4M4XA

Structure and dimerization properties of the aryl hydrocarbon receptor (ahr) pas-a domain
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
160
structure length
126
Chain Sequence
GSMLQEGEFLLQALNGFVLVVTADALVFYASSTIQDYLGFQQSDVIHQSVYELIHTEDRAEFQRQLHWALNPDNASFMERCFRCRLRCLLDNSSGFLAMNFQGRLKYLHGQNLPPQLALFAIATPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aryl hydrocarbon receptor
publication title Structure and dimerization properties of the aryl hydrocarbon receptor PAS-A domain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 32
structure length 126
sequence length 160
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4m4xA00
3LIAA 2D01A 1XJ3A 3F1NB 3UMEA 5I5LA 2PD8A 3BY8A 4GS9A 5J7EA 4DJ2A 3EWKA 1N9LA 3UB7A 5HD5A 1OJ5A 1S4RA 4L9GA 4MN6A 3FG8A 3UE6A 4WL9A 2KDKA 2ZOHA 1LSVA 3D72A 2W0NA 4R6LA 1TS8A 3UMDA 3ULFA 1X0OA 4HY8A 1T19A 5HWTA 3CWFA 2W27A 4JGOA 3LIEA 1S1ZA 2L1MA 3LI8A 2QJ7A 2V1AA 3HJKA 5J3WA 3NHQA 3RTYA 4HIAA 1P97A 3MJQA 4R70A 2GJ3A 2OWJA 3LIDA 3F1NA 2Z6CA 1OT6A 4JGRA 3KX0X 3SW1A 1OT9A 4NXGA 4I3IA 1GSVA 3E4PA 5HZHA 2PYPA 1Y28A 4MN5A 3K3CA 4EERA 3IS2A 1UWNX 5DKLA 4YWZA 4WUJA 4GHIA 5HSQA 1S67L 3LIBA 1LSXA 3FC7A 3B33A 4I5SA 4RQ9A 1BYWA 4I39A 3VE4A 3C8CA 1F9IA 3T50A 2Z6DA 3NOUC 4HNBA 2V0UA 2VV6A 1XJ4A 4WF0A 3ZQ5A 5AVEA 2OWHA 5HDSA 1LSWA 4HJ6A 2R78A 1OTBA 2L0WA 2QWSA 1DRMA 1F98A 4LRYC 4KUOA 1NWZA 2VV7A 1EW0A 1D7EA 2EA9A 4F3LA 4I3JA 5G4YA 2HV1A 3IS2B 1T18A 1S4SA 1D06A 4GHIB 2J80A 3LI9A 1N9OA 3CAXA 5DJUA 4HHDA 5HDCA 1OTAA 4HJ4A 4I3AA 1OTEA 3NOTC 3NJAA 4BBUA 3HJIA 2PR6A 5EFWA 4KQDA 2INWA 1MZUA 3F1OA 5KIZA 4I38A 1DP9A 1DP6A 1T1CA 2QKPA 1T1BA 2A24A 2PDRA 4EW7A 1S1YA 2YKFA 2QHKA 3C2WA 3H9WA 1TS0A 4EESA 4F3LB 4GCZA 2ZOIA 1DP8A 2WKQA 4EETB 3A0VA 4GW9A 3GDIA 2OOLA 4M4XA 1OJGA 2KX6A 1GSWA 4HP9A 3PYPA 3NOPC 3VOLA 3MFXA 3IBRA 4H6JA 1TS6A 4LLOB 4EEUA 3PHYA 1P0ZA 2JHEA 2YKHA 3P7NA 3UB8A 3G6OA 4PKYG 1G28A 1KOUA 1GSXA 3F1OB 4NXBA 3ICYA 1OTIA 4HQAA 2A24B 2L4RA 3LUQA 1T1AA 3LIFA 5HWVA 1WA9A 2K7SA 2PD7A 3LYXA 1XFQA 3K3DA 4R38A 1N9NA 4L9EA 2ZBBA 3E4QA 4EQ1A 1V9YA 2QJ5A 3F1PA 3H7WA 2VLGA 4HOIA 3EEHA 1ODVA 5F5YA 2H28A 1JNUA 4BBTA 1V9ZA 2V0WA 3MQOA 5AVFA 3UB6A 2P7JA 4LPZA 2BASA 4PKYA 3MQQA 2V1BA 5F68A 4H6JB 4HP4A 5HD3A 4B9OA 3RH8B 5DKKA 4E04A 2JN7A 5DJTA 3MR0A 1S66L 2D02A 3H82A 4NXEA 4LRZE 1XJ6A 3CLOA 2V9AA 1TS7A 1XFNA 5HWWA 3BY9A 4XT2A 2WKPA 3A0SA 4JGPA 4NXFA 3MXQA 5TBMB 3BWLA 5HDDA 2PHYA 2M1CA 5F69A 4WN5A 5G4ZA 4WLAA 5IS1A 3F1PB 3H7WB 3GECA 1LL8A 5A8BA 4L9FA 2PR5A 3E4OA 1LT0A 4GS9B 4LRXC 4HJ3A 3LICA 2CMNA 2PYRA 4DJ3A 4HH2A 3VE3A 4EEPA 2VV8A 1OTDA 4EXOA 4BBVA 4JGQA 3OLOA 3H82B 4HI4A 2I9VA 4XT2B 4R3AA 4K08A 1UGUA 1XJ2A 3UB9A 5TBMA 5IU1A 5F6AA 5J4EA 2WKRA 2B02A 4KUKA 1UWPX 3A0RA 2VEAA 1VB6A 4HH3A
chains in the Genus database with same CATH superfamily
2A49A 2UWXA 1VM1A 3F1NB 2VJWA 4S2LA 2XFSA 5E2HA 2EX8A 3SH7A 1IOUA 4DJ2A 2W3HA 3EWKA 2FFYA 2H0TA 5HD5A 3BFCA 1OJ5A 4L9GA 4LV0A 1K54A 2P04A 1J3WA 3IF6A 3BM6A 2ZOHA 1ZG6A 3HLBA 2CC1A 3MQ0A 4N92A 1DJBA 5F1GA 2W0NA 2IWDA 2RL3A 3R4KA 1W63M 1CF0A 2C5WB 2P74A 5HWTA 2J7VA 4E6XA 1XGJA 4JGOA 1P9WA 3LIEA 1K25A 2QJ7A 4CLCE 1YLJA 3MXSA 4WYYA 5J3WA 3FKVA 2XR0A 4WELA 3NHQA 1H8YA 1P97A 4S2MA 4UHUA 2W3FA 3BECA 3LIDA 3PBQA 5CGXA 1OT6A 5L2FA 2HZ5A 3OC2A 1OT9A 3VP0A 3HUOA 5FQMA 3TE8A 3DTKA 2XEPA 1KGGA 1YT4A 4CLCC 4MN5A 3K3CA 2Y2QA 3MFDA 2IWCA 4OP5A 1ACFA 1ZG4A 1JTDA 4GHIA 5HSQA 2E8JA 1S67L 5FAOA 1LSXA 3ZG5A 3CZDA 3T12B 3PBSA 1SCWA 3HUMA 2FZ0A 5CRFA 2XD5A 5EVIA 1PI4A 2Y2HA 3HLCA 3GVBA 2V0UA 2VV6A 2WGIA 4E3MA 3WWXA 3BLMA 4WF0A 5EVID 3ZQ5A 4EUZA 3LEQA 3KSHA 1NRJA 1LSWA 2R78A 2L0WA 4DF6A 1YSQA 2QWSA 1I5QA 5DTSA 5FA7A 2OLVA 4KUOA 2QMIA 2J3TC 1XXMA 2VV7A 2EA9A 4HEFA 1FR6A 1CJFA 5FQQA 3WRTA 1MWTA 3TW8A 1T18A 1D06A 2J80A 1N9OA 1XA7A 3CAXA 3QP6A 3PTEA 4E6WA 2PT7A 1YSPA 2ZD8A 3A3FA 1OTEA 1PNEA 2WKHA 2ZQAA 4JPMA 1NZOA 3HJIA 2PR6A 4IVIA 5MC7A 4D60A 1KGFA 2B5RA 2EX9A 5EM1A 4S2KA 4GKUA 1MZUA 5KIZA 3LEZA 1DP6A 3RFBA 1TEMA 2XK1A 4YINA 2A3UA 1D1JA 2QHKA 3L7HA 3UPPA 4DE1A 3Q07A 3IWQA 5CXWA 4OPQA 1TS0A 2EX6A 4F3LB 4OKPA 2OSUA 1DP8A 2WKQA 2Q0OA 1K57A 4PM8A 3O3VA 3SZTA 4Q0JA 4M4XA 2OOLA 1GSWA 3N6IA 3V5MA 1ES3A 2Q9NA 2WKIA 4WMCA 1BTLA 1MWSA 4QPRA 4BLMA 1NYMA 4WZ5C 2M7UA 4DN0A 1Z6FA 1BUEA 4R4SA 4H8RA 4MLLA 4MCWA 4HBUA 3OPHA 1FOFA 4LLOB 4WMCD 1XPBA 2M7VA 3M6HA 2ZC7A 2GDNA 3ZGAB 2Y59A 2ZC5B 1GCEA 5HL1A 1W63Q 4Q0HA 4X6TA 1L0EA 1XX2A 3WS4A 4E3OA 1OTIA 3E2KA 4N1HA 3LUQA 2Y2PA 2PD7A 3LYXA 1JWPA 5KSCA 3S7QA 1MPLA 1LL5A 2QJ5A 3IX8A 4P6ZS 4EQIA 2WYXA 4HESA 1Q2PA 5F82A 4BBTA 5AQAA 2IA2A 4N9LA 3MS6A 3LY4A 3IXDA 5FI6A 3NBLA 1V9ZA 3W2ZA 2PU2A 2V0WA 1FCNA 5M1AA 1YLZA 1ZHHB 3MQOA 4JF5A 5AVFA 3V3RA 2BASA 3MQQA 4IVKA 1WYCA 3T1RA 2Y91A 1SKOA 5DKKA 2XLNA 2JN7A 3IWOA 5HAQA 3HVFA 1S66L 4MMNA 3BLSA 3A3EA 4NXEA 1C3BA 1KVLA 1K54C 1RGYA 3DTIA 3IF6C 3MZDA 4EU0A 5HWWA 3T1QB 4BL3A 2A2LA 4XT2A 1N4OA 4CLCA 1BLCA 3PAEA 3MXQA 5AQ9A 3PBOA 5TBMB 4RVAA 3T4OA 2M1CA 2W1TB 5G4ZA 5U47A 2G2WA 4WLAA 3F1PB 1LL8A 4QY6A 3GRJA 3EQUA 2FFFB 2JCHA 1FSWA 4Y3IA 5GLDA 4JXWA 3A3JA 3DBAA 2RCXA 4GD6A 4NK3A 1EWZA 3G30A 3OPLA 3GR2A 4U3TA 4UA7A 3U2AA 4GN2A 1HZOA 4BBVA 4JGQA 5DF7A 4GB7A 4KG6A 2LB9A 4OOYA 4KZ8A 4HI4A 2I9VA 3KYQA 4OPYA 1FILA 3GV9A 3NC8A 2X71A 3IHAA 4BMWA 3KO6A 5EVIC 2B02A 1FQGA 1BLSA 2Y79A 1UWPX 3A0RA 2VEAA 4HH3A 2Y2OA 1MKIA 5EVEA 4RYEA 3VP1A 5HARA 5J7EA 1KE0A 1LI9A 3TOIA 1N9LA 4B88A 1ZTUA 4F94A 3GTCA 1FIKA 1S4RA 4DMZA 3SS5A 3O86A 4WL9A 2KDKA 4PPRA 1LSVA 3D72A 1VHMA 4R6LA 3UMDA 1X0OA 4DDYA 2X01A 4FSFA 5E2FA 2ZQ8A 2QZ6A 2HP6A 3B42A 3UNWA 5EVLA 3LR5A 5EECA 1W79A 4OQGA 1S1ZA 2L1MA 2UV0E 2V1AA 2X02A 2R9WA 1ESUA 3TRCA 5HAIA 3QNBA 4II7A 4HIAA 2Y4AA 1H8ZA 5FQKA 4M3KA 4OLGA 4ZDXA 4QU3A 3GSGA 2VKSA 3ISGA 4XXRA 1VETB 3KX0X 3VMAA 3MSHA 1ES4A 2OAQ1 4I3IA 4IHQA 4YFMA 2NUPC 1L0DA 3ZHHA 5HZHA 2PYPA 2ZMVA 2KLIA 3VOZA 2JKRM 4EERA 4PAUA 4D2OA 3FZCA 3Q1FA 1ONGA 2XA7S 3IS2A 1ZC2A 4YWZA 1BLHA 1M40A 2VA0A 1SKFA 2C6WB 1K57C 2XH9A 2Y2NA 2XRNA 3T4LA 1F9IA 3T50A 3G34A 3T1XA 2KOIA 2Z6DA 4LENA 2P08A 1IYQA 5I94A 2VX8A 4HNBA 4S2PA 4BD1A 1WYBA 1XJ4A 1YLWA 4GNUA 4NEED 1OPXA 4Y5FA 3CPTB 3IXBA 1MBLA 3EGXC 5AQBA 3A3IA 5HDSA 2V8FA 3VSKA 5FATA 4HJ6A 5GLBA 1YMXA 4WM9A 2HP5A 4DXCA 1F98A 1TDLA 4LRYC 5LBRA 4CPKA 3UB5P 4MEZA 4BD0A 4ZRRA 3MZFA 4IJGA 1D7EA 3S22A 1HVBA 3OPPA 5G4YA 3A3DA 2OV5A 2ZL1A 1WE4A 4EBPA 1PFLA 2AVXA 3LO7A 2W3DA 2NUTC 5GLAA 3FYZA 5GHXA 3ITBA 4UA6A 2K31A 1L0GA 4Z9QA 2V1ZA 1OTAA 2WAEA 3UPOA 4KZ3A 1H3QA 5L10A 3KSIA 4JF6A 1VEUA 4AFIA 3NJAA 3CG5A 2Y2LA 3WS1A 4KQDA 2INWA 4NETA 2HDSA 3F1OA 3VP2A 3T4TA 1Q2QA 2ZMAA 2QKPA 3RXWA 2A24A 3UE0A 4EW7A 4O0PA 1SHVA 2YKFA 4KZ6A 3JVUA 4UQIM 2XROA 4R3BA 3S7NA 3I7JA 2PU4A 3WS5A 3GDIA 3SH8A 4FH2A 3QP1A 5A93A 3DW0A 1RGZA 3ZG0A 5CHJA 4QY5A 1L3LA 4OQIA 1Z09A 4KQRA 3S7OA 4S2OA 3VOLA 1ONHA 3HL9A 1J9MA 3KYZA 4O7DA 3VOYA 1ZKJA 1SKOB 1TS6A 2XSSA 4K0WA 3QP5A 1M6KA 3PHYA 4BWIA 1IKGA 5DFYA 5HFOA 2YKHA 3FPWA 1IYOA 4PKYG 1G28A 1KOUA 4ESPA 3HLEA 5F1FA 2WGWB 4JLFA 4LV1A 3LFVA 3OPRA 3RJUA 4OH0A 3ICYA 4HQAA 4CLCB 3MMHA 3E98A 1IYSA 4JBFA 4R3JA 2K7SA 1S0WA 3T1SA 4DXBA 2R9XA 4N1XA 4ZJ3A 5A91A 4R38A 1N9NA 2VGLM 1ESIA 2J9PA 1BLPA 4GJ4A 3V39A 4ETZA 3BFFA 5CHUA 3VP4A 3W4QA 3H7WA 4HOIA 3EEHA 4DE0A 1TVFA 3G32A 3DWZA 5CGWA 1JNUA 2DCFA 4OOMA 3BQAA 1O7EA 1L0FA 4K0XA 2O0YA 4KG2A 3EOIA 3C5AA 2V1BA 4H6JB 3S1YA 2HJEA 4E04A 1YAXA 1HTZA 2WUQA 4X53A 3OOVA 3V50A 2WADA 2B18A 4G3KA 4UEYA 1XGIA 4LRZE 1KVMA 5FAQA 3N8LA 4XUXA 1TS7A 5M19A 3GQZA 1GHMA 4P0MA 3BY9A 5D3OA 2I72A 4JGPA 1YM1A 3CHWP 3ZG7B 2MJ6A 3Q81A 5HDDA 5HPIA 1L2SA 5FASA 4WN5A 3M2JA 4QWOA 4GZBA 2ZC4B 2Q9MA 2BLSA 4KZ4A 3GECA 3IQAA 1HD8A 4MDZA 1K0KA 3W4PA 3DAVA 3M2KA 1LT0A 3DTMA 1K55A 3JYIA 4HJ3A 1GA0A 2HDRA 3ZFZA 2WK0A 1W8QA 3AGEA 4DJ3A 4HH2A 3WS2A 2VV8A 1OTDA 2XQZA 4EXOA 3C4PA 3WRZA 3H82B 3B47A 5KSHA 2XGNA 5FAPA 1IFQA 4ZJ2A 3NULA 3C38A 1BZAA 4Y7PA 2G7UA 1XJ2A 5F6AA 4LV2A 5J4EA 2ZQ7A 1ERMA 3P09A 3D3OA 5AQ7A 4KUKA 2HDUA 4C3QA 2ACGA 2ZMFA 3BJNA 2EX2A 3K2NA 4ZBEA 2HP9A 5I5LA 4KZ5A 2PD8A 2O9BA 3BY8A 3IWIA 4GS9A 4Y2FA 2EXBA 2HPBA 5A90A 5IHVA 1FCMA 2H10A 1PWCA 1IYPA 4B93A 3LR0A 2HJ9C 1CEFA 4KENB 4C6YA 3FG8A 3UE6A 1TD5A 1KGEA 3IX3A 2O9CA 4JXSA 3ULFA 4HY8A 3OZHA 4XUZA 3CMZA 1T19A 1P9RA 3LI8A 2ZJ9A 3O87A 4LCMA 3G4PA 5C5KA 1S6RA 4PM6A 5EOOA 3RTYA 5HAPA 2J8YA 3UE1A 5KMWA 3MJQA 4R70A 2GJ3A 2OWJA 4G3VA 4JXVA 2Y2JA 5F83A 4MBKA 4JGRA 1CQAA 2WGVA 2Y2KA 3SW1A 4JF4A 1ES2A 2JKRI 1GSVA 5HX9A 3E4PA 1Y28A 5CGSA 1I2SA 1NZUA 4WEJA 4GDNA 3IF6B 1PZOA 1UWNX 1ES5A 4IUHA 3VFFA 3PBNA 1PW8A 2JKGA 3LIBA 1PW1A 5FEGA 3FC7A 3B33A 4KG5A 2ZQCA 2XD1A 4RQ9A 1H8MA 4QD4A 3NCKA 3VE4A 1ERQA 4ETXA 3C8CA 3QP8A 2XFTA 4DKIA 3T4KA 2QYBA 5TGFA 4YOFA 3NOUC 3O88A 1QMFA 3Q7VA 3S4XA 2DRWA 3U4LP 1K4FA 5DFXA 2ZC6B 5AVEA 3D9YA 2Y2GA 1K6RA 1MWRA 5EPHA 3NECA 5FDHA 5E2EA 5DVAA 1DJAA 1RP5A 1NWZA 1U60A 2K2NA 4LCLA 4F3LA 1YPRA 2EFXA 4E3KA 4PHTA 4QJGA 1S4SA 4GHIB 3MKFA 2ZM8A 1FCOA 1K6SA 3ZDJA 2P9VA 1CI9A 1Y54A 5DJUA 2VGKA 2H5SA 4LFUA 1STZA 4HHDA 1SDNA 3BQ8A 3ZNYA 4WBGA 5EVIB 2H0YA 5HDCA 4HJ4A 5G18A 4E3JA 4P6ZM 3IF5A 3QP2A 5GL9A 4KZ9A 3T4SA 3G35A 4BBUA 5EFWA 1JWZA 4HBTA 1JWVA 1VQQA 4I38A 4ZTKA 1DP9A 1XA1A 4FD8A 5TFQA 5TR7A 3DTEA 1S1YA 4X1MA 3JVVA 1GHIA 3NI9A 1BT5A 3ZVTA 4GCZA 3DWKA 3TJZC 1LI0A 3NY4A 5CEDA 3HUNA 4EETB 3LCEA 4KZBA 4DE3A 3M6BA 4R23A 3MZEA 1OJGA 2W3EA 3MF0A 4B4ZA 4ARZA 3NOPC 5CX7A 3MFXA 4ME4A 2BG1A 4BQMA 3IBRA 3CUEA 1K55C 4EEUA 3ZG9B 5CEBA 3UPNA 3N8SA 1YLTA 3UB8A 1KDSA 2B95A 2J9OA 3N4IA 3T4JA 1BULA 1G68A 4S2JA 5GHZA 4DRTA 4O8GA 1T1AA 4BJPA 4E3IA 4S2NA 1CEGA 1XFQA 4CJNA 3K3DA 3LR4A 5E2GA 2QPNA 4E3LA 4L9EA 2W1TA 3E4QA 4EQ1A 1W8YA 2XDMA 3F1PA 2ZM2A 3AGDA 3LY3A 3JPUA 3NDGA 5F5YA 3BFDA 4RX3A 2ZM0A 2PBYA 3EGDC 4LV3A 3S7PA 4MBHA 4Z1WA 4E3NA 5M18A 3OBFA 4LPZA 1F2KA 4X55A 5F68A 1SZVA 3AGFA 5HD3A 4B9OA 1EROA 5DJTA 2JKTM 1G5UA 4BL2A 3MR0A 2GX5A 4UA9A 2V9AA 4FOFA 3OCLA 3L9KA 3ZYTA 1O07A 4FUWA 3QNCA 3BWLA 1LHYA 4OLDA 2ZQDA 2FH5A 1SDEA 4MN7A 1K4EA 2IWBA 3KYEA 5A8BA 4L9FA 2BTFP 2Y8HA 3IH9A 3HLDA 1NLZA 4GS9B 1DY6A 4LRXC 3ZNTA 5IT5A 3LICA 3R7WA 2CMNA 3PXPA 2HGVA 3VE3A 5L07A 1MY8A 3CJMA 4IUKA 3IT9A 4O01A 1MKMA 3PBRA 3IH8A 4OONA 3V67A 3HLGA 2W3GA 4FCFA 4R1GA 3BEBA 4XT2B 4ZAMA 4PM7A 4K08A 2O99A 3CI6A 5JYPA 1K56A 3EEAA 3N8RA 3BFEA 2XA7M 3T4QA 1KE4A 1HLUP 5EV0A 2ZQ9A 1VB6A 1CI8A 3NDEA 3LIAA 3B3XA 2D01A 1XJ3A 5CHMA 2GZAA 1K56D 4PM5A 1AXBA 3UMEA 1PZPA 3IHBA 1VETA 4Y0UA 3TG9A 2O9AA 2J3WA 4GD8A 5EOEA 4EV4A 3UB7A 5CECA 1TF1A 1YLPA 5DF8A 4MN6A 5CTMA 1PI5A 1A0KA 3UN7A 1FR1A 3VFHA 5TJJA 3D4FA 3SS3A 3MKEA 2VK3A 1TS8A 4QB8A 1LLBA 1PWDA 1DJCA 3FPVA 2VZWA 1PRQA 3CWFA 4KQOA 2EWWA 2W27A 2WKEA 4ID4A 5FQIA 3HJKA 2W1RA 1NXYA 4CQHA 4KZ7A 4NG2A 3Q7VB 5E43A 3W8KA 3CPTA 4OP8A 5J8XA 4Q0IA 1YQSA 2JBFA 3KSFA 3HCYA 1W5DA 1IEMA 3F1NA 1G6AA 2Z6CA 1YKDA 4A5RA 2V2FF 3VP3A 4NXGA 3C7UA 1MXOA 4X1LA 1N9BA 3HLFA 1FSYA 3UDIA 5FI2A 3MBZA 5DKLA 4EBLA 4WUJA 4RX2A 3IBJA 3Q82A 3KSGA 2P9VB 4Y0TA 4I5SA 1ALQA 2LB5A 1QMEA 5CTNA 2HDQA 1BYWA 4I39A 2JE5A 5HW3A 2V20A 1YLYA 3UDXA 1JTGA 2DNSA 1G6OA 4DE2A 1NYYA 4OQHA 3BW6A 3PAGA 3CUEC 2WZXA 4JXGA 3IXGA 2OWHA 1H0MA 3ITAA 1OTBA 1DRMA 2G2UA 2VGJA 4GLQA 4R4RA 3PBTA 4EUVA 4Y15A 5FDSA 5FSRA 1EW0A 1F5MA 4LGWA 4I3JA 4GDBA 4S2NC 4P87A 3TSGA 3MXRA 2HV1A 3IS2B 5BOHA 3CITA 4X56A 1Y4OA 3LI9A 4Q8IA 3HBRA 2ZLYA 3HLWA 2ZC3B 4ARZB 4WEKA 3EQVA 4OQ0A 1MC0A 4KZAA 5FL3A 3O5YA 1E4DA 4U0XA 4I3AA 3NOTC 2PBDP 1RCJA 3ZVWA 3C4OA 3IXHA 2WZZA 2E8IA 5EE8A 3BYDA 3UO9A 4R0QA 2PRFA 2WGWA 5A92A 1T1CA 1T1BA 3E2LA 2PDRA 2Y55A 3G2YA 3OCNA 3V3SA 3GMWA 3C2WA 3UDFA 3SH9A 3Q7ZA 1XP4A 4P85A 5GLCA 4B4XA 1I2WA 3H9WA 2JKFA 3PR6A 4EESA 1GHPA 2ZOIA 4NKPA 4OOLA 4K91A 4S2IA 3G31A 4CLCD 3A0VA 4MBFA 4GW9A 4BENA 2ZL1B 2KX6A 1IELA 1EI5A 1H5XA 3VV4A 4HP9A 5JYOA 3PYPA 3IX4A 4L0LA 2XF3A 4EBNA 2WAFA 4RA7A 3FWLA 4H6JA 1GA9A 4PMAA 1VEUB 1P0ZA 2JHEA 5KZHA 2PAVP 3P7NA 3E0YA 5DTTA 3G6OA 5AJGA 4DDSA 2OAP1 1GSXA 3F1OB 5FQJA 1TDGA 1JVJA 1YMSA 4IEDA 4NXBA 2A24B 2L4RA 4P6BA 3LIFA 1NRFA 5HWVA 3C30A 1WA9A 4Y17A 1W7FA 4JKTA 5HL6A 4FTXA 2ZBBA 2J3TD 3LGOA 1V9YA 5DTKA 4UAAA 3RXXA 5FI7A 2VLGA 3SS4A 3BRMA 1ODVA 2Y2IA 4N9KA 3G2ZA 5K5BA 2H28A 3LR3A 4X69A 4IBXA 5L8MA 4IBRA 3ZCZA 5CERA 3R7WB 2JC7A 3BFGA 3UB6A 4U0TA 2P7JA 4PKYA 1KE3A 3HREA 2JKTI 2Y2MA 5FQ9A 4HP4A 5EM0A 3RH8B 4UQIS 3SOIA 2DMWA 4X68A 1PIOA 2D02A 3FKWA 3H82A 1NJ4A 1E25A 1MWUA 3N7WA 1XJ6A 3CLOA 4G3WA 1XFNA 2OLUA 2WKPA 3A0SA 4NXFA 4OVDA 5DF9A 1AWIA 3QP4A 4KQQA 5L09A 1CK3A 2PHYA 5F69A 3W4OA 3ZG8B 4ZJ1A 5EUAA 1NY0A 5IS1A 1IKIA 5FEFA 4WZ5A 3H7WB 4Y0OA 1BSGA 2PR5A 3UE3A 3E4OA 4C75A 2Z2LB 2EWVA 5GHYA 1LL9A 3FV7A 2EFUA 4MNRA 4X25A 4EWFA 4WZ4A 1XKZA 2PYRA 3UY6A 1PWGA 1NLYA 4PM9A 4OPZA 2VGLS 4FH4A 4QHCA 4YNRA 3P01A 4EEPA 3OLOA 1K38A 1E3UA 1PYYA 2Z2MB 3VSLA 1KDWA 5HPFA 3WS0A 3NIAA 4Y13A 2V8CA 4OPRA 4R3AA 1UGUA 3C7VA 3UB9A 5TBMA 5IU1A 2GNXA 1OMEA 2WKRA 1E3UD 3QHYA 3P98A 2HF6A 2EXAA 4GOGA
chains in the Genus database with same CATH topology
2ZMFA 3LIAA 3BJNA 2D01A 1XJ3A 2GZAA 3K2NA 3F1NB 3UMEA 2VJWA 5I5LA 2PD8A 2O9BA 3BY8A 4GS9A 4Y2FA 1IOUA 5J7EA 2O9AA 2W3HA 3EWKA 4DJ2A 4B93A 2J3WA 1N9LA 3LR0A 3UB7A 1ZTUA 2HJ9C 5HD5A 1TF1A 1OJ5A 1S4RA 4L9GA 4DMZA 4MN6A 2P04A 3FG8A 5TJJA 3UE6A 4WL9A 2KDKA 2ZOHA 1TD5A 3MQ0A 1LSVA 3D72A 2O9CA 1VHMA 2W0NA 4R6LA 1TS8A 3UMDA 3ULFA 1X0OA 3R4KA 4HY8A 4FSFA 1W63M 1T19A 3FPVA 3B42A 5HWTA 2VZWA 3LR5A 3CWFA 1P9RA 4KQOA 2EWWA 2W27A 4JGOA 1P9WA 1S1ZA 2L1MA 3LIEA 3LI8A 2QJ7A 2V1AA 4CLCE 3HJKA 2W1RA 5J3WA 4CQHA 5C5KA 4WELA 3NHQA 3TRCA 3RTYA 4II7A 4HIAA 1P97A 3MJQA 4R70A 4Q0IA 2W3FA 3KSFA 2GJ3A 3HCYA 2OWJA 2VKSA 4G3VA 3LIDA 3F1NA 3PBQA 2Z6CA 1OT6A 1YKDA 4JGRA 3OC2A 3KX0X 3SW1A 1OT9A 4NXGA 2OAQ1 2JKRI 4I3IA 4IHQA 2NUPC 3TE8A 1GSVA 3E4PA 5HZHA 2PYPA 2ZMVA 2KLIA 4CLCC 1Y28A 4MN5A 2JKRM 3K3CA 4EERA 4PAUA 4WEJA 2XA7S 3IS2A 1UWNX 4IUHA 5DKLA 4YWZA 3PBNA 4WUJA 4GHIA 5HSQA 3IBJA 1S67L 2VA0A 3KSGA 3LIBA 1LSXA 3FC7A 3B33A 3PBSA 4I5SA 2LB5A 2FZ0A 4RQ9A 1H8MA 1BYWA 4I39A 3VE4A 4ETXA 3C8CA 2XRNA 3T4LA 1F9IA 3T50A 3T4KA 2QYBA 2KOIA 2Z6DA 2P08A 4YOFA 3NOUC 2VX8A 4HNBA 2V0UA 2VV6A 1XJ4A 1G6OA 4NEED 4WF0A 3BW6A 1OPXA 4Y5FA 3CUEC 3ZQ5A 3EGXC 3KSHA 1NRJA 5DFXA 5AVEA 2OWHA 5HDSA 1LSWA 4HJ6A 2R78A 1OTBA 2L0WA 1YSQA 2QWSA 1DRMA 1F98A 4LRYC 4GLQA 3PBTA 4KUOA 5LBRA 4EUVA 2J3TC 1NWZA 2K2NA 4ZRRA 2VV7A 4IJGA 1EW0A 1D7EA 2EA9A 4F3LA 1F5MA 4I3JA 5G4YA 3TW8A 2HV1A 3IS2B 3CITA 1T18A 4PHTA 1S4SA 1D06A 4GHIB 2J80A 3LI9A 1N9OA 2W3DA 2NUTC 4ARZB 3CAXA 4WEKA 3EQVA 5DJUA 1STZA 1MC0A 2K31A 4HHDA 3BQ8A 5FL3A 3O5YA 5HDCA 1OTAA 4HJ4A 2PT7A 1YSPA 4P6ZM 4I3AA 1OTEA 1H3QA 3NOTC 3T4SA 3KSIA 4AFIA 3NJAA 4BBUA 3HJIA 2PR6A 5MC7A 5EFWA 4KQDA 2INWA 1MZUA 3F1OA 5KIZA 4I38A 1DP9A 3T4TA 1DP6A 3RFBA 1T1CA 2QKPA 1T1BA 2A24A 2PDRA 4EW7A 4O0PA 1S1YA 3OCNA 2YKFA 2QHKA 3C2WA 3JVUA 3JVVA 3H9WA 4UQIM 1TS0A 3PR6A 4EESA 4GCZA 4F3LB 2ZOIA 3TJZC 4NKPA 1DP8A 4OOLA 2WKQA 2XROA 3S7NA 4CLCD 4EETB 3A0VA 4Q0JA 4GW9A 3GDIA 2OOLA 4M4XA 1OJGA 2KX6A 1GSWA 2W3EA 3MF0A 4QPRA 4HP9A 3VV4A 3PYPA 4ARZA 3NOPC 3S7OA 3VOLA 5CX7A 2M7UA 4L0LA 4DN0A 3KYZA 3MFXA 4ME4A 4MCWA 3IBRA 4H6JA 1TS6A 3CUEA 2XSSA 4LLOB 4EEUA 3PHYA 2M7VA 4BWIA 5DFYA 1P0ZA 2JHEA 2YKHA 3FPWA 1W63Q 3P7NA 3E0YA 3UB8A 3G6OA 5AJGA 4PKYG 4Q0HA 1G28A 1KOUA 2OAP1 1GSXA 3F1OB 3T4JA 3LFVA 4NXBA 3ICYA 1OTIA 4HQAA 2A24B 4CLCB 4O8GA 3MMHA 2L4RA 3E98A 3LUQA 1T1AA 3LIFA 5HWVA 3C30A 4BJPA 1WA9A 2K7SA 2PD7A 3LYXA 1XFQA 5HL6A 3S7QA 3K3DA 3LR4A 4R38A 1N9NA 4L9EA 2W1TA 2ZBBA 2VGLM 3E4QA 4EQ1A 2J3TD 1V9YA 2QJ5A 4P6ZS 4GJ4A 3F1PA 4ETZA 3H7WA 2VLGA 4HOIA 3EEHA 1ODVA 5F5YA 5K5BA 2H28A 1JNUA 3LR3A 4BBTA 2IA2A 4OOMA 3BQAA 3EGDC 3W2ZA 1V9ZA 2V0WA 3S7PA 5L8MA 3MQOA 1ZHHB 5AVFA 4Z1WA 3R7WB 3UB6A 2O0YA 2P7JA 3OBFA 4LPZA 2BASA 3EOIA 3MQQA 4PKYA 2V1BA 2JKTI 5F68A 4H6JB 4HP4A 5HD3A 2HJEA 4B9OA 3RH8B 5DKKA 4UQIS 4E04A 1YAXA 2JN7A 5DJTA 2JKTM 3OOVA 3MR0A 1S66L 2DMWA 2B18A 4MMNA 2D02A 4G3KA 3H82A 2GX5A 4UEYA 4NXEA 4LRZE 1XJ6A 3CLOA 2V9AA 4G3WA 1TS7A 1XFNA 4FOFA 4EU0A 5HWWA 3BY9A 3OCLA 2A2LA 3ZYTA 4XT2A 2WKPA 3A0SA 4CLCA 4JGPA 4NXFA 5DF9A 3MXQA 3PBOA 5TBMB 3BWLA 2MJ6A 3T4OA 2PHYA 5HDDA 5HPIA 2M1CA 5F69A 4WN5A 2W1TB 5G4ZA 2FH5A 4MN7A 4WLAA 5IS1A 3F1PB 3H7WB 3GECA 4MDZA 1LL8A 5A8BA 4L9FA 2PR5A 3UE3A 3E4OA 2Y8HA 2EWVA 3EQUA 1NLZA 1LT0A 4Y3IA 4GS9B 4LRXC 4HJ3A 5IT5A 3DBAA 3LICA 3R7WA 2CMNA 2PYRA 3PXPA 4DJ3A 3U2AA 4HH2A 1NLYA 2HGVA 2VGLS 4YNRA 3VE3A 3P01A 2VV8A 4EEPA 1OTDA 4EXOA 4BBVA 4IUKA 4JGQA 3OLOA 4O01A 3H82B 1MKMA 3PBRA 3B47A 5KSHA 2LB9A 3V67A 5HPFA 1IFQA 2W3GA 4HI4A 2I9VA 4XT2B 3KYQA 4R3AA 4K08A 3C38A 2O99A 3CI6A 1UGUA 2G7UA 1XJ2A 3UB9A 5TBMA 5IU1A 2GNXA 3EEAA 5F6AA 5J4EA 2WKRA 2XA7M 4BMWA 3KO6A 2HF6A 3D3OA 2B02A 3T4QA 2Y79A 4KUKA 1UWPX 3A0RA 2VEAA 1VB6A 4HH3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LIA A;  2D01 A;  1XJ3 A;  3F1N B;  3UME A;  5I5L A;  2PD8 A;  3BY8 A;  4GS9 A;  5J7E A;  4DJ2 A;  3EWK A;  1N9L A;  3UB7 A;  5HD5 A;  1OJ5 A;  1S4R A;  4L9G A;  4MN6 A;  3FG8 A;  3UE6 A;  4WL9 A;  2KDK A;  2ZOH A;  1LSV A;  3D72 A;  2W0N A;  4R6L A;  1TS8 A;  3UMD A;  3ULF A;  1X0O A;  4HY8 A;  1T19 A;  5HWT A;  3CWF A;  2W27 A;  4JGO A;  3LIE A;  1S1Z A;  2L1M A;  3LI8 A;  2QJ7 A;  2V1A A;  3HJK A;  5J3W A;  3NHQ A;  3RTY A;  4HIA A;  1P97 A;  3MJQ A;  4R70 A;  2GJ3 A;  2OWJ A;  3LID A;  3F1N A;  2Z6C A;  1OT6 A;  4JGR A;  3KX0 X;  3SW1 A;  1OT9 A;  4NXG A;  4I3I A;  1GSV A;  3E4P A;  5HZH A;  2PYP A;  1Y28 A;  4MN5 A;  3K3C A;  4EER A;  3IS2 A;  1UWN X;  5DKL A;  4YWZ A;  4WUJ A;  4GHI A;  5HSQ A;  1S67 L;  3LIB A;  1LSX A;  3FC7 A;  3B33 A;  4I5S A;  4RQ9 A;  1BYW A;  4I39 A;  3VE4 A;  3C8C A;  1F9I A;  3T50 A;  2Z6D A;  3NOU C;  4HNB A;  2V0U A;  2VV6 A;  1XJ4 A;  4WF0 A;  3ZQ5 A;  5AVE A;  2OWH A;  5HDS A;  1LSW A;  4HJ6 A;  2R78 A;  1OTB A;  2L0W A;  2QWS A;  1DRM A;  1F98 A;  4LRY C;  4KUO A;  1NWZ A;  2VV7 A;  1EW0 A;  1D7E A;  2EA9 A;  4F3L A;  4I3J A;  5G4Y A;  2HV1 A;  3IS2 B;  1T18 A;  1S4S A;  1D06 A;  4GHI B;  2J80 A;  3LI9 A;  1N9O A;  3CAX A;  5DJU A;  4HHD A;  5HDC A;  1OTA A;  4HJ4 A;  4I3A A;  1OTE A;  3NOT C;  3NJA A;  4BBU A;  3HJI A;  2PR6 A;  5EFW A;  4KQD A;  2INW A;  1MZU A;  3F1O A;  5KIZ A;  4I38 A;  1DP9 A;  1DP6 A;  1T1C A;  2QKP A;  1T1B A;  2A24 A;  2PDR A;  4EW7 A;  1S1Y A;  2YKF A;  2QHK A;  3C2W A;  3H9W A;  1TS0 A;  4EES A;  4F3L B;  4GCZ A;  2ZOI A;  1DP8 A;  2WKQ A;  4EET B;  3A0V A;  4GW9 A;  3GDI A;  2OOL A;  4M4X A;  1OJG A;  2KX6 A;  1GSW A;  4HP9 A;  3PYP A;  3NOP C;  3VOL A;  3MFX A;  3IBR A;  4H6J A;  1TS6 A;  4LLO B;  4EEU A;  3PHY A;  1P0Z A;  2JHE A;  2YKH A;  3P7N A;  3UB8 A;  3G6O A;  4PKY G;  1G28 A;  1KOU A;  1GSX A;  3F1O B;  4NXB A;  3ICY A;  1OTI A;  4HQA A;  2A24 B;  2L4R A;  3LUQ A;  1T1A A;  3LIF A;  5HWV A;  1WA9 A;  2K7S A;  2PD7 A;  3LYX A;  1XFQ A;  3K3D A;  4R38 A;  1N9N A;  4L9E A;  2ZBB A;  3E4Q A;  4EQ1 A;  1V9Y A;  2QJ5 A;  3F1P A;  3H7W A;  2VLG A;  4HOI A;  3EEH A;  1ODV A;  5F5Y A;  2H28 A;  1JNU A;  4BBT A;  1V9Z A;  2V0W A;  3MQO A;  5AVF A;  3UB6 A;  2P7J A;  4LPZ A;  2BAS A;  4PKY A;  3MQQ A;  2V1B A;  5F68 A;  4H6J B;  4HP4 A;  5HD3 A;  4B9O A;  3RH8 B;  5DKK A;  4E04 A;  2JN7 A;  5DJT A;  3MR0 A;  1S66 L;  2D02 A;  3H82 A;  4NXE A;  4LRZ E;  1XJ6 A;  3CLO A;  2V9A A;  1TS7 A;  1XFN A;  5HWW A;  3BY9 A;  4XT2 A;  2WKP A;  3A0S A;  4JGP A;  4NXF A;  3MXQ A;  5TBM B;  3BWL A;  5HDD A;  2PHY A;  2M1C A;  5F69 A;  4WN5 A;  5G4Z A;  4WLA A;  5IS1 A;  3F1P B;  3H7W B;  3GEC A;  1LL8 A;  5A8B A;  4L9F A;  2PR5 A;  3E4O A;  1LT0 A;  4GS9 B;  4LRX C;  4HJ3 A;  3LIC A;  2CMN A;  2PYR A;  4DJ3 A;  4HH2 A;  3VE3 A;  4EEP A;  2VV8 A;  1OTD A;  4EXO A;  4BBV A;  4JGQ A;  3OLO A;  3H82 B;  4HI4 A;  2I9V A;  4XT2 B;  4R3A A;  4K08 A;  1UGU A;  1XJ2 A;  3UB9 A;  5TBM A;  5IU1 A;  5F6A A;  5J4E A;  2WKR A;  2B02 A;  4KUK A;  1UWP X;  3A0R A;  2VEA A;  1VB6 A;  4HH3 A; 
#chains in the Genus database with same CATH topology
 2A49 A;  2UWX A;  1VM1 A;  3F1N B;  2VJW A;  4S2L A;  2XFS A;  5E2H A;  2EX8 A;  3SH7 A;  1IOU A;  4DJ2 A;  2W3H A;  3EWK A;  2FFY A;  2H0T A;  5HD5 A;  3BFC A;  1OJ5 A;  4L9G A;  4LV0 A;  1K54 A;  2P04 A;  1J3W A;  3IF6 A;  3BM6 A;  2ZOH A;  1ZG6 A;  3HLB A;  2CC1 A;  3MQ0 A;  4N92 A;  1DJB A;  5F1G A;  2W0N A;  2IWD A;  2RL3 A;  3R4K A;  1W63 M;  1CF0 A;  2C5W B;  2P74 A;  5HWT A;  2J7V A;  4E6X A;  1XGJ A;  4JGO A;  1P9W A;  3LIE A;  1K25 A;  2QJ7 A;  4CLC E;  1YLJ A;  3MXS A;  4WYY A;  5J3W A;  3FKV A;  2XR0 A;  4WEL A;  3NHQ A;  1H8Y A;  1P97 A;  4S2M A;  4UHU A;  2W3F A;  3BEC A;  3LID A;  3PBQ A;  5CGX A;  1OT6 A;  5L2F A;  2HZ5 A;  3OC2 A;  1OT9 A;  3VP0 A;  3HUO A;  5FQM A;  3TE8 A;  3DTK A;  2XEP A;  1KGG A;  1YT4 A;  4CLC C;  4MN5 A;  3K3C A;  2Y2Q A;  3MFD A;  2IWC A;  4OP5 A;  1ACF A;  1ZG4 A;  1JTD A;  4GHI A;  5HSQ A;  2E8J A;  1S67 L;  5FAO A;  1LSX A;  3ZG5 A;  3CZD A;  3T12 B;  3PBS A;  1SCW A;  3HUM A;  2FZ0 A;  5CRF A;  2XD5 A;  5EVI A;  1PI4 A;  2Y2H A;  3HLC A;  3GVB A;  2V0U A;  2VV6 A;  2WGI A;  4E3M A;  3WWX A;  3BLM A;  4WF0 A;  5EVI D;  3ZQ5 A;  4EUZ A;  3LEQ A;  3KSH A;  1NRJ A;  1LSW A;  2R78 A;  2L0W A;  4DF6 A;  1YSQ A;  2QWS A;  1I5Q A;  5DTS A;  5FA7 A;  2OLV A;  4KUO A;  2QMI A;  2J3T C;  1XXM A;  2VV7 A;  2EA9 A;  4HEF A;  1FR6 A;  1CJF A;  5FQQ A;  3WRT A;  1MWT A;  3TW8 A;  1T18 A;  1D06 A;  2J80 A;  1N9O A;  1XA7 A;  3CAX A;  3QP6 A;  3PTE A;  4E6W A;  2PT7 A;  1YSP A;  2ZD8 A;  3A3F A;  1OTE A;  1PNE A;  2WKH A;  2ZQA A;  4JPM A;  1NZO A;  3HJI A;  2PR6 A;  4IVI A;  5MC7 A;  4D60 A;  1KGF A;  2B5R A;  2EX9 A;  5EM1 A;  4S2K A;  4GKU A;  1MZU A;  5KIZ A;  3LEZ A;  1DP6 A;  3RFB A;  1TEM A;  2XK1 A;  4YIN A;  2A3U A;  1D1J A;  2QHK A;  3L7H A;  3UPP A;  4DE1 A;  3Q07 A;  3IWQ A;  5CXW A;  4OPQ A;  1TS0 A;  2EX6 A;  4F3L B;  4OKP A;  2OSU A;  1DP8 A;  2WKQ A;  2Q0O A;  1K57 A;  4PM8 A;  3O3V A;  3SZT A;  4Q0J A;  4M4X A;  2OOL A;  1GSW A;  3N6I A;  3V5M A;  1ES3 A;  2Q9N A;  2WKI A;  4WMC A;  1BTL A;  1MWS A;  4QPR A;  4BLM A;  1NYM A;  4WZ5 C;  2M7U A;  4DN0 A;  1Z6F A;  1BUE A;  4R4S A;  4H8R A;  4MLL A;  4MCW A;  4HBU A;  3OPH A;  1FOF A;  4LLO B;  4WMC D;  1XPB A;  2M7V A;  3M6H A;  2ZC7 A;  2GDN A;  3ZGA B;  2Y59 A;  2ZC5 B;  1GCE A;  5HL1 A;  1W63 Q;  4Q0H A;  4X6T A;  1L0E A;  1XX2 A;  3WS4 A;  4E3O A;  1OTI A;  3E2K A;  4N1H A;  3LUQ A;  2Y2P A;  2PD7 A;  3LYX A;  1JWP A;  5KSC A;  3S7Q A;  1MPL A;  1LL5 A;  2QJ5 A;  3IX8 A;  4P6Z S;  4EQI A;  2WYX A;  4HES A;  1Q2P A;  5F82 A;  4BBT A;  5AQA A;  2IA2 A;  4N9L A;  3MS6 A;  3LY4 A;  3IXD A;  5FI6 A;  3NBL A;  1V9Z A;  3W2Z A;  2PU2 A;  2V0W A;  1FCN A;  5M1A A;  1YLZ A;  1ZHH B;  3MQO A;  4JF5 A;  5AVF A;  3V3R A;  2BAS A;  3MQQ A;  4IVK A;  1WYC A;  3T1R A;  2Y91 A;  1SKO A;  5DKK A;  2XLN A;  2JN7 A;  3IWO A;  5HAQ A;  3HVF A;  1S66 L;  4MMN A;  3BLS A;  3A3E A;  4NXE A;  1C3B A;  1KVL A;  1K54 C;  1RGY A;  3DTI A;  3IF6 C;  3MZD A;  4EU0 A;  5HWW A;  3T1Q B;  4BL3 A;  2A2L A;  4XT2 A;  1N4O A;  4CLC A;  1BLC A;  3PAE A;  3MXQ A;  5AQ9 A;  3PBO A;  5TBM B;  4RVA A;  3T4O A;  2M1C A;  2W1T B;  5G4Z A;  5U47 A;  2G2W A;  4WLA A;  3F1P B;  1LL8 A;  4QY6 A;  3GRJ A;  3EQU A;  2FFF B;  2JCH A;  1FSW A;  4Y3I A;  5GLD A;  4JXW A;  3A3J A;  3DBA A;  2RCX A;  4GD6 A;  4NK3 A;  1EWZ A;  3G30 A;  3OPL A;  3GR2 A;  4U3T A;  4UA7 A;  3U2A A;  4GN2 A;  1HZO A;  4BBV A;  4JGQ A;  5DF7 A;  4GB7 A;  4KG6 A;  2LB9 A;  4OOY A;  4KZ8 A;  4HI4 A;  2I9V A;  3KYQ A;  4OPY A;  1FIL A;  3GV9 A;  3NC8 A;  2X71 A;  3IHA A;  4BMW A;  3KO6 A;  5EVI C;  2B02 A;  1FQG A;  1BLS A;  2Y79 A;  1UWP X;  3A0R A;  2VEA A;  4HH3 A;  2Y2O A;  1MKI A;  5EVE A;  4RYE A;  3VP1 A;  5HAR A;  5J7E A;  1KE0 A;  1LI9 A;  3TOI A;  1N9L A;  4B88 A;  1ZTU A;  4F94 A;  3GTC A;  1FIK A;  1S4R A;  4DMZ A;  3SS5 A;  3O86 A;  4WL9 A;  2KDK A;  4PPR A;  1LSV A;  3D72 A;  1VHM A;  4R6L A;  3UMD A;  1X0O A;  4DDY A;  2X01 A;  4FSF A;  5E2F A;  2ZQ8 A;  2QZ6 A;  2HP6 A;  3B42 A;  3UNW A;  5EVL A;  3LR5 A;  5EEC A;  1W79 A;  4OQG A;  1S1Z A;  2L1M A;  2UV0 E;  2V1A A;  2X02 A;  2R9W A;  1ESU A;  3TRC A;  5HAI A;  3QNB A;  4II7 A;  4HIA A;  2Y4A A;  1H8Z A;  5FQK A;  4M3K A;  4OLG A;  4ZDX A;  4QU3 A;  3GSG A;  2VKS A;  3ISG A;  4XXR A;  1VET B;  3KX0 X;  3VMA A;  3MSH A;  1ES4 A;  2OAQ 1;  4I3I A;  4IHQ A;  4YFM A;  2NUP C;  1L0D A;  3ZHH A;  5HZH A;  2PYP A;  2ZMV A;  2KLI A;  3VOZ A;  2JKR M;  4EER A;  4PAU A;  4D2O A;  3FZC A;  3Q1F A;  1ONG A;  2XA7 S;  3IS2 A;  1ZC2 A;  4YWZ A;  1BLH A;  1M40 A;  2VA0 A;  1SKF A;  2C6W B;  1K57 C;  2XH9 A;  2Y2N A;  2XRN A;  3T4L A;  1F9I A;  3T50 A;  3G34 A;  3T1X A;  2KOI A;  2Z6D A;  4LEN A;  2P08 A;  1IYQ A;  5I94 A;  2VX8 A;  4HNB A;  4S2P A;  4BD1 A;  1WYB A;  1XJ4 A;  1YLW A;  4GNU A;  4NEE D;  1OPX A;  4Y5F A;  3CPT B;  3IXB A;  1MBL A;  3EGX C;  5AQB A;  3A3I A;  5HDS A;  2V8F A;  3VSK A;  5FAT A;  4HJ6 A;  5GLB A;  1YMX A;  4WM9 A;  2HP5 A;  4DXC A;  1F98 A;  1TDL A;  4LRY C;  5LBR A;  4CPK A;  3UB5 P;  4MEZ A;  4BD0 A;  4ZRR A;  3MZF A;  4IJG A;  1D7E A;  3S22 A;  1HVB A;  3OPP A;  5G4Y A;  3A3D A;  2OV5 A;  2ZL1 A;  1WE4 A;  4EBP A;  1PFL A;  2AVX A;  3LO7 A;  2W3D A;  2NUT C;  5GLA A;  3FYZ A;  5GHX A;  3ITB A;  4UA6 A;  2K31 A;  1L0G A;  4Z9Q A;  2V1Z A;  1OTA A;  2WAE A;  3UPO A;  4KZ3 A;  1H3Q A;  5L10 A;  3KSI A;  4JF6 A;  1VEU A;  4AFI A;  3NJA A;  3CG5 A;  2Y2L A;  3WS1 A;  4KQD A;  2INW A;  4NET A;  2HDS A;  3F1O A;  3VP2 A;  3T4T A;  1Q2Q A;  2ZMA A;  2QKP A;  3RXW A;  2A24 A;  3UE0 A;  4EW7 A;  4O0P A;  1SHV A;  2YKF A;  4KZ6 A;  3JVU A;  4UQI M;  2XRO A;  4R3B A;  3S7N A;  3I7J A;  2PU4 A;  3WS5 A;  3GDI A;  3SH8 A;  4FH2 A;  3QP1 A;  5A93 A;  3DW0 A;  1RGZ A;  3ZG0 A;  5CHJ A;  4QY5 A;  1L3L A;  4OQI A;  1Z09 A;  4KQR A;  3S7O A;  4S2O A;  3VOL A;  1ONH A;  3HL9 A;  1J9M A;  3KYZ A;  4O7D A;  3VOY A;  1ZKJ A;  1SKO B;  1TS6 A;  2XSS A;  4K0W A;  3QP5 A;  1M6K A;  3PHY A;  4BWI A;  1IKG A;  5DFY A;  5HFO A;  2YKH A;  3FPW A;  1IYO A;  4PKY G;  1G28 A;  1KOU A;  4ESP A;  3HLE A;  5F1F A;  2WGW B;  4JLF A;  4LV1 A;  3LFV A;  3OPR A;  3RJU A;  4OH0 A;  3ICY A;  4HQA A;  4CLC B;  3MMH A;  3E98 A;  1IYS A;  4JBF A;  4R3J A;  2K7S A;  1S0W A;  3T1S A;  4DXB A;  2R9X A;  4N1X A;  4ZJ3 A;  5A91 A;  4R38 A;  1N9N A;  2VGL M;  1ESI A;  2J9P A;  1BLP A;  4GJ4 A;  3V39 A;  4ETZ A;  3BFF A;  5CHU A;  3VP4 A;  3W4Q A;  3H7W A;  4HOI A;  3EEH A;  4DE0 A;  1TVF A;  3G32 A;  3DWZ A;  5CGW A;  1JNU A;  2DCF A;  4OOM A;  3BQA A;  1O7E A;  1L0F A;  4K0X A;  2O0Y A;  4KG2 A;  3EOI A;  3C5A A;  2V1B A;  4H6J B;  3S1Y A;  2HJE A;  4E04 A;  1YAX A;  1HTZ A;  2WUQ A;  4X53 A;  3OOV A;  3V50 A;  2WAD A;  2B18 A;  4G3K A;  4UEY A;  1XGI A;  4LRZ E;  1KVM A;  5FAQ A;  3N8L A;  4XUX A;  1TS7 A;  5M19 A;  3GQZ A;  1GHM A;  4P0M A;  3BY9 A;  5D3O A;  2I72 A;  4JGP A;  1YM1 A;  3CHW P;  3ZG7 B;  2MJ6 A;  3Q81 A;  5HDD A;  5HPI A;  1L2S A;  5FAS A;  4WN5 A;  3M2J A;  4QWO A;  4GZB A;  2ZC4 B;  2Q9M A;  2BLS A;  4KZ4 A;  3GEC A;  3IQA A;  1HD8 A;  4MDZ A;  1K0K A;  3W4P A;  3DAV A;  3M2K A;  1LT0 A;  3DTM A;  1K55 A;  3JYI A;  4HJ3 A;  1GA0 A;  2HDR A;  3ZFZ A;  2WK0 A;  1W8Q A;  3AGE A;  4DJ3 A;  4HH2 A;  3WS2 A;  2VV8 A;  1OTD A;  2XQZ A;  4EXO A;  3C4P A;  3WRZ A;  3H82 B;  3B47 A;  5KSH A;  2XGN A;  5FAP A;  1IFQ A;  4ZJ2 A;  3NUL A;  3C38 A;  1BZA A;  4Y7P A;  2G7U A;  1XJ2 A;  5F6A A;  4LV2 A;  5J4E A;  2ZQ7 A;  1ERM A;  3P09 A;  3D3O A;  5AQ7 A;  4KUK A;  2HDU A;  4C3Q A;  2ACG A;  2ZMF A;  3BJN A;  2EX2 A;  3K2N A;  4ZBE A;  2HP9 A;  5I5L A;  4KZ5 A;  2PD8 A;  2O9B A;  3BY8 A;  3IWI A;  4GS9 A;  4Y2F A;  2EXB A;  2HPB A;  5A90 A;  5IHV A;  1FCM A;  2H10 A;  1PWC A;  1IYP A;  4B93 A;  3LR0 A;  2HJ9 C;  1CEF A;  4KEN B;  4C6Y A;  3FG8 A;  3UE6 A;  1TD5 A;  1KGE A;  3IX3 A;  2O9C A;  4JXS A;  3ULF A;  4HY8 A;  3OZH A;  4XUZ A;  3CMZ A;  1T19 A;  1P9R A;  3LI8 A;  2ZJ9 A;  3O87 A;  4LCM A;  3G4P A;  5C5K A;  1S6R A;  4PM6 A;  5EOO A;  3RTY A;  5HAP A;  2J8Y A;  3UE1 A;  5KMW A;  3MJQ A;  4R70 A;  2GJ3 A;  2OWJ A;  4G3V A;  4JXV A;  2Y2J A;  5F83 A;  4MBK A;  4JGR A;  1CQA A;  2WGV A;  2Y2K A;  3SW1 A;  4JF4 A;  1ES2 A;  2JKR I;  1GSV A;  5HX9 A;  3E4P A;  1Y28 A;  5CGS A;  1I2S A;  1NZU A;  4WEJ A;  4GDN A;  3IF6 B;  1PZO A;  1UWN X;  1ES5 A;  4IUH A;  3VFF A;  3PBN A;  1PW8 A;  2JKG A;  3LIB A;  1PW1 A;  5FEG A;  3FC7 A;  3B33 A;  4KG5 A;  2ZQC A;  2XD1 A;  4RQ9 A;  1H8M A;  4QD4 A;  3NCK A;  3VE4 A;  1ERQ A;  4ETX A;  3C8C A;  3QP8 A;  2XFT A;  4DKI A;  3T4K A;  2QYB A;  5TGF A;  4YOF A;  3NOU C;  3O88 A;  1QMF A;  3Q7V A;  3S4X A;  2DRW A;  3U4L P;  1K4F A;  5DFX A;  2ZC6 B;  5AVE A;  3D9Y A;  2Y2G A;  1K6R A;  1MWR A;  5EPH A;  3NEC A;  5FDH A;  5E2E A;  5DVA A;  1DJA A;  1RP5 A;  1NWZ A;  1U60 A;  2K2N A;  4LCL A;  4F3L A;  1YPR A;  2EFX A;  4E3K A;  4PHT A;  4QJG A;  1S4S A;  4GHI B;  3MKF A;  2ZM8 A;  1FCO A;  1K6S A;  3ZDJ A;  2P9V A;  1CI9 A;  1Y54 A;  5DJU A;  2VGK A;  2H5S A;  4LFU A;  1STZ A;  4HHD A;  1SDN A;  3BQ8 A;  3ZNY A;  4WBG A;  5EVI B;  2H0Y A;  5HDC A;  4HJ4 A;  5G18 A;  4E3J A;  4P6Z M;  3IF5 A;  3QP2 A;  5GL9 A;  4KZ9 A;  3T4S A;  3G35 A;  4BBU A;  5EFW A;  1JWZ A;  4HBT A;  1JWV A;  1VQQ A;  4I38 A;  4ZTK A;  1DP9 A;  1XA1 A;  4FD8 A;  5TFQ A;  5TR7 A;  3DTE A;  1S1Y A;  4X1M A;  3JVV A;  1GHI A;  3NI9 A;  1BT5 A;  3ZVT A;  4GCZ A;  3DWK A;  3TJZ C;  1LI0 A;  3NY4 A;  5CED A;  3HUN A;  4EET B;  3LCE A;  4KZB A;  4DE3 A;  3M6B A;  4R23 A;  3MZE A;  1OJG A;  2W3E A;  3MF0 A;  4B4Z A;  4ARZ A;  3NOP C;  5CX7 A;  3MFX A;  4ME4 A;  2BG1 A;  4BQM A;  3IBR A;  3CUE A;  1K55 C;  4EEU A;  3ZG9 B;  5CEB A;  3UPN A;  3N8S A;  1YLT A;  3UB8 A;  1KDS A;  2B95 A;  2J9O A;  3N4I A;  3T4J A;  1BUL A;  1G68 A;  4S2J A;  5GHZ A;  4DRT A;  4O8G A;  1T1A A;  4BJP A;  4E3I A;  4S2N A;  1CEG A;  1XFQ A;  4CJN A;  3K3D A;  3LR4 A;  5E2G A;  2QPN A;  4E3L A;  4L9E A;  2W1T A;  3E4Q A;  4EQ1 A;  1W8Y A;  2XDM A;  3F1P A;  2ZM2 A;  3AGD A;  3LY3 A;  3JPU A;  3NDG A;  5F5Y A;  3BFD A;  4RX3 A;  2ZM0 A;  2PBY A;  3EGD C;  4LV3 A;  3S7P A;  4MBH A;  4Z1W A;  4E3N A;  5M18 A;  3OBF A;  4LPZ A;  1F2K A;  4X55 A;  5F68 A;  1SZV A;  3AGF A;  5HD3 A;  4B9O A;  1ERO A;  5DJT A;  2JKT M;  1G5U A;  4BL2 A;  3MR0 A;  2GX5 A;  4UA9 A;  2V9A A;  4FOF A;  3OCL A;  3L9K A;  3ZYT A;  1O07 A;  4FUW A;  3QNC A;  3BWL A;  1LHY A;  4OLD A;  2ZQD A;  2FH5 A;  1SDE A;  4MN7 A;  1K4E A;  2IWB A;  3KYE A;  5A8B A;  4L9F A;  2BTF P;  2Y8H A;  3IH9 A;  3HLD A;  1NLZ A;  4GS9 B;  1DY6 A;  4LRX C;  3ZNT A;  5IT5 A;  3LIC A;  3R7W A;  2CMN A;  3PXP A;  2HGV A;  3VE3 A;  5L07 A;  1MY8 A;  3CJM A;  4IUK A;  3IT9 A;  4O01 A;  1MKM A;  3PBR A;  3IH8 A;  4OON A;  3V67 A;  3HLG A;  2W3G A;  4FCF A;  4R1G A;  3BEB A;  4XT2 B;  4ZAM A;  4PM7 A;  4K08 A;  2O99 A;  3CI6 A;  5JYP A;  1K56 A;  3EEA A;  3N8R A;  3BFE A;  2XA7 M;  3T4Q A;  1KE4 A;  1HLU P;  5EV0 A;  2ZQ9 A;  1VB6 A;  1CI8 A;  3NDE A;  3LIA A;  3B3X A;  2D01 A;  1XJ3 A;  5CHM A;  2GZA A;  1K56 D;  4PM5 A;  1AXB A;  3UME A;  1PZP A;  3IHB A;  1VET A;  4Y0U A;  3TG9 A;  2O9A A;  2J3W A;  4GD8 A;  5EOE A;  4EV4 A;  3UB7 A;  5CEC A;  1TF1 A;  1YLP A;  5DF8 A;  4MN6 A;  5CTM A;  1PI5 A;  1A0K A;  3UN7 A;  1FR1 A;  3VFH A;  5TJJ A;  3D4F A;  3SS3 A;  3MKE A;  2VK3 A;  1TS8 A;  4QB8 A;  1LLB A;  1PWD A;  1DJC A;  3FPV A;  2VZW A;  1PRQ A;  3CWF A;  4KQO A;  2EWW A;  2W27 A;  2WKE A;  4ID4 A;  5FQI A;  3HJK A;  2W1R A;  1NXY A;  4CQH A;  4KZ7 A;  4NG2 A;  3Q7V B;  5E43 A;  3W8K A;  3CPT A;  4OP8 A;  5J8X A;  4Q0I A;  1YQS A;  2JBF A;  3KSF A;  3HCY A;  1W5D A;  1IEM A;  3F1N A;  1G6A A;  2Z6C A;  1YKD A;  4A5R A;  2V2F F;  3VP3 A;  4NXG A;  3C7U A;  1MXO A;  4X1L A;  1N9B A;  3HLF A;  1FSY A;  3UDI A;  5FI2 A;  3MBZ A;  5DKL A;  4EBL A;  4WUJ A;  4RX2 A;  3IBJ A;  3Q82 A;  3KSG A;  2P9V B;  4Y0T A;  4I5S A;  1ALQ A;  2LB5 A;  1QME A;  5CTN A;  2HDQ A;  1BYW A;  4I39 A;  2JE5 A;  5HW3 A;  2V20 A;  1YLY A;  3UDX A;  1JTG A;  2DNS A;  1G6O A;  4DE2 A;  1NYY A;  4OQH A;  3BW6 A;  3PAG A;  3CUE C;  2WZX A;  4JXG A;  3IXG A;  2OWH A;  1H0M A;  3ITA A;  1OTB A;  1DRM A;  2G2U A;  2VGJ A;  4GLQ A;  4R4R A;  3PBT A;  4EUV A;  4Y15 A;  5FDS A;  5FSR A;  1EW0 A;  1F5M A;  4LGW A;  4I3J A;  4GDB A;  4S2N C;  4P87 A;  3TSG A;  3MXR A;  2HV1 A;  3IS2 B;  5BOH A;  3CIT A;  4X56 A;  1Y4O A;  3LI9 A;  4Q8I A;  3HBR A;  2ZLY A;  3HLW A;  2ZC3 B;  4ARZ B;  4WEK A;  3EQV A;  4OQ0 A;  1MC0 A;  4KZA A;  5FL3 A;  3O5Y A;  1E4D A;  4U0X A;  4I3A A;  3NOT C;  2PBD P;  1RCJ A;  3ZVW A;  3C4O A;  3IXH A;  2WZZ A;  2E8I A;  5EE8 A;  3BYD A;  3UO9 A;  4R0Q A;  2PRF A;  2WGW A;  5A92 A;  1T1C A;  1T1B A;  3E2L A;  2PDR A;  2Y55 A;  3G2Y A;  3OCN A;  3V3S A;  3GMW A;  3C2W A;  3UDF A;  3SH9 A;  3Q7Z A;  1XP4 A;  4P85 A;  5GLC A;  4B4X A;  1I2W A;  3H9W A;  2JKF A;  3PR6 A;  4EES A;  1GHP A;  2ZOI A;  4NKP A;  4OOL A;  4K91 A;  4S2I A;  3G31 A;  4CLC D;  3A0V A;  4MBF A;  4GW9 A;  4BEN A;  2ZL1 B;  2KX6 A;  1IEL A;  1EI5 A;  1H5X A;  3VV4 A;  4HP9 A;  5JYO A;  3PYP A;  3IX4 A;  4L0L A;  2XF3 A;  4EBN A;  2WAF A;  4RA7 A;  3FWL A;  4H6J A;  1GA9 A;  4PMA A;  1VEU B;  1P0Z A;  2JHE A;  5KZH A;  2PAV P;  3P7N A;  3E0Y A;  5DTT A;  3G6O A;  5AJG A;  4DDS A;  2OAP 1;  1GSX A;  3F1O B;  5FQJ A;  1TDG A;  1JVJ A;  1YMS A;  4IED A;  4NXB A;  2A24 B;  2L4R A;  4P6B A;  3LIF A;  1NRF A;  5HWV A;  3C30 A;  1WA9 A;  4Y17 A;  1W7F A;  4JKT A;  5HL6 A;  4FTX A;  2ZBB A;  2J3T D;  3LGO A;  1V9Y A;  5DTK A;  4UAA A;  3RXX A;  5FI7 A;  2VLG A;  3SS4 A;  3BRM A;  1ODV A;  2Y2I A;  4N9K A;  3G2Z A;  5K5B A;  2H28 A;  3LR3 A;  4X69 A;  4IBX A;  5L8M A;  4IBR A;  3ZCZ A;  5CER A;  3R7W B;  2JC7 A;  3BFG A;  3UB6 A;  4U0T A;  2P7J A;  4PKY A;  1KE3 A;  3HRE A;  2JKT I;  2Y2M A;  5FQ9 A;  4HP4 A;  5EM0 A;  3RH8 B;  4UQI S;  3SOI A;  2DMW A;  4X68 A;  1PIO A;  2D02 A;  3FKW A;  3H82 A;  1NJ4 A;  1E25 A;  1MWU A;  3N7W A;  1XJ6 A;  3CLO A;  4G3W A;  1XFN A;  2OLU A;  2WKP A;  3A0S A;  4NXF A;  4OVD A;  5DF9 A;  1AWI A;  3QP4 A;  4KQQ A;  5L09 A;  1CK3 A;  2PHY A;  5F69 A;  3W4O A;  3ZG8 B;  4ZJ1 A;  5EUA A;  1NY0 A;  5IS1 A;  1IKI A;  5FEF A;  4WZ5 A;  3H7W B;  4Y0O A;  1BSG A;  2PR5 A;  3UE3 A;  3E4O A;  4C75 A;  2Z2L B;  2EWV A;  5GHY A;  1LL9 A;  3FV7 A;  2EFU A;  4MNR A;  4X25 A;  4EWF A;  4WZ4 A;  1XKZ A;  2PYR A;  3UY6 A;  1PWG A;  1NLY A;  4PM9 A;  4OPZ A;  2VGL S;  4FH4 A;  4QHC A;  4YNR A;  3P01 A;  4EEP A;  3OLO A;  1K38 A;  1E3U A;  1PYY A;  2Z2M B;  3VSL A;  1KDW A;  5HPF A;  3WS0 A;  3NIA A;  4Y13 A;  2V8C A;  4OPR A;  4R3A A;  1UGU A;  3C7V A;  3UB9 A;  5TBM A;  5IU1 A;  2GNX A;  1OME A;  2WKR A;  1E3U D;  3QHY A;  3P98 A;  2HF6 A;  2EXA A;  4GOG A; 
#chains in the Genus database with same CATH homology
 2ZMF A;  3LIA A;  3BJN A;  2D01 A;  1XJ3 A;  2GZA A;  3K2N A;  3F1N B;  3UME A;  2VJW A;  5I5L A;  2PD8 A;  2O9B A;  3BY8 A;  4GS9 A;  4Y2F A;  1IOU A;  5J7E A;  2O9A A;  2W3H A;  3EWK A;  4DJ2 A;  4B93 A;  2J3W A;  1N9L A;  3LR0 A;  3UB7 A;  1ZTU A;  2HJ9 C;  5HD5 A;  1TF1 A;  1OJ5 A;  1S4R A;  4L9G A;  4DMZ A;  4MN6 A;  2P04 A;  3FG8 A;  5TJJ A;  3UE6 A;  4WL9 A;  2KDK A;  2ZOH A;  1TD5 A;  3MQ0 A;  1LSV A;  3D72 A;  2O9C A;  1VHM A;  2W0N A;  4R6L A;  1TS8 A;  3UMD A;  3ULF A;  1X0O A;  3R4K A;  4HY8 A;  4FSF A;  1W63 M;  1T19 A;  3FPV A;  3B42 A;  5HWT A;  2VZW A;  3LR5 A;  3CWF A;  1P9R A;  4KQO A;  2EWW A;  2W27 A;  4JGO A;  1P9W A;  1S1Z A;  2L1M A;  3LIE A;  3LI8 A;  2QJ7 A;  2V1A A;  4CLC E;  3HJK A;  2W1R A;  5J3W A;  4CQH A;  5C5K A;  4WEL A;  3NHQ A;  3TRC A;  3RTY A;  4II7 A;  4HIA A;  1P97 A;  3MJQ A;  4R70 A;  4Q0I A;  2W3F A;  3KSF A;  2GJ3 A;  3HCY A;  2OWJ A;  2VKS A;  4G3V A;  3LID A;  3F1N A;  3PBQ A;  2Z6C A;  1OT6 A;  1YKD A;  4JGR A;  3OC2 A;  3KX0 X;  3SW1 A;  1OT9 A;  4NXG A;  2OAQ 1;  2JKR I;  4I3I A;  4IHQ A;  2NUP C;  3TE8 A;  1GSV A;  3E4P A;  5HZH A;  2PYP A;  2ZMV A;  2KLI A;  4CLC C;  1Y28 A;  4MN5 A;  2JKR M;  3K3C A;  4EER A;  4PAU A;  4WEJ A;  2XA7 S;  3IS2 A;  1UWN X;  4IUH A;  5DKL A;  4YWZ A;  3PBN A;  4WUJ A;  4GHI A;  5HSQ A;  3IBJ A;  1S67 L;  2VA0 A;  3KSG A;  3LIB A;  1LSX A;  3FC7 A;  3B33 A;  3PBS A;  4I5S A;  2LB5 A;  2FZ0 A;  4RQ9 A;  1H8M A;  1BYW A;  4I39 A;  3VE4 A;  4ETX A;  3C8C A;  2XRN A;  3T4L A;  1F9I A;  3T50 A;  3T4K A;  2QYB A;  2KOI A;  2Z6D A;  2P08 A;  4YOF A;  3NOU C;  2VX8 A;  4HNB A;  2V0U A;  2VV6 A;  1XJ4 A;  1G6O A;  4NEE D;  4WF0 A;  3BW6 A;  1OPX A;  4Y5F A;  3CUE C;  3ZQ5 A;  3EGX C;  3KSH A;  1NRJ A;  5DFX A;  5AVE A;  2OWH A;  5HDS A;  1LSW A;  4HJ6 A;  2R78 A;  1OTB A;  2L0W A;  1YSQ A;  2QWS A;  1DRM A;  1F98 A;  4LRY C;  4GLQ A;  3PBT A;  4KUO A;  5LBR A;  4EUV A;  2J3T C;  1NWZ A;  2K2N A;  4ZRR A;  2VV7 A;  4IJG A;  1EW0 A;  1D7E A;  2EA9 A;  4F3L A;  1F5M A;  4I3J A;  5G4Y A;  3TW8 A;  2HV1 A;  3IS2 B;  3CIT A;  1T18 A;  4PHT A;  1S4S A;  1D06 A;  4GHI B;  2J80 A;  3LI9 A;  1N9O A;  2W3D A;  2NUT C;  4ARZ B;  3CAX A;  4WEK A;  3EQV A;  5DJU A;  1STZ A;  1MC0 A;  2K31 A;  4HHD A;  3BQ8 A;  5FL3 A;  3O5Y A;  5HDC A;  1OTA A;  4HJ4 A;  2PT7 A;  1YSP A;  4P6Z M;  4I3A A;  1OTE A;  1H3Q A;  3NOT C;  3T4S A;  3KSI A;  4AFI A;  3NJA A;  4BBU A;  3HJI A;  2PR6 A;  5MC7 A;  5EFW A;  4KQD A;  2INW A;  1MZU A;  3F1O A;  5KIZ A;  4I38 A;  1DP9 A;  3T4T A;  1DP6 A;  3RFB A;  1T1C A;  2QKP A;  1T1B A;  2A24 A;  2PDR A;  4EW7 A;  4O0P A;  1S1Y A;  3OCN A;  2YKF A;  2QHK A;  3C2W A;  3JVU A;  3JVV A;  3H9W A;  4UQI M;  1TS0 A;  3PR6 A;  4EES A;  4GCZ A;  4F3L B;  2ZOI A;  3TJZ C;  4NKP A;  1DP8 A;  4OOL A;  2WKQ A;  2XRO A;  3S7N A;  4CLC D;  4EET B;  3A0V A;  4Q0J A;  4GW9 A;  3GDI A;  2OOL A;  4M4X A;  1OJG A;  2KX6 A;  1GSW A;  2W3E A;  3MF0 A;  4QPR A;  4HP9 A;  3VV4 A;  3PYP A;  4ARZ A;  3NOP C;  3S7O A;  3VOL A;  5CX7 A;  2M7U A;  4L0L A;  4DN0 A;  3KYZ A;  3MFX A;  4ME4 A;  4MCW A;  3IBR A;  4H6J A;  1TS6 A;  3CUE A;  2XSS A;  4LLO B;  4EEU A;  3PHY A;  2M7V A;  4BWI A;  5DFY A;  1P0Z A;  2JHE A;  2YKH A;  3FPW A;  1W63 Q;  3P7N A;  3E0Y A;  3UB8 A;  3G6O A;  5AJG A;  4PKY G;  4Q0H A;  1G28 A;  1KOU A;  2OAP 1;  1GSX A;  3F1O B;  3T4J A;  3LFV A;  4NXB A;  3ICY A;  1OTI A;  4HQA A;  2A24 B;  4CLC B;  4O8G A;  3MMH A;  2L4R A;  3E98 A;  3LUQ A;  1T1A A;  3LIF A;  5HWV A;  3C30 A;  4BJP A;  1WA9 A;  2K7S A;  2PD7 A;  3LYX A;  1XFQ A;  5HL6 A;  3S7Q A;  3K3D A;  3LR4 A;  4R38 A;  1N9N A;  4L9E A;  2W1T A;  2ZBB A;  2VGL M;  3E4Q A;  4EQ1 A;  2J3T D;  1V9Y A;  2QJ5 A;  4P6Z S;  4GJ4 A;  3F1P A;  4ETZ A;  3H7W A;  2VLG A;  4HOI A;  3EEH A;  1ODV A;  5F5Y A;  5K5B A;  2H28 A;  1JNU A;  3LR3 A;  4BBT A;  2IA2 A;  4OOM A;  3BQA A;  3EGD C;  3W2Z A;  1V9Z A;  2V0W A;  3S7P A;  5L8M A;  3MQO A;  1ZHH B;  5AVF A;  4Z1W A;  3R7W B;  3UB6 A;  2O0Y A;  2P7J A;  3OBF A;  4LPZ A;  2BAS A;  3EOI A;  3MQQ A;  4PKY A;  2V1B A;  2JKT I;  5F68 A;  4H6J B;  4HP4 A;  5HD3 A;  2HJE A;  4B9O A;  3RH8 B;  5DKK A;  4UQI S;  4E04 A;  1YAX A;  2JN7 A;  5DJT A;  2JKT M;  3OOV A;  3MR0 A;  1S66 L;  2DMW A;  2B18 A;  4MMN A;  2D02 A;  4G3K A;  3H82 A;  2GX5 A;  4UEY A;  4NXE A;  4LRZ E;  1XJ6 A;  3CLO A;  2V9A A;  4G3W A;  1TS7 A;  1XFN A;  4FOF A;  4EU0 A;  5HWW A;  3BY9 A;  3OCL A;  2A2L A;  3ZYT A;  4XT2 A;  2WKP A;  3A0S A;  4CLC A;  4JGP A;  4NXF A;  5DF9 A;  3MXQ A;  3PBO A;  5TBM B;  3BWL A;  2MJ6 A;  3T4O A;  2PHY A;  5HDD A;  5HPI A;  2M1C A;  5F69 A;  4WN5 A;  2W1T B;  5G4Z A;  2FH5 A;  4MN7 A;  4WLA A;  5IS1 A;  3F1P B;  3H7W B;  3GEC A;  4MDZ A;  1LL8 A;  5A8B A;  4L9F A;  2PR5 A;  3UE3 A;  3E4O A;  2Y8H A;  2EWV A;  3EQU A;  1NLZ A;  1LT0 A;  4Y3I A;  4GS9 B;  4LRX C;  4HJ3 A;  5IT5 A;  3DBA A;  3LIC A;  3R7W A;  2CMN A;  2PYR A;  3PXP A;  4DJ3 A;  3U2A A;  4HH2 A;  1NLY A;  2HGV A;  2VGL S;  4YNR A;  3VE3 A;  3P01 A;  2VV8 A;  4EEP A;  1OTD A;  4EXO A;  4BBV A;  4IUK A;  4JGQ A;  3OLO A;  4O01 A;  3H82 B;  1MKM A;  3PBR A;  3B47 A;  5KSH A;  2LB9 A;  3V67 A;  5HPF A;  1IFQ A;  2W3G A;  4HI4 A;  2I9V A;  4XT2 B;  3KYQ A;  4R3A A;  4K08 A;  3C38 A;  2O99 A;  3CI6 A;  1UGU A;  2G7U A;  1XJ2 A;  3UB9 A;  5TBM A;  5IU1 A;  2GNX A;  3EEA A;  5F6A A;  5J4E A;  2WKR A;  2XA7 M;  4BMW A;  3KO6 A;  2HF6 A;  3D3O A;  2B02 A;  3T4Q A;  2Y79 A;  4KUK A;  1UWP X;  3A0R A;  2VEA A;  1VB6 A;  4HH3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...