8A 3LIDA 1NLZA 4R38A 2GNXA 5HDDA 3VE3A 2ZMVA 3A0SA 4Z1WA 4P6ZS 4EEUA 3ULFA 4WUJA 5MC7A 2G7UA 2JKRM 3H7WB 3V67A 3E4QA 1TS8A 4HJ6A 4BWIA 1MZUA 5IT5A 2KOIA 4CLCE 3DBAA 4IHQA 3CAXA 1ZHHB 4XT2A 2HJEA 1GSVA 5DJUA 1BYWA 3MXQA 2M7VA 4ETZA 2W3HA 4UQIS 1S4RA 1T19A 4ZRRA 3LYXA 2J80A 3UE6A 5HDSA 4G3VA 2O9BA 3FPVA 3U2AA 4R70A 1KOUA 3OOVA 3F1PB 3KSFA 4PAUA 5FL3A 2HF6A 3GDIA 4EW7A 4GHIA 2GJ3A 4Y5FA 2VV8A 3C38A 2HJ9C 4HH2A 3LIFA 3HJIA 5IS1A 1XJ4A 1H8MA 2WKRA 2FZ0A 4GLQA 1UWPX 2H28A 3PBSA 2PT7A 1TD5A 5EFWA 2XA7M 1S66L 2V9AA 5IU1A 3LICA 2M7UA 4EESA 1S1YA 3KYQA 4HOIA 4IUHA 2NUPC 5C5KA 3TE8A 4DJ2A 5DFXA 2W27A 2ZMFA 3F1OB 4YWZA 2JN7A 2YKFA 2I9VA 1XJ2A 4GJ4A 5HD3A 3FPWA 5DJTA 3CWFA 5G4ZA 3PXPA 4E04A 4UQIM 4AFIA 2A24A 3B33A 3T4TA 5AJGA 4CQHA 3D72A 2QHKA 4IJGA 3BJNA 4HHDA 3G6OA 1XFNA 1LSWA 5HPIA 4P6ZM 4L9FA 1DRMA 5HZHA 5F6AA 1OT6A 3EEHA 4GW9A 3LFVA 5F69A 3P01A 2K31A 2ZOHA 5HD5A 1N9OA 2PHYA 3LR0A 4HP9A 2MJ6A 4I39A 2P04A 2VKSA 4F3LA 2W0NA 3BQAA 1S4SA 3OC2A 4KUOA 4EXOA 1N9LA 3NJAA 4BJPA 3UE3A 1EW0A 2JKRI 4L9EA 5KIZA 2EWWA 1T18A 3JVUA 5TBMA 4DN0A 1LT0A 4HQAA 4JGOA 4HH3A 1YSQA 4M4XA 3OCLA 1XJ3A 3C30A 2Z6CA 1ODVA 2PYPA 3EGDC 1NWZA 4LRZE 2PR5A 5DKKA 2W3EA 3VV4A 4HJ3A 4H6JA 3UB6A 3NOTC 4GHIB 5KSHA 2FH5A 1T1BA 3T4JA 3UMDA 4HNBA 1OPXA 2PD7A 4WL9A 1IFQA 5HL6A 3T50A 3UMEA 4DJ3A 1NRJA 2OAP1 3IS2B 5CX7A 2WKQA 4NXEA 2XROA 1OTIA 3KO6A 3LR4A 3EQVA 2Y8HA 3H9WA 1G28A 2VX8A 4PHTA 4Y3IA 3R7WA 3HJKA 3BQ8A 2BASA 1DP9A 2VA0A 3PYPA 2QJ7A 4HP4A 1GSWA 3T4OA 2VZWA 5F68A 1W63Q 1P97A 2M1CA 2EWVA 4G3KA 4O8GA 4NXGA 5DFYA 4OOLA 4MMNA 4YOFA 1N9NA 4Q0IA 4B9OA 4NXFA 2W1RA 4EU0A 3HCYA 4EEPA 2D01A 3C8CA 3P7NA 3C2WA 3T4SA 4ARZB 1OTEA 2WKPA 1P0ZA 3F1OA 5J4EA 1VB6A 2EA9A 3MJQA 4QPRA 3MQOA 2K7SA 3F1NA 1Y28A 2P08A 2V1BA 2KLIA 2JKTM 4F3LB 4IUKA 3LIEA 4WF0A 1LSXA 3K3CA 1YSPA 2JKTI 4I38A 4PKYG 4BBTA 4BBUA 2LB9A 2L4RA 3MFXA 4EUVA 4OOMA 1F5MA 3MF0A 3EEAA 1UWNX 3H82B 2W3FA 2W1TA 3VE4A 1MC0A 3S7OA 4ETXA 2B18A 3E0YA 2V0UA 4FSFA 2W3GA 3B42A 2O99A 2A24B 2A2LA 4PKYA 1XJ6A 3LR5A 5K5BA 1TF1A 2Y79A 1GSXA 3A0VA 3PR6A 4Y2FA 2VJWA 3A0RA 3IBRA 5DF9A 3TW8A 1MKMA 4MN7A 2K2NA 4I3IA 3H7WA 3PBTA 2HGVA 2PR6A 2ZBBA 3S7NA 1LSVA 1ZTUA 3MR0A 5A8BA 2XRNA 3OLOA 4LPZA 4LRYC 2VV6A 5AVFA 4O01A 3CLOA 5HDCA 1UGUA 2J3WA 5DKLA 3E4PA 3MMHA 3KYZA 3UB7A 3E4OA 3LI9A 3NHQA 3K3DA 2P7JA 3KSGA 4HIAA 4BMWA 3O5YA 2Z6DA 4B93A 1D7EA 4JGQA 4NKPA 3NOUC 4WEKA 2D02A 5G4YA 3T4LA 4CLCB 1VHMA 2JHEA 5J7EA 3CITA 4WELA 3ICYA 2VV7A 1T1CA 5HWTA 3E98A 2O9AA 3FG8A 2VGLM 4R6LA 4KQDA 3W2ZA 5LBRA 4UEYA 3EOIA 3OCNA 3BWLA 5L8MA 4WN5A 4EETB 5HWVA 3KSHA 4EQ1A 1DP6A 3ZYTA 4LLOB 1W63M 3PBQA 3JVVA 1G6OA 2GX5A 2IA2A 4Q0HA 4KQOA 2DMWA 3CUEC 4MDZA 2L1MA 3PBRA 4II7A 4MN5A 4ME4A 3R4KA 2QYBA 4H6JB 1YAXA 2XA7S 3FC7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F98 A;  3K3C A;  3SW1 A;  5IS1 A;  4PKY G;  4R38 A;  4I38 A;  4MN6 A;  2ZOH A;  5HDD A;  5HD5 A;  3VE3 A;  3A0S A;  4GS9 A;  4BBT A;  1N9O A;  1LL8 A;  2OOL A;  2PHY A;  4HP9 A;  4BBU A;  3MFX A;  2L4R A;  4WUJ A;  3ULF A;  4EEU A;  4I39 A;  4KUK A;  4I5S A;  3H7W B;  3UB8 A;  4F3L A;  2QWS A;  3GEC A;  5J3W A;  3E4Q A;  2PYR A;  2W0N A;  1S4S A;  4EXO A;  1UWN X;  3H82 B;  4KUO A;  1N9L A;  1TS8 A;  3NJA A;  4HJ6 A;  3VE4 A;  1EW0 A;  2HV1 A;  4L9E A;  1MZU A;  1V9Z A;  2V0U A;  5KIZ A;  1S67 L;  4HI4 A;  4EER A;  1T18 A;  3CAX A;  4XT2 A;  3UB9 A;  2KDK A;  2A24 B;  1OJ5 A;  4XT2 B;  1V9Y A;  5TBM A;  1LT0 A;  1OTA A;  1GSV A;  1XFQ A;  2OWH A;  4HQA A;  4JGO A;  4PKY A;  3RTY A;  5DJU A;  1XJ6 A;  3MQQ A;  4HH3 A;  4RQ9 A;  1BYW A;  4M4X A;  3MXQ A;  5I5L A;  1XJ3 A;  1GSX A;  1D06 A;  2Z6C A;  3A0V A;  4GS9 B;  4HJ4 A;  1TS7 A;  1ODV A;  2PYP A;  1OTB A;  3A0R A;  3IBR A;  4JGR A;  1S4R A;  1NWZ A;  1T19 A;  4LRZ E;  2PR5 A;  4I3I A;  5DKK A;  2V0W A;  3H7W A;  2QKP A;  3LYX A;  3ZQ5 A;  2J80 A;  1OJG A;  2PR6 A;  2YKH A;  4H6J A;  2ZBB A;  4HJ3 A;  3UB6 A;  3NOT C;  4K08 A;  1LSV A;  5HDS A;  4GHI B;  3UE6 A;  3MR0 A;  2PDR A;  4HY8 A;  1T1B A;  5A8B A;  4R70 A;  5HZH A;  1KOU A;  2ZOI A;  3OLO A;  3UMD A;  4HNB A;  4LPZ A;  4LRY C;  1F9I A;  2VV6 A;  1OT9 A;  3KX0 X;  2PD7 A;  3F1P B;  4WL9 A;  3F1P A;  4I3A A;  5AVF A;  2VLG A;  3T50 A;  3UME A;  3CLO A;  4DJ3 A;  5HDC A;  3IS2 A;  3GDI A;  2KX6 A;  4EW7 A;  1UGU A;  3H82 A;  4GHI A;  3IS2 B;  2GJ3 A;  4JGP A;  2L0W A;  5DKL A;  2PD8 A;  2VV8 A;  4HH2 A;  1S1Z A;  2WKQ A;  2R78 A;  3E4P A;  3HJI A;  3LIF A;  1OTI A;  3E4O A;  4NXE A;  1XJ4 A;  3LI9 A;  3NHQ A;  2WKR A;  3UB7 A;  3K3D A;  2P7J A;  4HIA A;  1UWP X;  2H28 A;  3LUQ A;  2V1A A;  2Z6D A;  1G28 A;  3H9W A;  5AVE A;  5F5Y A;  1D7E A;  4LRX C;  3HJK A;  4NXB A;  5EFW A;  2BAS A;  1DP9 A;  4JGQ A;  4BBV A;  3PYP A;  1WA9 A;  1S66 L;  2QJ7 A;  2V9A A;  3NOU C;  4HP4 A;  5IU1 A;  5HSQ A;  3LIC A;  1GSW A;  3NOP C;  4EES A;  1S1Y A;  2D02 A;  5F68 A;  5G4Y A;  1P97 A;  4HOI A;  3F1N B;  2JHE A;  5J7E A;  2M1C A;  3VOL A;  3ICY A;  2VV7 A;  1T1C A;  4NXG A;  4DJ2 A;  5HWT A;  4L9G A;  3RH8 B;  2W27 A;  3BY8 A;  4I3J A;  1N9N A;  1TS6 A;  3F1O B;  4YWZ A;  4B9O A;  2JN7 A;  3FG8 A;  4R6L A;  4NXF A;  2YKF A;  2I9V A;  1XJ2 A;  5HD3 A;  4KQD A;  5DJT A;  4R3A A;  4GCZ A;  1DP8 A;  3CWF A;  2D01 A;  3LIB A;  5G4Z A;  4E04 A;  3C8C A;  4EEP A;  3BWL A;  3P7N A;  4WN5 A;  2VEA A;  3C2W A;  4EET B;  5HWV A;  1OTD A;  2A24 A;  2CMN A;  1OTE A;  1X0O A;  3LIA A;  5TBM B;  4EQ1 A;  2WKP A;  1DP6 A;  3B33 A;  1P0Z A;  3F1O A;  5J4E A;  1VB6 A;  2EA9 A;  4LLO B;  3MJQ A;  3D72 A;  2QHK A;  3LI8 A;  4HHD A;  3BY9 A;  3G6O A;  2B02 A;  3PHY A;  3MQO A;  1XFN A;  1LSW A;  2K7S A;  3F1N A;  1Y28 A;  2L1M A;  2INW A;  2V1B A;  1T1A A;  1DRM A;  2QJ5 A;  4L9F A;  4MN5 A;  5F6A A;  1OT6 A;  1TS0 A;  4WLA A;  5HWW A;  1JNU A;  4H6J B;  3EWK A;  4F3L B;  2OWJ A;  3EEH A;  3LIE A;  4GW9 A;  4WF0 A;  5F69 A;  1LSX A;  3FC7 A;  3LID A; 
#chains in the Genus database with same CATH topology
 1F98 A;  4X25 A;  1HVB A;  4ESP A;  3NIA A;  3G31 A;  2OOL A;  3CJM A;  4I5S A;  5J3W A;  2PYR A;  4RX3 A;  4DF6 A;  3LGO A;  1IYO A;  1SDN A;  3D4F A;  4FTX A;  3M2J A;  4DMZ A;  3C7U A;  3ZNY A;  1P9R A;  3MS6 A;  1YKD A;  4ARZ A;  1OJ5 A;  1V9Y A;  1OTA A;  1TVF A;  1XFQ A;  4ZJ2 A;  3RJU A;  3TOI A;  4QJG A;  4BQM A;  1OTB A;  2V0W A;  3ZQ5 A;  1E25 A;  1PRQ A;  3IX3 A;  4WZ4 A;  4HY8 A;  3C4P A;  4MBK A;  4R4S A;  1OT9 A;  4WZ5 A;  3G2Z A;  4I3A A;  1VET A;  3IS2 A;  4CLC D;  3ITB A;  4DDY A;  3LEZ A;  2XH9 A;  4LRX C;  1P9W A;  4OQG A;  5HSQ A;  2W1T B;  4LFU A;  1YT4 A;  4N1H A;  3NC8 A;  3VOL A;  3GTC A;  1K57 C;  3RH8 B;  4L9G A;  3BY8 A;  4I3J A;  1TS6 A;  4BL3 A;  3G4P A;  4DDS A;  1TEM A;  2FFY A;  1XA7 A;  4R3A A;  1DP8 A;  2O9C A;  3LIB A;  4C75 A;  2ZQC A;  1CJF A;  4F94 A;  2CMN A;  2HZ5 A;  4YNR A;  3KSI A;  1VET B;  5TBM B;  3VP3 A;  4OQH A;  4NG2 A;  1NLY A;  2EX8 A;  1FR6 A;  3VP0 A;  5HWW A;  4FOF A;  3T1X A;  2PU4 A;  3EWK A;  3FKV A;  2OWJ A;  3BEB A;  3LID A;  2GNX A;  2QZ6 A;  5E2F A;  2ZMV A;  4Z1W A;  4WUJ A;  3C7V A;  3AGE A;  2JKR M;  2HDR A;  4PM9 A;  3V67 A;  2XF3 A;  3ZNT A;  1I5Q A;  3ZVW A;  4LCM A;  4HES A;  1FIL A;  4U0X A;  1MZU A;  5IT5 A;  3IXH A;  5HAP A;  4X56 A;  4OQ0 A;  4R23 A;  1HLU P;  2W3H A;  2WKI A;  1S4R A;  1T19 A;  2XLN A;  1MBL A;  2J80 A;  3NDE A;  4G3V A;  2O9B A;  1IEL A;  5GLD A;  4R70 A;  2JE5 A;  1LLB A;  3F1P B;  3N7W A;  4PAU A;  3A3E A;  4OPR A;  1L0G A;  3UO9 A;  5JYP A;  2VV8 A;  3HJI A;  1L0E A;  1XJ4 A;  2A49 A;  3M6H A;  1K25 A;  2RCX A;  1MWU A;  3LIC A;  3MZF A;  1IKI A;  5A92 A;  1Y54 A;  1NRF A;  5C5K A;  3TE8 A;  5E2E A;  5DFX A;  1YQS A;  3S22 A;  3F1O B;  4YWZ A;  2YKF A;  2IWC A;  4X53 A;  3QP1 A;  1CI9 A;  1K4E A;  3DW0 A;  5HL1 A;  5EOE A;  1VEU A;  1MWT A;  4BD0 A;  3IX4 A;  4GZB A;  4HBT A;  2Y2P A;  3ZHH A;  2QHK A;  4IJG A;  1Q2P A;  1ERQ A;  3G6O A;  4E3J A;  1XFN A;  5HPI A;  1DRM A;  3G2Y A;  1NZU A;  4FH2 A;  1CQA A;  4OLD A;  5F69 A;  3IF6 A;  2K31 A;  4ZJ3 A;  2BLS A;  3P98 A;  1BLC A;  1L0D A;  2PHY A;  4HP9 A;  2VKS A;  3T12 B;  2W0N A;  2R9W A;  1IYP A;  4IBR A;  3UE3 A;  4B4X A;  4GD8 A;  4KZ6 A;  1G6A A;  4S2I A;  1KDS A;  3SS4 A;  1KGF A;  2ZL1 B;  4JXW A;  1LI0 A;  1W79 A;  4HH3 A;  2Y2K A;  3OCL A;  3C30 A;  1BSG A;  1O07 A;  2H0T A;  1MWS A;  3NOT C;  5CED A;  3HLF A;  4KZ9 A;  3O87 A;  1Y4O A;  3UMD A;  1C3B A;  4EBL A;  5HL6 A;  4DJ3 A;  1XX2 A;  3HVF A;  5CEB A;  1PW1 A;  3HLC A;  2WKQ A;  2EFX A;  3VOY A;  1GA0 A;  3LR4 A;  3LY4 A;  4S2M A;  3EQV A;  4Z9Q A;  4RA7 A;  2VX8 A;  3UDF A;  4PHT A;  1Z6F A;  1VEU B;  1DP9 A;  3O86 A;  2QJ7 A;  3V39 A;  1SKF A;  5TGF A;  3IT9 A;  4DE0 A;  5TFQ A;  5CGW A;  1P97 A;  1ZKJ A;  4NXG A;  3LCE A;  4B9O A;  1RP5 A;  5GLB A;  5CRF A;  4E6X A;  5E2H A;  3HL9 A;  4WYY A;  3E2L A;  2P08 A;  2I72 A;  1ERO A;  4JLF A;  3MKF A;  2JKT M;  3LIE A;  3O3V A;  1S0W A;  4I38 A;  3C5A A;  3UE0 A;  4BBT A;  2LB9 A;  4EUV A;  3EEA A;  3AGF A;  3H82 B;  3VE4 A;  3BFG A;  3E0Y A;  3ZG9 B;  3Q7V B;  5AQ7 A;  4XUX A;  3BFF A;  3B42 A;  1VQQ A;  2A2L A;  2JKF A;  2E8J A;  1XJ6 A;  5K5B A;  2HDQ A;  1YLW A;  4Y2F A;  3TW8 A;  1FCN A;  1ZC2 A;  3UNW A;  5HAQ A;  4MN7 A;  3PBT A;  2HGV A;  2Y2J A;  3S7N A;  3MZE A;  3WRT A;  5EUA A;  2IWB A;  2XRN A;  1K0K A;  4LRY C;  2WGI A;  3BRM A;  4O01 A;  4LV3 A;  5HDC A;  2WK0 A;  3E4P A;  3E4O A;  4WMC A;  4JF5 A;  1DJA A;  4JXG A;  4B93 A;  3OZH A;  4NKP A;  4UAA A;  4O7D A;  3OPL A;  5G4Y A;  1JVJ A;  2JHE A;  2ZC6 B;  3CIT A;  2VV7 A;  4FCF A;  2P74 A;  1J3W A;  3QP5 A;  3Q81 A;  4N9L A;  4KQD A;  3VFF A;  3W2Z A;  5LBR A;  3SZT A;  3VSK A;  1JTG A;  2JCH A;  1DP6 A;  5CGX A;  1E3U A;  4EUZ A;  3CUE C;  4II7 A;  1PIO A;  3ISG A;  3R4K A;  2C5W B;  3FC7 A;  4E3L A;  2Y2Q A;  4GS9 A;  4Q8I A;  3D3O A;  3ZFZ A;  1GHP A;  3S7Q A;  3TG9 A;  2OLU A;  5J8X A;  1S67 L;  4DKI A;  4HI4 A;  1PWD A;  4OPQ A;  3UB9 A;  2KDK A;  2V8C A;  4XT2 B;  2OWH A;  3PBO A;  3MQQ A;  2VGL S;  4X6T A;  4GS9 B;  4E3O A;  4HJ4 A;  1TS7 A;  4JGR A;  1JTD A;  2QKP A;  2ZQ7 A;  1OJG A;  2J7V A;  2XSS A;  4K08 A;  3MQ0 A;  5DVA A;  5EEC A;  3T4Q A;  3TRC A;  4UHU A;  5EV0 A;  1F9I A;  3KX0 X;  2VGK A;  3OPP A;  4Y13 A;  2KX6 A;  1ACF A;  3H82 A;  4JGP A;  1G5U A;  1BLP A;  4PPR A;  5FI6 A;  2Y2I A;  1PZP A;  2UV0 E;  1K56 D;  4BBV A;  4O0P A;  2WAF A;  1L3L A;  1A0K A;  3IWI A;  5CGS A;  5GHZ A;  4ID4 A;  1PZO A;  2OAQ 1;  4DXC A;  4OPY A;  4S2N A;  2BG1 A;  1K6R A;  2PRF A;  4PM8 A;  4GCZ A;  4WEJ A;  4UA9 A;  1PNE A;  4GD6 A;  2VGJ A;  1X0O A;  3CUE A;  3CHW P;  2O0Y A;  2B02 A;  1STZ A;  2INW A;  2QJ5 A;  2X71 A;  5TJJ A;  4CLC C;  1NLZ A;  3UY6 A;  4R38 A;  2DNS A;  5HDD A;  3VE3 A;  5EM1 A;  4P6Z S;  3WS2 A;  4EEU A;  4C6Y A;  1E3U D;  3ULF A;  1M40 A;  3RXX A;  1BLS A;  1TS8 A;  4HJ6 A;  1MPL A;  3DTI A;  1FSW A;  1HZO A;  2KOI A;  4IVI A;  3S4X A;  1FQG A;  2FFF B;  3HUO A;  2HJE A;  4P85 A;  1GSV A;  4UA7 A;  2WUQ A;  1SZV A;  3MXQ A;  1SDE A;  3G34 A;  4ETZ A;  1YLT A;  2WZX A;  3UN7 A;  3MXS A;  1ES4 A;  3UE6 A;  3FPV A;  2XD1 A;  1KOU A;  4E3M A;  3CZD A;  3OOV A;  5FI2 A;  1K4F A;  3Q1F A;  2GJ3 A;  4KZ4 A;  2EFU A;  2HJ9 C;  3LIF A;  1ZG6 A;  1H8M A;  1YLZ A;  1K55 A;  3ZDJ A;  3PBS A;  1PFL A;  1TD5 A;  1K55 C;  3IHA A;  4QY6 A;  3QHY A;  5IU1 A;  3RXW A;  3KYQ A;  1Q2Q A;  3GR2 A;  4KG5 A;  2NUP C;  2W27 A;  3BFE A;  4N9K A;  2Y4A A;  3GSG A;  2I9V A;  1XJ2 A;  3FPW A;  5DJT A;  3PAG A;  3PXP A;  2XFT A;  4X1M A;  4UQI M;  2X02 A;  2Z2M B;  2GDN A;  4R3J A;  5AJG A;  5HAI A;  4CQH A;  4HHD A;  1YLJ A;  4U0T A;  4K0X A;  1XXM A;  4P6Z M;  4YFM A;  5HZH A;  5F6A A;  3LO7 A;  1OT6 A;  4LGW A;  4GOG A;  2X01 A;  3G35 A;  3A3J A;  3L9K A;  3P09 A;  4QU3 A;  3BQA A;  1S4S A;  5FQK A;  3NJA A;  1IKG A;  5FQM A;  2JKR I;  1N4O A;  5L09 A;  4L9E A;  5CEC A;  2EWW A;  2HPB A;  4GB7 A;  4LV2 A;  5AQ9 A;  5CHJ A;  5TBM A;  4DN0 A;  1LT0 A;  5FEG A;  2WGW B;  3Q7Z A;  3GV9 A;  2PYP A;  1SKO A;  3EGD C;  1NWZ A;  5FAS A;  2W3E A;  4H6J A;  2ZM2 A;  1MWR A;  1QMF A;  2HP6 A;  5FQJ A;  3T4J A;  1HTZ A;  1OPX A;  2JC7 A;  1XKZ A;  2ZD8 A;  2PD7 A;  1IFQ A;  3T50 A;  3N8L A;  2OAP 1;  3IS2 B;  4NXE A;  3JYI A;  1W8Y A;  1GA9 A;  2XRO A;  2WYX A;  2P9V A;  2Y8H A;  1N9B A;  4Y3I A;  3R7W A;  3V3R A;  3HRE A;  1HD8 A;  2H5S A;  2VZW A;  5CTM A;  3CPT A;  5F1G A;  2QMI A;  2Y2M A;  4G3K A;  4O8G A;  3LEQ A;  1MKI A;  4E3N A;  4Q0I A;  4IED A;  1BLH A;  2ZL1 A;  4HEF A;  2D01 A;  1K6S A;  1LHY A;  1OTE A;  1P0Z A;  1VB6 A;  3MJQ A;  1BZA A;  2XR0 A;  4PM5 A;  3F1N A;  5EOO A;  4ZDX A;  2Q9M A;  4IUK A;  1G68 A;  4OP5 A;  1LSX A;  3MFX A;  3VP1 A;  3SH8 A;  1WYC A;  1BTL A;  1PWC A;  1ESI A;  2B18 A;  4S2N C;  4FSF A;  2W3G A;  3AGD A;  4NK3 A;  4PKY A;  4WM9 A;  3QP4 A;  3A0V A;  1YLP A;  3PR6 A;  4FUW A;  5CHM A;  5DF9 A;  5M1A A;  4RYE A;  1CEF A;  4S2L A;  2ZBB A;  2HDU A;  5DTK A;  1LSV A;  1M6K A;  1L0F A;  3MR0 A;  5A8B A;  1S6R A;  4QHC A;  1UGU A;  1BT5 A;  3MMH A;  2H0Y A;  3LI9 A;  5M19 A;  1CK3 A;  4BMW A;  2Z6D A;  4R1G A;  5A90 A;  1D7E A;  4FH4 A;  1DY6 A;  1E4D A;  3NOU C;  1PYY A;  4LV1 A;  1I2W A;  5J7E A;  2EX6 A;  3FZC A;  4WEL A;  3ICY A;  4XXR A;  3E98 A;  2O9A A;  4R6L A;  2VGL M;  1NYM A;  3OPH A;  4K0W A;  3EOI A;  3BWL A;  4WN5 A;  1MXO A;  3B3X A;  1W63 M;  4Q0H A;  2DMW A;  4MDZ A;  2L1M A;  3PBR A;  4MN5 A;  2PAV P;  2H10 A;  1YAX A;  4MBH A;  3SW1 A;  4JXV A;  4MN6 A;  1KDW A;  2GZA A;  1LL8 A;  3EGX C;  5EVI B;  3UB8 A;  3GEC A;  3BW6 A;  3EQU A;  2ZC5 B;  3IBJ A;  3Q82 A;  4KZ5 A;  2ZC7 A;  2CC1 A;  1YPR A;  3BEC A;  4Y0O A;  4GDB A;  1ES3 A;  3VFH A;  4KEN B;  4JKT A;  5FEF A;  4JPM A;  1H8Y A;  2YKH A;  4DXB A;  3PTE A;  3U4L P;  4ZBE A;  2G2U A;  3K2N A;  2ZOI A;  3E2K A;  1ERM A;  3DTE A;  1GCE A;  3R7W B;  4DE3 A;  2PD8 A;  1LI9 A;  2J3T D;  5EPH A;  5FQQ A;  5AVE A;  2V1A A;  4NXB A;  5GLA A;  4NEE D;  1EI5 A;  1SKO B;  3F1N B;  1FOF A;  2ZMA A;  5FAO A;  2EX2 A;  4RX2 A;  2ZQ8 A;  3UPN A;  2W3D A;  2PU2 A;  4L0L A;  1IYS A;  1NY0 A;  5FSR A;  1JWZ A;  1OTD A;  4Y0T A;  5EVI C;  4PMA A;  3BY9 A;  3O88 A;  3PHY A;  3CI6 A;  4QD4 A;  3NEC A;  1T1A A;  5FAP A;  1TS0 A;  4QY5 A;  4WZ5 C;  3HBR A;  1YM1 A;  2G7U A;  3HLG A;  3NCK A;  4D2O A;  3E4Q A;  2HP9 A;  2ZLY A;  1O7E A;  4KZA A;  2ZM0 A;  4CLC E;  4DE2 A;  4IHQ A;  4N1X A;  3CAX A;  3DTM A;  4OOY A;  1IEM A;  4A5R A;  5DJU A;  1BYW A;  2M7V A;  2DRW A;  2PBY A;  5L07 A;  4UQI S;  2Q9N A;  5BOH A;  3NI9 A;  1ZG4 A;  3LYX A;  2E8I A;  2Y2H A;  5HDS A;  3WS1 A;  5GL9 A;  3U2A A;  5GLC A;  3HLB A;  4KG6 A;  3IXB A;  3KSF A;  5FL3 A;  2HF6 A;  1PI4 A;  3SH9 A;  3C38 A;  2WKR A;  1J9M A;  3ZG0 A;  3ZVT A;  4YIN A;  5KSC A;  2V8F A;  4JXS A;  2V9A A;  5IHV A;  2M7U A;  3IX8 A;  4EES A;  4MBF A;  3QP2 A;  4HOI A;  4BEN A;  1XGJ A;  3N6I A;  5CER A;  3WS4 A;  2ZMF A;  5AQB A;  4KZ7 A;  4GJ4 A;  3CWF A;  2ZJ9 A;  5G4Z A;  2AVX A;  4N92 A;  4AFI A;  4OQI A;  4M3K A;  1YMS A;  2A24 A;  4IVK A;  3N8S A;  3B33 A;  1XP4 A;  3IF6 B;  3T4T A;  2Z2L B;  2XFS A;  3D72 A;  2V2F F;  3T1R A;  3BJN A;  3WS5 A;  1LSW A;  4GDN A;  2BTF P;  3UB5 P;  3EEH A;  2ZQ9 A;  4GW9 A;  3LFV A;  3ZG5 A;  5HD5 A;  1D1J A;  3LR0 A;  2Y2L A;  2MJ6 A;  4I39 A;  3A3F A;  1QME A;  3N8R A;  3OC2 A;  4EXO A;  1N9L A;  4BJP A;  1EW0 A;  3GVB A;  5KIZ A;  2WZZ A;  3W8K A;  2XK1 A;  3MXR A;  3MBZ A;  4JGO A;  4HQA A;  4OP8 A;  1YMX A;  1YSQ A;  1RGY A;  1KE0 A;  4OVD A;  5DF7 A;  4GN2 A;  1ODV A;  4LRZ E;  2PR5 A;  3W4O A;  1NJ4 A;  5EM0 A;  2UWX A;  4OH0 A;  3UB6 A;  5KSH A;  2EXA A;  4HNB A;  3KYE A;  1FR1 A;  4WL9 A;  3S1Y A;  1NRJ A;  3WRZ A;  5CX7 A;  2WGW A;  1BUE A;  1OTI A;  3KO6 A;  2WKH A;  3H9W A;  1G28 A;  4LV0 A;  1FIK A;  4LEN A;  1TDG A;  3IF6 C;  1JWP A;  4EV4 A;  3GMW A;  2BAS A;  2C6W B;  4HP4 A;  4DE1 A;  2Y91 A;  5F68 A;  4C3Q A;  3Q07 A;  5L2F A;  5DFY A;  4OOL A;  1ONG A;  4FD8 A;  1N9N A;  1KGE A;  1ALQ A;  3IXD A;  4EU0 A;  4EEP A;  3C8C A;  2J9P A;  3TSG A;  3C2W A;  3IH8 A;  3V5M A;  2WKP A;  3F1O A;  2EA9 A;  4JBF A;  4QPR A;  1KVM A;  3NUL A;  4BD1 A;  4B4Z A;  2J8Y A;  2K7S A;  1Y28 A;  2V1B A;  4EWF A;  2KLI A;  5AQA A;  1H0M A;  3K3C A;  3FYZ A;  4PKY G;  2JKT I;  3A3I A;  1NZO A;  4BBU A;  4CJN A;  2L4R A;  2DCF A;  5G18 A;  1Z09 A;  1UWN X;  2W1T A;  1MC0 A;  3ZGA B;  4S2K A;  5D3O A;  2A24 B;  3IH9 A;  1WE4 A;  4H8R A;  3LR5 A;  1NYY A;  1TF1 A;  1GSX A;  4NET A;  3WWX A;  1PI5 A;  3G32 A;  3T1Q B;  4Y17 A;  5CHU A;  4EBP A;  4I3I A;  2PR6 A;  2XD5 A;  3HUN A;  1AWI A;  4OLG A;  1XA1 A;  5A91 A;  3JPU A;  3FKW A;  2J3W A;  5DKL A;  3KYZ A;  3NHQ A;  4HIA A;  2P7J A;  2OLV A;  1KE4 A;  4EBN A;  5E2G A;  4JGQ A;  2V1Z A;  1NXY A;  2D02 A;  1H8Z A;  2JBF A;  3T4L A;  1T1C A;  5HWT A;  5L10 A;  1JWV A;  2B5R A;  4ZAM A;  5FAT A;  4UEY A;  5L8M A;  3DWZ A;  4OON A;  5EVL A;  4EET B;  5HWV A;  5EVE A;  3KSH A;  4EQ1 A;  5E43 A;  3JVV A;  1G6O A;  2IA2 A;  3HLD A;  2ZQA A;  5DF8 A;  3BLM A;  1RGZ A;  1ES5 A;  3QP6 A;  5F1F A;  1EWZ A;  1SCW A;  4Y0U A;  1H3Q A;  2P9V B;  4KUK A;  1FCO A;  4X69 A;  2QWS A;  3OBF A;  2OV5 A;  2ZQD A;  1K38 A;  1K57 A;  2HV1 A;  3NDG A;  1V9Z A;  1IOU A;  5HPF A;  2WGV A;  4EER A;  3TJZ C;  3RTY A;  5FI7 A;  2NUT C;  4RQ9 A;  5I5L A;  4R0Q A;  5HX9 A;  1D06 A;  4UA6 A;  1VM1 A;  3RFB A;  3UDX A;  4MEZ A;  5A93 A;  2PDR A;  2RL3 A;  4PM6 A;  3D9Y A;  3F1P A;  2VLG A;  4HBU A;  2L0W A;  1S1Z A;  4R4R A;  2R78 A;  3B47 A;  4Q0J A;  3ZG8 B;  3DTK A;  4LCL A;  3LUQ A;  5FDH A;  5F5Y A;  1K54 C;  3S7P A;  3PBN A;  4BLM A;  1WA9 A;  4MCW A;  4D60 A;  3LY3 A;  3NOP C;  3SH7 A;  3CPT B;  3QNB A;  2LB5 A;  1MY8 A;  3L7H A;  2V20 A;  3ZCZ A;  5HW3 A;  5EE8 A;  1FSY A;  1AXB A;  3VMA A;  4G3W A;  3DAV A;  2HDS A;  4S2J A;  4U3T A;  2JKG A;  3IHB A;  3OPR A;  4X1L A;  2VEA A;  3LIA A;  5TR7 A;  3T4K A;  4QWO A;  2J9O A;  2J3T C;  2Y2G A;  1PWG A;  5FQI A;  3LR3 A;  4S2P A;  4CLC A;  2EX9 A;  4WLA A;  1JNU A;  4XUZ A;  4CPK A;  3LI8 A;  3SOI A;  3PAE A;  1YLY A;  3A0S A;  2R9X A;  4MNR A;  4GNU A;  4BL2 A;  3MSH A;  3H7W B;  5MC7 A;  2XEP A;  3BYD A;  1SHV A;  4BWI A;  3Q7V A;  4MLL A;  4DRT A;  3DBA A;  5CXW A;  1ZHH B;  4XT2 A;  3UE1 A;  2ZM8 A;  5EVI D;  2Y59 A;  5FAQ A;  4ZRR A;  1PW8 A;  2XQZ A;  1GHM A;  2XGN A;  3SS3 A;  2QPN A;  3G30 A;  3GDI A;  4EW7 A;  1OME A;  4GHI A;  4Y5F A;  4HH2 A;  5IS1 A;  2FZ0 A;  4GLQ A;  5GHY A;  4RVA A;  1UWP X;  2H28 A;  3N4I A;  2PT7 A;  5EFW A;  2XA7 M;  3VOZ A;  2Y2N A;  2ACG A;  1S66 L;  2B95 A;  4R3B A;  4E3K A;  4E3I A;  1S1Y A;  3BFD A;  4IUH A;  4KZB A;  2IWD A;  4DJ2 A;  2JN7 A;  2PBD P;  1U60 A;  3A3D A;  3ITA A;  5HD3 A;  4S2O A;  5HAR A;  4E04 A;  4EQI A;  3V50 A;  1XPB A;  3HLE A;  5F83 A;  2ZC4 B;  1H5X A;  4Y15 A;  3M6B A;  2Y55 A;  4KQQ A;  3W4Q A;  4L9F A;  1CF0 A;  4WMC D;  4Y7P A;  3P01 A;  2ZOH A;  3CG5 A;  1N9O A;  2EXB A;  2P04 A;  3BLS A;  4F3L A;  3UPO A;  3SS5 A;  4KUO A;  4GKU A;  2HP5 A;  3V3S A;  4JF6 A;  1T18 A;  2A3U A;  3JVU A;  3BFC A;  4JF4 A;  5JYO A;  1GHI A;  4M4X A;  1XJ3 A;  1W5D A;  2Z6C A;  3GRJ A;  3IWQ A;  5DKK A;  4B88 A;  1I2S A;  3VV4 A;  4HJ3 A;  2OSU A;  3BM6 A;  5DTS A;  4GHI B;  2FH5 A;  4KQR A;  1T1B A;  5EVI A;  3UME A;  4P0M A;  3VP2 A;  1LL9 A;  3FWL A;  5FDS A;  4KG2 A;  3HJK A;  3BQ8 A;  1WYB A;  4KZ3 A;  3W4P A;  1CEG A;  2VA0 A;  3PYP A;  1W8Q A;  1L2S A;  3NY4 A;  1GSW A;  3T4O A;  1W63 Q;  3IWO A;  4KZ8 A;  4K91 A;  2M1C A;  2EWV A;  2Y2O A;  2WAE A;  1KVL A;  4MMN A;  4YOF A;  4NXF A;  5GHX A;  2W1R A;  2VK3 A;  2WAD A;  3M2K A;  3HCY A;  3HUM A;  1LL5 A;  3P7N A;  3T4S A;  4ARZ B;  5J4E A;  5FQ9 A;  3IXG A;  3T1S A;  2XDM A;  3UDI A;  4E6W A;  5U47 A;  1TDL A;  1RCJ A;  3MQO A;  1KGG A;  3GQZ A;  5HFO A;  1FCM A;  4OKP A;  5KMW A;  2ZC3 B;  4F3L B;  5FA7 A;  4WF0 A;  1K56 A;  3NBL A;  1YSP A;  3IF5 A;  4QB8 A;  4WBG A;  4OOM A;  1F5M A;  4ZJ1 A;  3MF0 A;  3CMZ A;  2W3F A;  1DJC A;  3S7O A;  4ETX A;  2V0U A;  1IYQ A;  3VP4 A;  2O99 A;  1F2K A;  3MKE A;  5CTN A;  2Y79 A;  4ZTK A;  2VJW A;  1KE3 A;  3A0R A;  3IBR A;  1MKM A;  5M18 A;  2K2N A;  3H7W A;  3WS0 A;  1ZTU A;  3MZD A;  4X55 A;  3OLO A;  4LPZ A;  2VV6 A;  5AVF A;  3UPP A;  3DWK A;  5F82 A;  3CLO A;  3QNC A;  3I7J A;  1DJB A;  3UB7 A;  3K3D A;  3KSG A;  3O5Y A;  1ES2 A;  1BUL A;  4X68 A;  4WEK A;  1ONH A;  2Q0O A;  4CLC B;  1VHM A;  3C4O A;  4P6B A;  3QP8 A;  5I94 A;  3FG8 A;  4P87 A;  2WKE A;  1ESU A;  3OCN A;  4OPZ A;  4PM7 A;  3HLW A;  3FV7 A;  3ZG7 B;  1CI8 A;  1W7F A;  5DTT A;  1XGI A;  3ZYT A;  4LLO B;  3VSL A;  3PBQ A;  2GX5 A;  4KQO A;  5KZH A;  3IQA A;  2G2W A;  4ME4 A;  4IBX A;  2QYB A;  3MFD A;  4H6J B;  2XA7 S;  1K54 A; 
#chains in the Genus database with same CATH homology
 1F98 A;  3SW1 A;  4MN6 A;  2GZA A;  1H3Q A;  4GS9 A;  2OOL A;  1LL8 A;  4KUK A;  3EGX C;  3D3O A;  4I5S A;  3UB8 A;  2QWS A;  3BW6 A;  3GEC A;  3EQU A;  3OBF A;  5J3W A;  2PYR A;  3S7Q A;  3IBJ A;  2HV1 A;  1V9Z A;  1IOU A;  4DMZ A;  5HPF A;  1S67 L;  1P9R A;  4HI4 A;  4EER A;  1YKD A;  3UB9 A;  2KDK A;  4XT2 B;  1OJ5 A;  3TJZ C;  1V9Y A;  4ARZ A;  2OWH A;  1OTA A;  3PBO A;  1XFQ A;  3RTY A;  3MQQ A;  2NUT C;  4RQ9 A;  2VGL S;  5I5L A;  1D06 A;  4GS9 B;  4HJ4 A;  1TS7 A;  4JGR A;  1OTB A;  3RFB A;  2V0W A;  2QKP A;  3ZQ5 A;  1OJG A;  2YKH A;  2XSS A;  4K08 A;  3MQ0 A;  3T4Q A;  2PDR A;  3K2N A;  4HY8 A;  3TRC A;  2ZOI A;  1F9I A;  1OT9 A;  3KX0 X;  3F1P A;  4I3A A;  2VLG A;  3R7W B;  3IS2 A;  2KX6 A;  3H82 A;  4JGP A;  4CLC D;  2L0W A;  2PD8 A;  2J3T D;  1S1Z A;  2R78 A;  3B47 A;  4Q0J A;  3LUQ A;  5AVE A;  2V1A A;  5F5Y A;  4LRX C;  4NXB A;  1P9W A;  3PBN A;  3S7P A;  4BBV A;  4O0P A;  1WA9 A;  4NEE D;  4MCW A;  5HSQ A;  2W1T B;  3NOP C;  3F1N B;  2LB5 A;  3VOL A;  3RH8 B;  4L9G A;  3BY8 A;  4I3J A;  2OAQ 1;  1TS6 A;  2W3D A;  4R3A A;  4GCZ A;  1DP8 A;  2O9C A;  3LIB A;  4G3W A;  4WEJ A;  4L0L A;  2VEA A;  1OTD A;  2CMN A;  4YNR A;  3LIA A;  1X0O A;  3KSI A;  5TBM B;  3CUE A;  3T4K A;  1NLY A;  2J3T C;  3BY9 A;  2O0Y A;  2B02 A;  3PHY A;  1STZ A;  3CI6 A;  3LR3 A;  4CLC A;  2INW A;  1T1A A;  2QJ5 A;  1TS0 A;  4WLA A;  5HWW A;  1JNU A;  4FOF A;  5TJJ A;  4CLC C;  3EWK A;  2OWJ A;  3LI8 A;  3LID A;  1NLZ A;  4R38 A;  2GNX A;  5HDD A;  3VE3 A;  2ZMV A;  3A0S A;  4Z1W A;  4P6Z S;  4EEU A;  3ULF A;  4WUJ A;  5MC7 A;  2G7U A;  2JKR M;  3H7W B;  3V67 A;  3E4Q A;  1TS8 A;  4HJ6 A;  4BWI A;  1MZU A;  5IT5 A;  2KOI A;  4CLC E;  3DBA A;  4IHQ A;  3CAX A;  1ZHH B;  4XT2 A;  2HJE A;  1GSV A;  5DJU A;  1BYW A;  3MXQ A;  2M7V A;  4ETZ A;  2W3H A;  4UQI S;  1S4R A;  1T19 A;  4ZRR A;  3LYX A;  2J80 A;  3UE6 A;  5HDS A;  4G3V A;  2O9B A;  3FPV A;  3U2A A;  4R70 A;  1KOU A;  3OOV A;  3F1P B;  3KSF A;  4PAU A;  5FL3 A;  2HF6 A;  3GDI A;  4EW7 A;  4GHI A;  2GJ3 A;  4Y5F A;  2VV8 A;  3C38 A;  2HJ9 C;  4HH2 A;  3LIF A;  3HJI A;  5IS1 A;  1XJ4 A;  1H8M A;  2WKR A;  2FZ0 A;  4GLQ A;  1UWP X;  2H28 A;  3PBS A;  2PT7 A;  1TD5 A;  5EFW A;  2XA7 M;  1S66 L;  2V9A A;  5IU1 A;  3LIC A;  2M7U A;  4EES A;  1S1Y A;  3KYQ A;  4HOI A;  4IUH A;  2NUP C;  5C5K A;  3TE8 A;  4DJ2 A;  5DFX A;  2W27 A;  2ZMF A;  3F1O B;  4YWZ A;  2JN7 A;  2YKF A;  2I9V A;  1XJ2 A;  4GJ4 A;  5HD3 A;  3FPW A;  5DJT A;  3CWF A;  5G4Z A;  3PXP A;  4E04 A;  4UQI M;  4AFI A;  2A24 A;  3B33 A;  3T4T A;  5AJG A;  4CQH A;  3D72 A;  2QHK A;  4IJG A;  3BJN A;  4HHD A;  3G6O A;  1XFN A;  1LSW A;  5HPI A;  4P6Z M;  4L9F A;  1DRM A;  5HZH A;  5F6A A;  1OT6 A;  3EEH A;  4GW9 A;  3LFV A;  5F69 A;  3P01 A;  2K31 A;  2ZOH A;  5HD5 A;  1N9O A;  2PHY A;  3LR0 A;  4HP9 A;  2MJ6 A;  4I39 A;  2P04 A;  2VKS A;  4F3L A;  2W0N A;  3BQA A;  1S4S A;  3OC2 A;  4KUO A;  4EXO A;  1N9L A;  3NJA A;  4BJP A;  3UE3 A;  1EW0 A;  2JKR I;  4L9E A;  5KIZ A;  2EWW A;  1T18 A;  3JVU A;  5TBM A;  4DN0 A;  1LT0 A;  4HQA A;  4JGO A;  4HH3 A;  1YSQ A;  4M4X A;  3OCL A;  1XJ3 A;  3C30 A;  2Z6C A;  1ODV A;  2PYP A;  3EGD C;  1NWZ A;  4LRZ E;  2PR5 A;  5DKK A;  2W3E A;  3VV4 A;  4HJ3 A;  4H6J A;  3UB6 A;  3NOT C;  4GHI B;  5KSH A;  2FH5 A;  1T1B A;  3T4J A;  3UMD A;  4HNB A;  1OPX A;  2PD7 A;  4WL9 A;  1IFQ A;  5HL6 A;  3T50 A;  3UME A;  4DJ3 A;  1NRJ A;  2OAP 1;  3IS2 B;  5CX7 A;  2WKQ A;  4NXE A;  2XRO A;  1OTI A;  3KO6 A;  3LR4 A;  3EQV A;  2Y8H A;  3H9W A;  1G28 A;  2VX8 A;  4PHT A;  4Y3I A;  3R7W A;  3HJK A;  3BQ8 A;  2BAS A;  1DP9 A;  2VA0 A;  3PYP A;  2QJ7 A;  4HP4 A;  1GSW A;  3T4O A;  2VZW A;  5F68 A;  1W63 Q;  1P97 A;  2M1C A;  2EWV A;  4G3K A;  4O8G A;  4NXG A;  5DFY A;  4OOL A;  4MMN A;  4YOF A;  1N9N A;  4Q0I A;  4B9O A;  4NXF A;  2W1R A;  4EU0 A;  3HCY A;  4EEP A;  2D01 A;  3C8C A;  3P7N A;  3C2W A;  3T4S A;  4ARZ B;  1OTE A;  2WKP A;  1P0Z A;  3F1O A;  5J4E A;  1VB6 A;  2EA9 A;  3MJQ A;  4QPR A;  3MQO A;  2K7S A;  3F1N A;  1Y28 A;  2P08 A;  2V1B A;  2KLI A;  2JKT M;  4F3L B;  4IUK A;  3LIE A;  4WF0 A;  1LSX A;  3K3C A;  1YSP A;  2JKT I;  4I38 A;  4PKY G;  4BBT A;  4BBU A;  2LB9 A;  2L4R A;  3MFX A;  4EUV A;  4OOM A;  1F5M A;  3MF0 A;  3EEA A;  1UWN X;  3H82 B;  2W3F A;  2W1T A;  3VE4 A;  1MC0 A;  3S7O A;  4ETX A;  2B18 A;  3E0Y A;  2V0U A;  4FSF A;  2W3G A;  3B42 A;  2O99 A;  2A24 B;  2A2L A;  4PKY A;  1XJ6 A;  3LR5 A;  5K5B A;  1TF1 A;  2Y79 A;  1GSX A;  3A0V A;  3PR6 A;  4Y2F A;  2VJW A;  3A0R A;  3IBR A;  5DF9 A;  3TW8 A;  1MKM A;  4MN7 A;  2K2N A;  4I3I A;  3H7W A;  3PBT A;  2HGV A;  2PR6 A;  2ZBB A;  3S7N A;  1LSV A;  1ZTU A;  3MR0 A;  5A8B A;  2XRN A;  3OLO A;  4LPZ A;  4LRY C;  2VV6 A;  5AVF A;  4O01 A;  3CLO A;  5HDC A;  1UGU A;  2J3W A;  5DKL A;  3E4P A;  3MMH A;  3KYZ A;  3UB7 A;  3E4O A;  3LI9 A;  3NHQ A;  3K3D A;  2P7J A;  3KSG A;  4HIA A;  4BMW A;  3O5Y A;  2Z6D A;  4B93 A;  1D7E A;  4JGQ A;  4NKP A;  3NOU C;  4WEK A;  2D02 A;  5G4Y A;  3T4L A;  4CLC B;  1VHM A;  2JHE A;  5J7E A;  3CIT A;  4WEL A;  3ICY A;  2VV7 A;  1T1C A;  5HWT A;  3E98 A;  2O9A A;  3FG8 A;  2VGL M;  4R6L A;  4KQD A;  3W2Z A;  5LBR A;  4UEY A;  3EOI A;  3OCN A;  3BWL A;  5L8M A;  4WN5 A;  4EET B;  5HWV A;  3KSH A;  4EQ1 A;  1DP6 A;  3ZYT A;  4LLO B;  1W63 M;  3PBQ A;  3JVV A;  1G6O A;  2GX5 A;  2IA2 A;  4Q0H A;  4KQO A;  2DMW A;  3CUE C;  4MDZ A;  2L1M A;  3PBR A;  4II7 A;  4MN5 A;  4ME4 A;  3R4K A;  2QYB A;  4H6J B;  1YAX A;  2XA7 S;  3FC7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...