4M4XA

Structure and dimerization properties of the aryl hydrocarbon receptor (ahr) pas-a domain
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
160
structure length
126
Chain Sequence
GSMLQEGEFLLQALNGFVLVVTADALVFYASSTIQDYLGFQQSDVIHQSVYELIHTEDRAEFQRQLHWALNPDNASFMERCFRCRLRCLLDNSSGFLAMNFQGRLKYLHGQNLPPQLALFAIATPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Aryl hydrocarbon receptor
publication title Structure and dimerization properties of the aryl hydrocarbon receptor PAS-A domain.
pubmed doi rcsb
source organism Mus musculus
total genus 32
structure length 126
sequence length 160
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4m4xA00
1EW0A 4WUJA 2OWHA 3F1NB 2H28A 1TS6A 4F3LA 1N9LA 2Z6CA 4L9EA 2EA9A 4KUKA 4PKYG 1UGUA 5F6AA 4K08A 3E4QA 3B33A 3LIAA 1DP8A 5F69A 3BY8A 2BASA 2PR5A 1LSWA 1Y28A 3LI9A 3NOTC 5I5LA 2QJ7A 1P97A 1JNUA 4EQ1A 2M1CA 4WN5A 5KIZA 3MR0A 4NXBA 2P7JA 2KX6A 1WA9A 5A8BA 4HI4A 4F3LB 1DP6A 3LIBA 3FC7A 2W27A 4EEPA 4DJ3A 3UB6A 2A24B 3D72A 1S1ZA 1TS0A 4HHDA 1GSXA 2OWJA 4RQ9A 1S1YA 3LIFA 4I3IA 5HWVA 3F1OA 1GSWA 1S66L 3E4PA 5HDSA 4E04A 2V0WA 2QKPA 5EFWA 5AVFA 3T50A 4LRZE 1LSVA 2I9VA 1N9OA 4R38A 3VE3A 3CLOA 3H82A 1XJ4A 2CMNA 1D7EA 1LL8A 2V1AA 1XJ2A 3PHYA 1V9YA 4HQAA 4I38A 1TS8A 5HDCA 4WF0A 3CAXA 1DP9A 2PHYA 4EXOA 3MQQA 2L0WA 3LICA 4LRXC 3GDIA 1T18A 5G4ZA 5HWWA 2JN7A 4LPZA 1XJ6A 4R3AA 5J3WA 2B02A 5TBMA 5IS1A 1S4RA 1T1BA 3VOLA 4GHIA 2R78A 1T1AA 4GS9A 3NOPC 1BYWA 4BBUA 2V9AA 3F1PA 4HNBA 3IBRA 4GCZA 5HSQA 2D02A 2V0UA 3P7NA 2WKPA 2ZOHA 2Z6DA 2HV1A 5DJTA 4HY8A 4EERA 4KQDA 1V9ZA 5IU1A 4EEUA 3A0SA 3UE6A 1NWZA 2KDKA 3MFXA 5J7EA 4JGOA 1OT6A 1OTDA 2ZBBA 3FG8A 4HIAA 3MQOA 4GHIB 4YWZA 4GS9B 3UMEA 5HD3A 3SW1A 4M4XA 3F1PB 3EWKA 1T19A 2VV8A 2QJ5A 3IS2A 5HZHA 4HH3A 5HD5A 4HOIA 4BBVA 5HWTA 3VE4A 4LLOB 1OTAA 1DRMA 3C8CA 1F98A 3ZQ5A 4R70A 3UB9A 3RTYA 3C2WA 2JHEA 4HP4A 1OTBA 4DJ2A 1OJ5A 2J80A 4I3JA 4H6JA 4HJ6A 1P0ZA 1MZUA 3PYPA 2QHKA 3LIDA 2PR6A 1N9NA 1LSXA 2ZOIA 4WLAA 4B9OA 1S67L 3F1OB 1X0OA 4L9GA 2QWSA 3IS2B 4GW9A 5DJUA 1XFNA 3NJAA 4HJ4A 4EETB 3KX0X 1S4SA 1UWNX 3A0VA 3K3DA 3K3CA 3G6OA 1OJGA 1T1CA 3MJQA 1XJ3A 3H82B 4MN5A 1OT9A 3LYXA 1OTEA 4H6JB 4NXGA 1UWPX 1XFQA 5F5YA 5F68A 1F9IA 3LIEA 1ODVA 4BBTA 3UMDA 3RH8B 1D06A 2V1BA 1LT0A 2A24A 3A0RA 3H9WA 2WKRA 1OTIA 3CWFA 4WL9A 1TS7A 2INWA 4MN6A 4HP9A 2OOLA 2D01A 3BY9A 2WKQA 2W0NA 5DKKA 5TBMB 3BWLA 3HJIA 4NXEA 1GSVA 2PYRA 3GECA 4KUOA 4LRYC 2PDRA 2L4RA 3LI8A 3EEHA 3NHQA 5HDDA 3UB8A 2GJ3A 2VEAA 4PKYA 3UB7A 2PD8A 4JGRA 3E4OA 3HJKA 3H7WA 1G28A 4NXFA 4XT2A 5AVEA 5G4YA 2VLGA 2PYPA 4HH2A 2PD7A 4HJ3A 4EW7A 3LUQA 2YKFA 3F1NA 4R6LA 4I39A 4JGQA 4I5SA 4EESA 3ICYA 3ULFA 2VV6A 2VV7A 4JGPA 5J4EA 1KOUA 2YKHA 4I3AA 2K7SA 5DKLA 3H7WB 4XT2B 4L9FA 1VB6A 2L1MA 3OLOA 3MXQA 3NOUC
chains in the Genus database with same CATH superfamily
1WYBA 3VSKA 3IF6A 3O5YA 4G3VA 1SKFA 2H28A 1TS6A 1N9LA 2Z6CA 4L9EA 1MWSA 5HW3A 1W63Q 1F5MA 1IKGA 1LHYA 1Y4OA 1NXYA 5EVID 3VP4A 3LIAA 4Q8IA 3QP4A 2XK1A 5A93A 4WYYA 2IA2A 2PR5A 1LSWA 3LI9A 4KG5A 4LV0A 3VP1A 3NOTC 1YAXA 5I5LA 3MMHA 2A3UA 1JNUA 5C5KA 2XDMA 4WN5A 2PU2A 4NXBA 2P9VB 3D9YA 2XGNA 3CUEA 5JYPA 3IF6B 4Y0UA 1XX2A 5A8BA 1DP6A 1XGJA 3IWQA 5DTKA 5LBRA 3BEBA 4EEPA 4GJ4A 1FCNA 1ES2A 3UB6A 2W3FA 5AQBA 2DRWA 2B95A 3O86A 1SKOA 3HLGA 4HESA 4N9LA 3UO9A 4RA7A 4R1GA 1PZPA 4RQ9A 5E2EA 2WADA 3HLWA 2HGVA 1H8MA 3CMZA 1S1YA 2Y55A 3HBRA 4XUXA 5HWVA 4GZBA 1S66L 2Y8HA 3UE1A 1XKZA 4E04A 5DF8A 2E8JA 5DF9A 3SH8A 1K0KA 2VZWA 3IWIA 4KZ5A 2EFXA 1BULA 2P74A 4OQGA 2CMNA 2VX8A 3GV9A 1SKOB 2H0YA 4FOFA 4HQAA 5I94A 1S0WA 3HLFA 4S2MA 4CPKA 5AQ7A 5HDCA 1DP9A 1Q2QA 4BJPA 3MQQA 4R3BA 5EM0A 1KE3A 2J7VA 3WS4A 1U60A 1W5DA 4PMAA 3HCYA 3Q81A 3ZNYA 5FI2A 4X1MA 2B02A 5IS1A 4M3KA 3AGFA 4GHIA 1K6RA 3BJNA 3UNWA 4KZAA 2UWXA 5CXWA 2IWBA 4Q0JA 5IT5A 1K55C 3KSHA 5CX7A 2WKPA 3Q82A 3RFBA 2HV1A 3ZDJA 4E3LA 4EERA 3FV7A 3PBSA 3T4KA 3O3VA 3D3OA 3DBAA 4DN0A 2XRNA 2I72A 3DWKA 3MQOA 4GHIB 3O87A 3LY4A 3HUOA 5HD3A 4ESPA 3PAGA 2GZAA 4DDYA 1KVLA 2QJ5A 4HH3A 5HWTA 5DTSA 1H0MA 3JPUA 1F98A 1ALQA 4R70A 3IXBA 1YM1A 2Q9MA 5FI7A 1NZUA 2JKTI 3DWZA 2ZC7A 3ZG0A 4I3JA 3WWXA 4KQRA 5DFYA 2CC1A 4HJ6A 1K55A 1P0ZA 3FKVA 2QMIA 3HLEA 3MKFA 3VFFA 4WEJA 3JVVA 3ZHHA 2J8YA 2DNSA 2P04A 3LIDA 3VSLA 4ZDXA 4NK3A 3QP6A 1LSXA 3MZFA 4R4SA 4ARZB 3T1QB 1MXOA 2EWWA 3M6HA 2WUQA 2W3HA 1PYYA 2J3TC 1H8YA 4BENA 4MDZA 4WM9A 2JKGA 3V39A 2H10A 5HX9A 3ITBA 1KE4A 2J9OA 4Y0OA 1JWVA 3A0VA 3K3CA 5GHXA 1W8QA 1T1CA 3MJQA 3H82B 2P08A 2X71A 1OT9A 1YLPA 1RGYA 3Q1FA 3CITA 4CJNA 3T1RA 3UPNA 2LB5A 4YFMA 1FSWA 3LIEA 1BZAA 1ODVA 3G2YA 4NG2A 1BT5A 3RH8B 3E98A 4FH2A 1QMEA 1GHPA 5TR7A 2Y4AA 3VOYA 5CEBA 4CLCA 1K57A 2WKRA 2ZC3B 3KYZA 4BQMA 1TS7A 4AFIA 4BL2A 2OLVA 4LV1A 3IXDA 3WS5A 4ZTKA 3E2LA 2D01A 3BY9A 2FZ0A 4E3NA 5DKKA 3I7JA 4NETA 3V50A 1IOUA 4KZ6A 3DAVA 1IYQA 2VGKA 1L2SA 2V20A 5EVEA 1W79A 4DE3A 3W2ZA 1TEMA 2Z2MB 1YQSA 1G6AA 4PKYA 4IVIA 3HJKA 1YLWA 3IQAA 4PAUA 1MC0A 1G28A 2HP5A 4NXFA 1K4FA 4FTXA 4HH2A 4DDSA 5G18A 5CGXA 3A3EA 1YSPA 4OLGA 4DE2A 3TW8A 4OP8A 1MKMA 4JGQA 4OP5A 1IKIA 3LY3A 2XD1A 3HREA 2WGIA 3MS6A 1BLPA 3ICYA 1CF0A 1JTGA 5TGFA 1W7FA 2ZMAA 1KOUA 2YKHA 3S1YA 4I3AA 2K7SA 4IVKA 5EVLA 4P87A 3IBJA 4L9FA 1TVFA 1VB6A 2Q0OA 3MXQA 5GL9A 4FSFA 4EWFA 3IXHA 4OQIA 4Q0HA 1EW0A 1IYPA 3TG9A 3NY4A 2W1TA 2GX5A 3V3SA 3JYIA 3OZHA 2FFYA 1SDNA 2VGLS 5F6AA 1Z6FA 2XQZA 4RX3A 3MQ0A 1ZKJA 3B33A 1WE4A 1DP8A 3BW6A 2J3WA 2Y2KA 1L0EA 5GHYA 4EQIA 5L8MA 1Y28A 4OPZA 1P97A 3V67A 4EQ1A 2W3GA 3TRCA 3C30A 2M1CA 3KYEA 4X6TA 3MR0A 3T1XA 2P7JA 1BUEA 1WA9A 3IX3A 4PM6A 3T4QA 1SHVA 3OCLA 4HI4A 4DXBA 3EGXC 4KENB 3LIBA 4P6ZS 2W1TB 3U2AA 1LI0A 2W27A 4O0PA 3S7PA 4UEYA 1MWUA 3D72A 2XFTA 5L10A 3PBQA 2JE5A 3N8SA 1OPXA 1YLYA 3ZVWA 4HHDA 4IBXA 1SZVA 2PAVP 4Z1WA 2HF6A 4I3IA 1NLYA 3BECA 2ZC6B 3OBFA 1K6SA 1JVJA 2WYXA 4KZ4A 4C75A 3BFFA 1K38A 2V0WA 3VMAA 2QKPA 4JXGA 5AVFA 4QD4A 3QNBA 3T50A 4B4XA 1C3BA 3BFEA 1FIKA 4LRZE 3PBOA 4WZ5A 1GHMA 4CQHA 1N9OA 2IWCA 2Y2PA 1PNEA 3CUEC 1DJBA 3PHYA 1V9YA 3ZYTA 4EBNA 1ESUA 1LI9A 2J3TD 3QP5A 4QY6A 4II7A 4R3JA 5FDHA 3TOIA 1HLUP 3BM6A 3CAXA 5JYOA 4WMCA 5CTNA 3KO6A 2PHYA 3WRTA 1N4OA 3GDIA 5G4ZA 4Y7PA 1VEUA 2ZJ9A 3FPVA 1GA9A 3MSHA 3VP2A 2R9XA 4S2OA 5FQIA 3SH9A 1Y54A 3AGEA 3GR2A 4DMZA 3QHYA 2WAEA 4IJGA 3T4JA 4R3AA 3LEZA 2WKEA 5J3WA 4K91A 3E2KA 2JKFA 5CHMA 1YPRA 4Y17A 4K0WA 1IFQA 4S2IA 2R78A 4GS9A 4LFUA 2M7UA 4BD0A 5KZHA 4GOGA 4UQIS 3IBRA 4ZJ2A 1H8ZA 2JKRI 4E3IA 4F94A 4NEED 1RCJA 2V0UA 5E2GA 2WZXA 1IYOA 4OOYA 5FL3A 4OONA 3CI6A 3UPPA 1S6RA 1VEUB 3PR6A 5M19A 2Q9NA 1XGIA 1VETA 1V9ZA 3UE6A 4DE1A 4Y0TA 3PXPA 3PTEA 4MBKA 5F1FA 1NYYA 2ZBBA 1EROA 3FG8A 1JWZA 3DTEA 3QP1A 4O8GA 3O88A 2K31A 1PFLA 4GS9B 4PM8A 1MPLA 3MXSA 1ESIA 3SW1A 2VKSA 4JF4A 3NIAA 5HZHA 4BBVA 2EX2A 1L3LA 2WGVA 2XA7M 3P09A 1OTAA 1DRMA 1VETB 2ZD8A 1DJAA 2FFFB 2ZM2A 4HP4A 4DJ2A 1OJ5A 1F2KA 3OPLA 1I5QA 2LB9A 4QU3A 2O0YA 1RP5A 2V8CA 2ZM0A 3EQUA 3PYPA 5FSRA 1EWZA 5CERA 2PU4A 5J8XA 5FQQA 4B9OA 1S67L 1XFNA 3MKEA 4LV2A 2Y91A 2Y2MA 5E43A 2M7VA 1E3UD 3N8RA 4PPRA 2HP6A 3K3DA 3G6OA 4WEKA 1XJ3A 1QMFA 3LYXA 4NXGA 1K4EA 3ZGAB 1AWIA 3LR5A 5F68A 3DTKA 3T4TA 3FYZA 4BD1A 4IEDA 5FI6A 4WELA 2V1BA 3IF5A 1LT0A 1KDSA 2A24A 3PBRA 2Y2GA 2MJ6A 3G30A 3HLBA 2HPBA 4JXWA 1ERMA 2ZM8A 1VM1A 1PW1A 1OTIA 4MEZA 3CWFA 3V5MA 4XXRA 3IWOA 4UA7A 2INWA 2ZQ9A 2OOLA 1BSGA 2JCHA 3B3XA 2WKQA 2Y2LA 5EUAA 3BWLA 3HJIA 4JKTA 5L09A 4EUVA 2KOIA 3GECA 3ZG5A 3PAEA 2PDRA 4HBTA 5HL6A 1FCOA 3LI8A 3P01A 3VV4A 1O07A 3OOVA 4OOLA 5FATA 2GJ3A 1GHIA 3UB7A 2ZQ8A 2PD8A 2GNXA 2QYBA 5EM1A 3E4OA 3UN7A 1FQGA 3A3FA 4YINA 3V3RA 2O99A 3A3IA 1PZOA 3RJUA 2VLGA 4CLCC 3GRJA 1L0DA 2RL3A 1K57C 2AVXA 2VGLM 2PD7A 5DFXA 3TSGA 2YKFA 3K2NA 2B5RA 5FA7A 4KQQA 4Y13A 4I39A 3SS5A 4ZAMA 3CG5A 3S22A 1E4DA 2WKIA 3WS1A 2BG1A 4JLFA 4EESA 2VV6A 2A49A 4O01A 2VV7A 4JGPA 3A3JA 4E3OA 5FAQA 5KSHA 5EV0A 4LCLA 1ERQA 3HL9A 5DKLA 4LENA 2W1RA 3P98A 5KMWA 4P6ZM 2QZ6A 1NJ4A 2OV5A 4S2KA 4MN5A 3NOUC 4N92A 1VQQA 3EQVA 1PIOA 2EWVA 2EX6A 1CEFA 5A92A 3R4KA 4F3LA 4EU0A 4GB7A 4QPRA 2EXBA 4K0XA 4QWOA 3KSIA 4KUKA 3HUMA 3S4XA 4K08A 4B93A 1TF1A 3E4QA 3RXWA 4ZRRA 2HJ9C 4ID4A 3BFDA 5F69A 2EFUA 3KSGA 3BY8A 1STZA 4IUHA 3UE0A 4B4ZA 5EVIC 1TD5A 2QJ7A 1G68A 2X01A 4E3JA 3N4IA 4C3QA 2KX6A 4YNRA 5FDSA 2UV0E 1CI8A 4Z9QA 4OPYA 1TDLA 3SS3A 4F3LB 5HAPA 4S2JA 3FZCA 2PRFA 3TE8A 1WYCA 4GDBA 3W8KA 5IHVA 2E8IA 4CLCB 4E6WA 1S1ZA 1K54A 1MWRA 5HARA 4R23A 4Y2FA 4N9KA 3CPTA 4D60A 1ZG6A 2PBDP 4MCWA 3F1OA 1GSWA 3E4PA 4B88A 4FD8A 1O7EA 2XD5A 5HDSA 5M1AA 3W4PA 5EOOA 3WS0A 1CK3A 3IHBA 5HPIA 1LSVA 1ZC2A 1K56D 3S7QA 4UQIM 2I9VA 5EVIA 1XJ4A 3UDXA 2V1ZA 2VA0A 4OQ0A 5EECA 2K2NA 4O7DA 2JC7A 2V1AA 1XJ2A 1BLSA 1YMSA 1N9BA 3N6IA 4OPQA 2ZMFA 3CPTB 3OC2A 3MFDA 3R7WA 2QPNA 1FR6A 4XUZA 3AGDA 2L0WA 2OLUA 4X1LA 5GLBA 4X53A 1T18A 1XA7A 4X68A 4GD8A 2JN7A 1HZOA 3OPRA 3C7VA 4JBFA 1BTLA 1ZHHB 4MNRA 4U0TA 2JBFA 5EVIB 4CLCE 5TBMA 1IEMA 5GLCA 2HDUA 1S4RA 5DVAA 3VOLA 3IT9A 4OKPA 4WZ5C 1BYWA 4LV3A 2H5SA 5CRFA 2GDNA 3F1PA 4DF6A 3PBTA 4QHCA 4GCZA 3R7WB 5HSQA 3IH9A 3ZNTA 2D02A 3MZDA 2ZOHA 4UA6A 2Z6DA 4Y5FA 4HEFA 2WGWA 5U47A 4HY8A 4WBGA 5IU1A 4EEUA 3A0SA 3EOIA 2Y2IA 3B47A 1P9WA 4JGOA 1J3WA 1DY6A 3UPOA 4HIAA 4YWZA 1CQAA 4Q0IA 1KGGA 2ZQAA 3FKWA 3F1PB 1E25A 1T19A 4KZ8A 4ZBEA 4U3TA 2Y2JA 3Q07A 5GHZA 5FQKA 4UAAA 1D1JA 2HDQA 3IS2A 5HD5A 2Z2LB 3C7UA 5AQ9A 3G31A 1YKDA 1PWDA 2WGWB 3IX8A 4IBRA 2ZLYA 3MBZA 3BFGA 4RX2A 3ZQ5A 3N7WA 4U0XA 1IYSA 3BFCA 3RTYA 3C2WA 2JHEA 2DMWA 3FWLA 2J80A 5CHUA 1KGFA 3MF0A 3SOIA 1ES3A 2WZZA 1ONGA 5HL1A 2C5WB 1MZUA 4G3KA 1HVBA 4X25A 4ZJ3A 5L07A 1N9NA 2ZOIA 4WLAA 4GDNA 3HUNA 4KZ9A 1X0OA 2QWSA 3IS2B 4GW9A 5DJUA 3G2ZA 4IUKA 4DXCA 1W8YA 1MBLA 3OPPA 4HJ4A 2WAFA 4OPRA 4DKIA 4EETB 3KX0X 3NDGA 4JXSA 3SS4A 2G2UA 4S2LA 5K5BA 2ACGA 4KG2A 4ME4A 4MMNA 1L0FA 4NKPA 5L2FA 2EX8A 4KG6A 5F1GA 1OTEA 2VK3A 1UWPX 1PWGA 4GLQA 4R4RA 3U4LP 1F9IA 5F82A 1YLJA 1NY0A 3ZG7B 4BBTA 3UMDA 5EOEA 1D06A 4KZ7A 2JKTM 3H9WA 3QP2A 4QJGA 3N8LA 3UY6A 1YSQA 3G4PA 1DJCA 1MKIA 3EGDC 4MN6A 2HJEA 1HTZA 1FR1A 2W3EA 3OPHA 2HDSA 1L0GA 2R9WA 1ONHA 4E3MA 4BWIA 2PYRA 1I2SA 4RVAA 2X02A 3EEHA 3NHQA 3BQ8A 5HFOA 5HDDA 4IHQA 4N1HA 3VP3A 4X55A 4JGRA 4LCMA 4YOFA 1YLTA 2ZL1A 4PM9A 4OH0A 4OLDA 4R0QA 4KQOA 3IXGA 4XT2A 5AVEA 5G4YA 4P6BA 1RGZA 3VOZA 4EUZA 4GKUA 1LL9A 2PYPA 4GNUA 2XFSA 5E2FA 3VP0A 3GVBA 1ES4A 4Y15A 4EW7A 2Y2NA 3NECA 3ZG9B 1MY8A 3F1NA 4R6LA 1Q2PA 3S7NA 2G2WA 4I5SA 2HZ5A 5FAPA 1PRQA 2EX9A 1BLHA 3ULFA 1LLBA 2O9AA 4BL3A 3OCNA 5J4EA 3IHAA 3QP8A 4MBFA 2ZL1B 5A91A 1K25A 1P9RA 2BTFP 4UA9A 3UDIA 4XT2B 2L1MA 2XR0A 3OLOA 1BLCA 1FILA 2O9BA 3EEAA 3UE3A 2RCXA 4WUJA 3CJMA 2OWHA 3F1NB 1SDEA 1GA0A 4UHUA 3BLSA 3G32A 3T4SA 3B42A 5GLDA 2EA9A 4LGWA 4PKYG 1UGUA 2KLIA 3VFHA 1PW8A 4E3KA 5TFQA 2BASA 3ZG8B 1ZG4A 1JTDA 5KIZA 3HVFA 1H5XA 4WMCD 4OQHA 2ZQCA 1K56A 1XPBA 3HLDA 3FC7A 4DJ3A 2A24B 1KVMA 1YLZA 4ETXA 3LGOA 1TS0A 4OVDA 1GSXA 2OWJA 3TJZC 4A5RA 3Q7ZA 2V8FA 4EV4A 1CEGA 1OMEA 5BOHA 3LIFA 4ARZA 5FEFA 2V2FF 2HP9A 2XEPA 1KDWA 1VHMA 5EFWA 2ZQDA 5FAOA 2BLSA 1KE0A 3MXRA 5EE8A 1XXMA 4E6XA 4R38A 3VE3A 3CLOA 3H82A 1PI5A 2J9PA 1YMXA 1D7EA 1LL8A 5F83A 1FSYA 1XA1A 3NBLA 4I38A 4EBPA 1SCWA 2EXAA 1TS8A 4G3WA 4WF0A 3GQZA 4GD6A 4MN7A 5HAQA 4EXOA 2C6WB 3LICA 4LRXC 3D4FA 3IX4A 1K54C 2HDRA 5AQAA 5HWWA 3QNCA 4MLLA 5CHJA 5FEGA 4LPZA 3LR3A 2Y2OA 1ACFA 3CHWP 1PI4A 5FQMA 1XJ6A 1IELA 4C6YA 4OOMA 3A3DA 2IWDA 2XA7S 3LR0A 2OSUA 1T1BA 1T1AA 4X56A 1M40A 4ETZA 3MZEA 3NOPC 4PM7A 4MBHA 4BBUA 2PT7A 2V9AA 3IH8A 4HNBA 1NLZA 5DTTA 3S7OA 2W3DA 5E2HA 4KZBA 4S2PA 3P7NA 5HAIA 4ZJ1A 4S2NC 5DJTA 4KQDA 1CJFA 1FCMA 3NI9A 1G6OA 1NWZA 2KDKA 3MFXA 4BLMA 5J7EA 3ZFZA 3C4OA 1OT6A 3L7HA 1OTDA 4FCFA 3ZCZA 4L0LA 2FH5A 2Y59A 4PM5A 3GSGA 3C5AA 3UMEA 5M18A 4FUWA 4M4XA 3EWKA 1J9MA 2ZC4B 2VV8A 4P85A 3G35A 4HOIA 1GCEA 1XP4A 2XF3A 5CGSA 3VE4A 4LLOB 3NDEA 3C8CA 3WS2A 1NRFA 5HPFA 3DW0A 3KYQA 3UB9A 4X69A 3LFVA 4N1XA 1ZTUA 4H8RA 5FQJA 1OTBA 2B18A 4JPMA 2JKRM 1JWPA 4H6JA 2H0TA 5TJJA 5MC7A 3ZVTA 3LEQA 1KGEA 3PBNA 4S2NA 3M2JA 4Y3IA 2QHKA 2PR6A 1ES5A 2ZC5B 3SZTA 2WKHA 4D2OA 3F1OB 4L9GA 3JVUA 3NULA 5FQ9A 2XLNA 5DF7A 3NJAA 3C38A 1S4SA 1G5UA 2Y2HA 3DTMA 1UWNX 1A0KA 1MWTA 3WRZA 1OJGA 4H6JB 3T4OA 2WK0A 3T1SA 3BYDA 1XFQA 2VJWA 2ZQ7A 2OAQ1 2XROA 5F5YA 5KSCA 5CEDA 4QY5A 2OAP1 3M6BA 3T4LA 4PHTA 3M2KA 3E0YA 2XH9A 3A0RA 2Y79A 1EI5A 2DCFA 4JXVA 1LL5A 3GMWA 5EPHA 2G7UA 2NUTC 4WL9A 1HD8A 5CECA 4BMWA 2PBYA 4HP9A 1M6KA 1H3QA 2W0NA 5TBMB 1TDGA 2NUPC 3LCEA 4DRTA 3G34A 1PWCA 4NXEA 5FASA 1AXBA 1GSVA 4KUOA 3ISGA 3L9KA 4LRYC 3BLMA 2L4RA 3RXXA 4DE0A 2A2LA 4FH4A 2O9CA 2VGJA 1YT4A 3HLCA 5D3OA 3UB8A 3IF6C 1E3UA 2VEAA 4JF6A 3DTIA 3GTCA 4CLCD 3T12B 3C4PA 3H7WA 1NYMA 3BQAA 3W4QA 2Y2QA 4RYEA 1CI9A 3Q7VA 5GLAA 3UDFA 2ZMVA 4HBUA 4HJ3A 1I2WA 4WZ4A 1W63M 3LUQA 3SH7A 3ITAA 3KSFA 5AJGA 2XSSA 4EBLA 3CZDA 3FPWA 3BRMA 1NZOA 5A90A 4JF5A 3W4OA 5CGWA 3NCKA 3H7WB 5CTMA 4KZ3A 4QB8A 1FOFA 4P0MA 1Z09A 3NC8A 3Q7VB 1NRJA 4GN2A 3LO7A 2P9VA 3UB5P 3LR4A
chains in the Genus database with same CATH topology
4Q0HA 3EQVA 1EW0A 4WUJA 2EWVA 3O5YA 2OWHA 4G3VA 3F1NB 2H28A 3R4KA 1TS6A 4F3LA 4EU0A 2W1TA 2GX5A 1N9LA 2Z6CA 4QPRA 3T4SA 3B42A 4L9EA 2EA9A 3KSIA 4KUKA 4PKYG 1UGUA 2VGLS 5F6AA 4K08A 1W63Q 1F5MA 4B93A 2KLIA 3MQ0A 1TF1A 3E4QA 3B33A 3LIAA 4ZRRA 2HJ9C 1DP8A 3BW6A 2J3WA 5F69A 3KSGA 3BY8A 2BASA 2IA2A 1LSWA 1STZA 1Y28A 2PR5A 3LI9A 4IUHA 5L8MA 3NOTC 1YAXA 5I5LA 3MMHA 1TD5A 2QJ7A 1P97A 3V67A 1JNUA 4EQ1A 2W3GA 5C5KA 3TRCA 3C30A 2M1CA 4WN5A 5KIZA 3MR0A 4NXBA 2P7JA 2KX6A 4YNRA 1WA9A 3CUEA 3T4QA 3OCLA 5A8BA 4HI4A 3EGXC 4F3LB 1DP6A 3LIBA 4P6ZS 2W1TB 3FC7A 3U2AA 2W27A 5LBRA 4O0PA 4EEPA 3S7PA 4GJ4A 4UEYA 4DJ3A 3TE8A 3UB6A 2W3FA 2A24B 3D72A 3PBQA 4ETXA 4CLCB 1S1ZA 1OPXA 1TS0A 4HHDA 1GSXA 2OWJA 4Y2FA 4RQ9A 3TJZC 4Z1WA 2HGVA 1H8MA 1S1YA 2HF6A 3LIFA 4ARZA 4I3IA 4MCWA 1NLYA 5HWVA 3F1OA 1GSWA 3OBFA 1S66L 3E4PA 2Y8HA 5HDSA 4E04A 2V0WA 2QKPA 1VHMA 5EFWA 5AVFA 3T50A 5DF9A 4LRZE 2VZWA 5HPIA 3PBOA 1LSVA 3S7QA 4UQIM 4CQHA 2I9VA 1N9OA 4R38A 3VE3A 3CLOA 3H82A 1XJ4A 2CMNA 2VA0A 2VX8A 1D7EA 2K2NA 3CUEC 1LL8A 2V1AA 1XJ2A 3PHYA 1V9YA 3ZYTA 4FOFA 4HQAA 2ZMFA 2J3TD 4I38A 4II7A 1TS8A 3OC2A 5HDCA 4G3WA 4WF0A 3CAXA 4MN7A 1DP9A 3R7WA 3KO6A 2PHYA 4BJPA 4EXOA 3MQQA 2L0WA 3LICA 4LRXC 3GDIA 1T18A 5G4ZA 3HCYA 5HWWA 2JN7A 3FPVA 4LPZA 3LR3A 1ZHHB 4DMZA 4IJGA 1XJ6A 3T4JA 4R3AA 5J3WA 2B02A 4CLCE 4OOMA 5TBMA 5IS1A 2XA7S 3LR0A 1S4RA 1T1BA 3VOLA 1IFQA 4GHIA 2R78A 1T1AA 4GS9A 4ETZA 3NOPC 2M7UA 1BYWA 3BJNA 4BBUA 2PT7A 2V9AA 3F1PA 3PBTA 4UQIS 4HNBA 3IBRA 1NLZA 4GCZA 3R7WB 2JKRI 4Q0JA 5HSQA 5IT5A 3S7OA 2D02A 4NEED 2V0UA 2W3DA 3KSHA 3P7NA 2WKPA 5CX7A 2ZOHA 2Z6DA 4Y5FA 5FL3A 3CI6A 3RFBA 2HV1A 3PR6A 5DJTA 4HY8A 4EERA 4KQDA 1V9ZA 5IU1A 4EEUA 3A0SA 3UE6A 1G6OA 3EOIA 3PBSA 1NWZA 3T4KA 2KDKA 3MFXA 5J7EA 3B47A 1P9WA 3PXPA 4JGOA 3D3OA 1OT6A 1OTDA 3DBAA 2ZBBA 4DN0A 3FG8A 4L0LA 2FH5A 2XRNA 4O8GA 2K31A 4HIAA 3MQOA 4GHIB 4YWZA 4GS9B 4Q0IA 3UMEA 5HD3A 3SW1A 4M4XA 3F1PB 2VKSA 3EWKA 1T19A 2GZAA 2VV8A 2QJ5A 3IS2A 5HZHA 4HH3A 5HD5A 4HOIA 4BBVA 5HWTA 1YKDA 3VE4A 4LLOB 2XA7M 1OTAA 1DRMA 3C8CA 5HPFA 1F98A 3ZQ5A 3KYQA 4R70A 3UB9A 3RTYA 3LFVA 3C2WA 2JHEA 1ZTUA 4HP4A 2DMWA 2JKTI 1OTBA 2B18A 4DJ2A 1OJ5A 2J80A 4I3JA 5DFYA 2JKRM 2LB9A 4H6JA 4HJ6A 5TJJA 1P0ZA 3MF0A 5MC7A 2O0YA 3PBNA 1MZUA 4G3KA 3EQUA 3PYPA 4WEJA 3JVVA 4Y3IA 2P04A 2QHKA 3LIDA 2PR6A 1N9NA 1LSXA 2ZOIA 4WLAA 4ARZB 4B9OA 1S67L 3F1OB 1X0OA 4L9GA 3JVUA 2EWWA 2QWSA 2J3TC 2W3HA 3IS2B 4GW9A 5DJUA 1XFNA 4IUKA 3NJAA 4HJ4A 4MDZA 4EETB 3C38A 3KX0X 1S4SA 5K5BA 1UWNX 2M7VA 4ME4A 4MMNA 3A0VA 3K3DA 3K3CA 3G6OA 1OJGA 1T1CA 3MJQA 4NKPA 1XJ3A 3H82B 4WEKA 4MN5A 2P08A 1OT9A 3LYXA 1OTEA 4H6JB 3T4OA 3CITA 4NXGA 1UWPX 1XFQA 2VJWA 4GLQA 2OAQ1 2XROA 5F5YA 2LB5A 3LR5A 5F68A 1F9IA 3LIEA 3T4TA 1ODVA 2OAP1 4BBTA 3UMDA 4WELA 3RH8B 1D06A 4PHTA 2V1BA 3T4LA 3E0YA 3E98A 1LT0A 2A24A 3A0RA 3PBRA 2JKTM 2Y79A 2MJ6A 3H9WA 4CLCA 2WKRA 1OTIA 2G7UA 2NUTC 3CWFA 4WL9A 3KYZA 1YSQA 1TS7A 4AFIA 4BMWA 2INWA 3EGDC 4MN6A 4HP9A 2HJEA 2OOLA 1H3QA 2W3EA 2D01A 3BY9A 2FZ0A 2WKQA 2W0NA 5DKKA 5TBMB 3BWLA 3HJIA 2NUPC 4EUVA 1IOUA 4NXEA 1GSVA 4BWIA 2KOIA 2PYRA 3GECA 4KUOA 4LRYC 2PDRA 5HL6A 3W2ZA 2L4RA 2A2LA 3LI8A 3P01A 2O9CA 3EEHA 3UE3A 3NHQA 3BQ8A 3VV4A 3OOVA 4OOLA 5HDDA 3UB8A 4IHQA 2GJ3A 2VEAA 4PKYA 3UB7A 2PD8A 4JGRA 2GNXA 2QYBA 3E4OA 3HJKA 4YOFA 4CLCD 3H7WA 4PAUA 1MC0A 4KQOA 1G28A 3BQAA 4NXFA 4XT2A 2O99A 5AVEA 5G4YA 2VLGA 4CLCC 2PYPA 4HH2A 2VGLM 2ZMVA 2PD7A 5DFXA 4HJ3A 1W63M 3LUQA 4EW7A 2YKFA 3K2NA 1YSPA 3F1NA 3KSFA 5AJGA 4R6LA 3TW8A 2XSSA 4I39A 1MKMA 3FPWA 4JGQA 3S7NA 4I5SA 4EESA 3ICYA 3ULFA 2VV6A 4O01A 2VV7A 2O9AA 4JGPA 3OCNA 5J4EA 5KSHA 1KOUA 2YKHA 4I3AA 2K7SA 5DKLA 3H7WB 2W1RA 1P9RA 4P6ZM 4XT2B 3IBJA 4L9FA 1VB6A 2L1MA 3OLOA 1NRJA 3MXQA 2O9BA 3EEAA 4FSFA 3NOUC 3LR4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EW0 A;  4WUJ A;  2OWH A;  3F1N B;  2H28 A;  1TS6 A;  4F3L A;  1N9L A;  2Z6C A;  4L9E A;  2EA9 A;  4KUK A;  4PKY G;  1UGU A;  5F6A A;  4K08 A;  3E4Q A;  3B33 A;  3LIA A;  1DP8 A;  5F69 A;  3BY8 A;  2BAS A;  2PR5 A;  1LSW A;  1Y28 A;  3LI9 A;  3NOT C;  5I5L A;  2QJ7 A;  1P97 A;  1JNU A;  4EQ1 A;  2M1C A;  4WN5 A;  5KIZ A;  3MR0 A;  4NXB A;  2P7J A;  2KX6 A;  1WA9 A;  5A8B A;  4HI4 A;  4F3L B;  1DP6 A;  3LIB A;  3FC7 A;  2W27 A;  4EEP A;  4DJ3 A;  3UB6 A;  2A24 B;  3D72 A;  1S1Z A;  1TS0 A;  4HHD A;  1GSX A;  2OWJ A;  4RQ9 A;  1S1Y A;  3LIF A;  4I3I A;  5HWV A;  3F1O A;  1GSW A;  1S66 L;  3E4P A;  5HDS A;  4E04 A;  2V0W A;  2QKP A;  5EFW A;  5AVF A;  3T50 A;  4LRZ E;  1LSV A;  2I9V A;  1N9O A;  4R38 A;  3VE3 A;  3CLO A;  3H82 A;  1XJ4 A;  2CMN A;  1D7E A;  1LL8 A;  2V1A A;  1XJ2 A;  3PHY A;  1V9Y A;  4HQA A;  4I38 A;  1TS8 A;  5HDC A;  4WF0 A;  3CAX A;  1DP9 A;  2PHY A;  4EXO A;  3MQQ A;  2L0W A;  3LIC A;  4LRX C;  3GDI A;  1T18 A;  5G4Z A;  5HWW A;  2JN7 A;  4LPZ A;  1XJ6 A;  4R3A A;  5J3W A;  2B02 A;  5TBM A;  5IS1 A;  1S4R A;  1T1B A;  3VOL A;  4GHI A;  2R78 A;  1T1A A;  4GS9 A;  3NOP C;  1BYW A;  4BBU A;  2V9A A;  3F1P A;  4HNB A;  3IBR A;  4GCZ A;  5HSQ A;  2D02 A;  2V0U A;  3P7N A;  2WKP A;  2ZOH A;  2Z6D A;  2HV1 A;  5DJT A;  4HY8 A;  4EER A;  4KQD A;  1V9Z A;  5IU1 A;  4EEU A;  3A0S A;  3UE6 A;  1NWZ A;  2KDK A;  3MFX A;  5J7E A;  4JGO A;  1OT6 A;  1OTD A;  2ZBB A;  3FG8 A;  4HIA A;  3MQO A;  4GHI B;  4YWZ A;  4GS9 B;  3UME A;  5HD3 A;  3SW1 A;  4M4X A;  3F1P B;  3EWK A;  1T19 A;  2VV8 A;  2QJ5 A;  3IS2 A;  5HZH A;  4HH3 A;  5HD5 A;  4HOI A;  4BBV A;  5HWT A;  3VE4 A;  4LLO B;  1OTA A;  1DRM A;  3C8C A;  1F98 A;  3ZQ5 A;  4R70 A;  3UB9 A;  3RTY A;  3C2W A;  2JHE A;  4HP4 A;  1OTB A;  4DJ2 A;  1OJ5 A;  2J80 A;  4I3J A;  4H6J A;  4HJ6 A;  1P0Z A;  1MZU A;  3PYP A;  2QHK A;  3LID A;  2PR6 A;  1N9N A;  1LSX A;  2ZOI A;  4WLA A;  4B9O A;  1S67 L;  3F1O B;  1X0O A;  4L9G A;  2QWS A;  3IS2 B;  4GW9 A;  5DJU A;  1XFN A;  3NJA A;  4HJ4 A;  4EET B;  3KX0 X;  1S4S A;  1UWN X;  3A0V A;  3K3D A;  3K3C A;  3G6O A;  1OJG A;  1T1C A;  3MJQ A;  1XJ3 A;  3H82 B;  4MN5 A;  1OT9 A;  3LYX A;  1OTE A;  4H6J B;  4NXG A;  1UWP X;  1XFQ A;  5F5Y A;  5F68 A;  1F9I A;  3LIE A;  1ODV A;  4BBT A;  3UMD A;  3RH8 B;  1D06 A;  2V1B A;  1LT0 A;  2A24 A;  3A0R A;  3H9W A;  2WKR A;  1OTI A;  3CWF A;  4WL9 A;  1TS7 A;  2INW A;  4MN6 A;  4HP9 A;  2OOL A;  2D01 A;  3BY9 A;  2WKQ A;  2W0N A;  5DKK A;  5TBM B;  3BWL A;  3HJI A;  4NXE A;  1GSV A;  2PYR A;  3GEC A;  4KUO A;  4LRY C;  2PDR A;  2L4R A;  3LI8 A;  3EEH A;  3NHQ A;  5HDD A;  3UB8 A;  2GJ3 A;  2VEA A;  4PKY A;  3UB7 A;  2PD8 A;  4JGR A;  3E4O A;  3HJK A;  3H7W A;  1G28 A;  4NXF A;  4XT2 A;  5AVE A;  5G4Y A;  2VLG A;  2PYP A;  4HH2 A;  2PD7 A;  4HJ3 A;  4EW7 A;  3LUQ A;  2YKF A;  3F1N A;  4R6L A;  4I39 A;  4JGQ A;  4I5S A;  4EES A;  3ICY A;  3ULF A;  2VV6 A;  2VV7 A;  4JGP A;  5J4E A;  1KOU A;  2YKH A;  4I3A A;  2K7S A;  5DKL A;  3H7W B;  4XT2 B;  4L9F A;  1VB6 A;  2L1M A;  3OLO A;  3MXQ A;  3NOU C; 
#chains in the Genus database with same CATH topology
 1WYB A;  3VSK A;  3IF6 A;  3O5Y A;  4G3V A;  1SKF A;  2H28 A;  1TS6 A;  1N9L A;  2Z6C A;  4L9E A;  1MWS A;  5HW3 A;  1W63 Q;  1F5M A;  1IKG A;  1LHY A;  1Y4O A;  1NXY A;  5EVI D;  3VP4 A;  3LIA A;  4Q8I A;  3QP4 A;  2XK1 A;  5A93 A;  4WYY A;  2IA2 A;  2PR5 A;  1LSW A;  3LI9 A;  4KG5 A;  4LV0 A;  3VP1 A;  3NOT C;  1YAX A;  5I5L A;  3MMH A;  2A3U A;  1JNU A;  5C5K A;  2XDM A;  4WN5 A;  2PU2 A;  4NXB A;  2P9V B;  3D9Y A;  2XGN A;  3CUE A;  5JYP A;  3IF6 B;  4Y0U A;  1XX2 A;  5A8B A;  1DP6 A;  1XGJ A;  3IWQ A;  5DTK A;  5LBR A;  3BEB A;  4EEP A;  4GJ4 A;  1FCN A;  1ES2 A;  3UB6 A;  2W3F A;  5AQB A;  2DRW A;  2B95 A;  3O86 A;  1SKO A;  3HLG A;  4HES A;  4N9L A;  3UO9 A;  4RA7 A;  4R1G A;  1PZP A;  4RQ9 A;  5E2E A;  2WAD A;  3HLW A;  2HGV A;  1H8M A;  3CMZ A;  1S1Y A;  2Y55 A;  3HBR A;  4XUX A;  5HWV A;  4GZB A;  1S66 L;  2Y8H A;  3UE1 A;  1XKZ A;  4E04 A;  5DF8 A;  2E8J A;  5DF9 A;  3SH8 A;  1K0K A;  2VZW A;  3IWI A;  4KZ5 A;  2EFX A;  1BUL A;  2P74 A;  4OQG A;  2CMN A;  2VX8 A;  3GV9 A;  1SKO B;  2H0Y A;  4FOF A;  4HQA A;  5I94 A;  1S0W A;  3HLF A;  4S2M A;  4CPK A;  5AQ7 A;  5HDC A;  1DP9 A;  1Q2Q A;  4BJP A;  3MQQ A;  4R3B A;  5EM0 A;  1KE3 A;  2J7V A;  3WS4 A;  1U60 A;  1W5D A;  4PMA A;  3HCY A;  3Q81 A;  3ZNY A;  5FI2 A;  4X1M A;  2B02 A;  5IS1 A;  4M3K A;  3AGF A;  4GHI A;  1K6R A;  3BJN A;  3UNW A;  4KZA A;  2UWX A;  5CXW A;  2IWB A;  4Q0J A;  5IT5 A;  1K55 C;  3KSH A;  5CX7 A;  2WKP A;  3Q82 A;  3RFB A;  2HV1 A;  3ZDJ A;  4E3L A;  4EER A;  3FV7 A;  3PBS A;  3T4K A;  3O3V A;  3D3O A;  3DBA A;  4DN0 A;  2XRN A;  2I72 A;  3DWK A;  3MQO A;  4GHI B;  3O87 A;  3LY4 A;  3HUO A;  5HD3 A;  4ESP A;  3PAG A;  2GZA A;  4DDY A;  1KVL A;  2QJ5 A;  4HH3 A;  5HWT A;  5DTS A;  1H0M A;  3JPU A;  1F98 A;  1ALQ A;  4R70 A;  3IXB A;  1YM1 A;  2Q9M A;  5FI7 A;  1NZU A;  2JKT I;  3DWZ A;  2ZC7 A;  3ZG0 A;  4I3J A;  3WWX A;  4KQR A;  5DFY A;  2CC1 A;  4HJ6 A;  1K55 A;  1P0Z A;  3FKV A;  2QMI A;  3HLE A;  3MKF A;  3VFF A;  4WEJ A;  3JVV A;  3ZHH A;  2J8Y A;  2DNS A;  2P04 A;  3LID A;  3VSL A;  4ZDX A;  4NK3 A;  3QP6 A;  1LSX A;  3MZF A;  4R4S A;  4ARZ B;  3T1Q B;  1MXO A;  2EWW A;  3M6H A;  2WUQ A;  2W3H A;  1PYY A;  2J3T C;  1H8Y A;  4BEN A;  4MDZ A;  4WM9 A;  2JKG A;  3V39 A;  2H10 A;  5HX9 A;  3ITB A;  1KE4 A;  2J9O A;  4Y0O A;  1JWV A;  3A0V A;  3K3C A;  5GHX A;  1W8Q A;  1T1C A;  3MJQ A;  3H82 B;  2P08 A;  2X71 A;  1OT9 A;  1YLP A;  1RGY A;  3Q1F A;  3CIT A;  4CJN A;  3T1R A;  3UPN A;  2LB5 A;  4YFM A;  1FSW A;  3LIE A;  1BZA A;  1ODV A;  3G2Y A;  4NG2 A;  1BT5 A;  3RH8 B;  3E98 A;  4FH2 A;  1QME A;  1GHP A;  5TR7 A;  2Y4A A;  3VOY A;  5CEB A;  4CLC A;  1K57 A;  2WKR A;  2ZC3 B;  3KYZ A;  4BQM A;  1TS7 A;  4AFI A;  4BL2 A;  2OLV A;  4LV1 A;  3IXD A;  3WS5 A;  4ZTK A;  3E2L A;  2D01 A;  3BY9 A;  2FZ0 A;  4E3N A;  5DKK A;  3I7J A;  4NET A;  3V50 A;  1IOU A;  4KZ6 A;  3DAV A;  1IYQ A;  2VGK A;  1L2S A;  2V20 A;  5EVE A;  1W79 A;  4DE3 A;  3W2Z A;  1TEM A;  2Z2M B;  1YQS A;  1G6A A;  4PKY A;  4IVI A;  3HJK A;  1YLW A;  3IQA A;  4PAU A;  1MC0 A;  1G28 A;  2HP5 A;  4NXF A;  1K4F A;  4FTX A;  4HH2 A;  4DDS A;  5G18 A;  5CGX A;  3A3E A;  1YSP A;  4OLG A;  4DE2 A;  3TW8 A;  4OP8 A;  1MKM A;  4JGQ A;  4OP5 A;  1IKI A;  3LY3 A;  2XD1 A;  3HRE A;  2WGI A;  3MS6 A;  1BLP A;  3ICY A;  1CF0 A;  1JTG A;  5TGF A;  1W7F A;  2ZMA A;  1KOU A;  2YKH A;  3S1Y A;  4I3A A;  2K7S A;  4IVK A;  5EVL A;  4P87 A;  3IBJ A;  4L9F A;  1TVF A;  1VB6 A;  2Q0O A;  3MXQ A;  5GL9 A;  4FSF A;  4EWF A;  3IXH A;  4OQI A;  4Q0H A;  1EW0 A;  1IYP A;  3TG9 A;  3NY4 A;  2W1T A;  2GX5 A;  3V3S A;  3JYI A;  3OZH A;  2FFY A;  1SDN A;  2VGL S;  5F6A A;  1Z6F A;  2XQZ A;  4RX3 A;  3MQ0 A;  1ZKJ A;  3B33 A;  1WE4 A;  1DP8 A;  3BW6 A;  2J3W A;  2Y2K A;  1L0E A;  5GHY A;  4EQI A;  5L8M A;  1Y28 A;  4OPZ A;  1P97 A;  3V67 A;  4EQ1 A;  2W3G A;  3TRC A;  3C30 A;  2M1C A;  3KYE A;  4X6T A;  3MR0 A;  3T1X A;  2P7J A;  1BUE A;  1WA9 A;  3IX3 A;  4PM6 A;  3T4Q A;  1SHV A;  3OCL A;  4HI4 A;  4DXB A;  3EGX C;  4KEN B;  3LIB A;  4P6Z S;  2W1T B;  3U2A A;  1LI0 A;  2W27 A;  4O0P A;  3S7P A;  4UEY A;  1MWU A;  3D72 A;  2XFT A;  5L10 A;  3PBQ A;  2JE5 A;  3N8S A;  1OPX A;  1YLY A;  3ZVW A;  4HHD A;  4IBX A;  1SZV A;  2PAV P;  4Z1W A;  2HF6 A;  4I3I A;  1NLY A;  3BEC A;  2ZC6 B;  3OBF A;  1K6S A;  1JVJ A;  2WYX A;  4KZ4 A;  4C75 A;  3BFF A;  1K38 A;  2V0W A;  3VMA A;  2QKP A;  4JXG A;  5AVF A;  4QD4 A;  3QNB A;  3T50 A;  4B4X A;  1C3B A;  3BFE A;  1FIK A;  4LRZ E;  3PBO A;  4WZ5 A;  1GHM A;  4CQH A;  1N9O A;  2IWC A;  2Y2P A;  1PNE A;  3CUE C;  1DJB A;  3PHY A;  1V9Y A;  3ZYT A;  4EBN A;  1ESU A;  1LI9 A;  2J3T D;  3QP5 A;  4QY6 A;  4II7 A;  4R3J A;  5FDH A;  3TOI A;  1HLU P;  3BM6 A;  3CAX A;  5JYO A;  4WMC A;  5CTN A;  3KO6 A;  2PHY A;  3WRT A;  1N4O A;  3GDI A;  5G4Z A;  4Y7P A;  1VEU A;  2ZJ9 A;  3FPV A;  1GA9 A;  3MSH A;  3VP2 A;  2R9X A;  4S2O A;  5FQI A;  3SH9 A;  1Y54 A;  3AGE A;  3GR2 A;  4DMZ A;  3QHY A;  2WAE A;  4IJG A;  3T4J A;  4R3A A;  3LEZ A;  2WKE A;  5J3W A;  4K91 A;  3E2K A;  2JKF A;  5CHM A;  1YPR A;  4Y17 A;  4K0W A;  1IFQ A;  4S2I A;  2R78 A;  4GS9 A;  4LFU A;  2M7U A;  4BD0 A;  5KZH A;  4GOG A;  4UQI S;  3IBR A;  4ZJ2 A;  1H8Z A;  2JKR I;  4E3I A;  4F94 A;  4NEE D;  1RCJ A;  2V0U A;  5E2G A;  2WZX A;  1IYO A;  4OOY A;  5FL3 A;  4OON A;  3CI6 A;  3UPP A;  1S6R A;  1VEU B;  3PR6 A;  5M19 A;  2Q9N A;  1XGI A;  1VET A;  1V9Z A;  3UE6 A;  4DE1 A;  4Y0T A;  3PXP A;  3PTE A;  4MBK A;  5F1F A;  1NYY A;  2ZBB A;  1ERO A;  3FG8 A;  1JWZ A;  3DTE A;  3QP1 A;  4O8G A;  3O88 A;  2K31 A;  1PFL A;  4GS9 B;  4PM8 A;  1MPL A;  3MXS A;  1ESI A;  3SW1 A;  2VKS A;  4JF4 A;  3NIA A;  5HZH A;  4BBV A;  2EX2 A;  1L3L A;  2WGV A;  2XA7 M;  3P09 A;  1OTA A;  1DRM A;  1VET B;  2ZD8 A;  1DJA A;  2FFF B;  2ZM2 A;  4HP4 A;  4DJ2 A;  1OJ5 A;  1F2K A;  3OPL A;  1I5Q A;  2LB9 A;  4QU3 A;  2O0Y A;  1RP5 A;  2V8C A;  2ZM0 A;  3EQU A;  3PYP A;  5FSR A;  1EWZ A;  5CER A;  2PU4 A;  5J8X A;  5FQQ A;  4B9O A;  1S67 L;  1XFN A;  3MKE A;  4LV2 A;  2Y91 A;  2Y2M A;  5E43 A;  2M7V A;  1E3U D;  3N8R A;  4PPR A;  2HP6 A;  3K3D A;  3G6O A;  4WEK A;  1XJ3 A;  1QMF A;  3LYX A;  4NXG A;  1K4E A;  3ZGA B;  1AWI A;  3LR5 A;  5F68 A;  3DTK A;  3T4T A;  3FYZ A;  4BD1 A;  4IED A;  5FI6 A;  4WEL A;  2V1B A;  3IF5 A;  1LT0 A;  1KDS A;  2A24 A;  3PBR A;  2Y2G A;  2MJ6 A;  3G30 A;  3HLB A;  2HPB A;  4JXW A;  1ERM A;  2ZM8 A;  1VM1 A;  1PW1 A;  1OTI A;  4MEZ A;  3CWF A;  3V5M A;  4XXR A;  3IWO A;  4UA7 A;  2INW A;  2ZQ9 A;  2OOL A;  1BSG A;  2JCH A;  3B3X A;  2WKQ A;  2Y2L A;  5EUA A;  3BWL A;  3HJI A;  4JKT A;  5L09 A;  4EUV A;  2KOI A;  3GEC A;  3ZG5 A;  3PAE A;  2PDR A;  4HBT A;  5HL6 A;  1FCO A;  3LI8 A;  3P01 A;  3VV4 A;  1O07 A;  3OOV A;  4OOL A;  5FAT A;  2GJ3 A;  1GHI A;  3UB7 A;  2ZQ8 A;  2PD8 A;  2GNX A;  2QYB A;  5EM1 A;  3E4O A;  3UN7 A;  1FQG A;  3A3F A;  4YIN A;  3V3R A;  2O99 A;  3A3I A;  1PZO A;  3RJU A;  2VLG A;  4CLC C;  3GRJ A;  1L0D A;  2RL3 A;  1K57 C;  2AVX A;  2VGL M;  2PD7 A;  5DFX A;  3TSG A;  2YKF A;  3K2N A;  2B5R A;  5FA7 A;  4KQQ A;  4Y13 A;  4I39 A;  3SS5 A;  4ZAM A;  3CG5 A;  3S22 A;  1E4D A;  2WKI A;  3WS1 A;  2BG1 A;  4JLF A;  4EES A;  2VV6 A;  2A49 A;  4O01 A;  2VV7 A;  4JGP A;  3A3J A;  4E3O A;  5FAQ A;  5KSH A;  5EV0 A;  4LCL A;  1ERQ A;  3HL9 A;  5DKL A;  4LEN A;  2W1R A;  3P98 A;  5KMW A;  4P6Z M;  2QZ6 A;  1NJ4 A;  2OV5 A;  4S2K A;  4MN5 A;  3NOU C;  4N92 A;  1VQQ A;  3EQV A;  1PIO A;  2EWV A;  2EX6 A;  1CEF A;  5A92 A;  3R4K A;  4F3L A;  4EU0 A;  4GB7 A;  4QPR A;  2EXB A;  4K0X A;  4QWO A;  3KSI A;  4KUK A;  3HUM A;  3S4X A;  4K08 A;  4B93 A;  1TF1 A;  3E4Q A;  3RXW A;  4ZRR A;  2HJ9 C;  4ID4 A;  3BFD A;  5F69 A;  2EFU A;  3KSG A;  3BY8 A;  1STZ A;  4IUH A;  3UE0 A;  4B4Z A;  5EVI C;  1TD5 A;  2QJ7 A;  1G68 A;  2X01 A;  4E3J A;  3N4I A;  4C3Q A;  2KX6 A;  4YNR A;  5FDS A;  2UV0 E;  1CI8 A;  4Z9Q A;  4OPY A;  1TDL A;  3SS3 A;  4F3L B;  5HAP A;  4S2J A;  3FZC A;  2PRF A;  3TE8 A;  1WYC A;  4GDB A;  3W8K A;  5IHV A;  2E8I A;  4CLC B;  4E6W A;  1S1Z A;  1K54 A;  1MWR A;  5HAR A;  4R23 A;  4Y2F A;  4N9K A;  3CPT A;  4D60 A;  1ZG6 A;  2PBD P;  4MCW A;  3F1O A;  1GSW A;  3E4P A;  4B88 A;  4FD8 A;  1O7E A;  2XD5 A;  5HDS A;  5M1A A;  3W4P A;  5EOO A;  3WS0 A;  1CK3 A;  3IHB A;  5HPI A;  1LSV A;  1ZC2 A;  1K56 D;  3S7Q A;  4UQI M;  2I9V A;  5EVI A;  1XJ4 A;  3UDX A;  2V1Z A;  2VA0 A;  4OQ0 A;  5EEC A;  2K2N A;  4O7D A;  2JC7 A;  2V1A A;  1XJ2 A;  1BLS A;  1YMS A;  1N9B A;  3N6I A;  4OPQ A;  2ZMF A;  3CPT B;  3OC2 A;  3MFD A;  3R7W A;  2QPN A;  1FR6 A;  4XUZ A;  3AGD A;  2L0W A;  2OLU A;  4X1L A;  5GLB A;  4X53 A;  1T18 A;  1XA7 A;  4X68 A;  4GD8 A;  2JN7 A;  1HZO A;  3OPR A;  3C7V A;  4JBF A;  1BTL A;  1ZHH B;  4MNR A;  4U0T A;  2JBF A;  5EVI B;  4CLC E;  5TBM A;  1IEM A;  5GLC A;  2HDU A;  1S4R A;  5DVA A;  3VOL A;  3IT9 A;  4OKP A;  4WZ5 C;  1BYW A;  4LV3 A;  2H5S A;  5CRF A;  2GDN A;  3F1P A;  4DF6 A;  3PBT A;  4QHC A;  4GCZ A;  3R7W B;  5HSQ A;  3IH9 A;  3ZNT A;  2D02 A;  3MZD A;  2ZOH A;  4UA6 A;  2Z6D A;  4Y5F A;  4HEF A;  2WGW A;  5U47 A;  4HY8 A;  4WBG A;  5IU1 A;  4EEU A;  3A0S A;  3EOI A;  2Y2I A;  3B47 A;  1P9W A;  4JGO A;  1J3W A;  1DY6 A;  3UPO A;  4HIA A;  4YWZ A;  1CQA A;  4Q0I A;  1KGG A;  2ZQA A;  3FKW A;  3F1P B;  1E25 A;  1T19 A;  4KZ8 A;  4ZBE A;  4U3T A;  2Y2J A;  3Q07 A;  5GHZ A;  5FQK A;  4UAA A;  1D1J A;  2HDQ A;  3IS2 A;  5HD5 A;  2Z2L B;  3C7U A;  5AQ9 A;  3G31 A;  1YKD A;  1PWD A;  2WGW B;  3IX8 A;  4IBR A;  2ZLY A;  3MBZ A;  3BFG A;  4RX2 A;  3ZQ5 A;  3N7W A;  4U0X A;  1IYS A;  3BFC A;  3RTY A;  3C2W A;  2JHE A;  2DMW A;  3FWL A;  2J80 A;  5CHU A;  1KGF A;  3MF0 A;  3SOI A;  1ES3 A;  2WZZ A;  1ONG A;  5HL1 A;  2C5W B;  1MZU A;  4G3K A;  1HVB A;  4X25 A;  4ZJ3 A;  5L07 A;  1N9N A;  2ZOI A;  4WLA A;  4GDN A;  3HUN A;  4KZ9 A;  1X0O A;  2QWS A;  3IS2 B;  4GW9 A;  5DJU A;  3G2Z A;  4IUK A;  4DXC A;  1W8Y A;  1MBL A;  3OPP A;  4HJ4 A;  2WAF A;  4OPR A;  4DKI A;  4EET B;  3KX0 X;  3NDG A;  4JXS A;  3SS4 A;  2G2U A;  4S2L A;  5K5B A;  2ACG A;  4KG2 A;  4ME4 A;  4MMN A;  1L0F A;  4NKP A;  5L2F A;  2EX8 A;  4KG6 A;  5F1G A;  1OTE A;  2VK3 A;  1UWP X;  1PWG A;  4GLQ A;  4R4R A;  3U4L P;  1F9I A;  5F82 A;  1YLJ A;  1NY0 A;  3ZG7 B;  4BBT A;  3UMD A;  5EOE A;  1D06 A;  4KZ7 A;  2JKT M;  3H9W A;  3QP2 A;  4QJG A;  3N8L A;  3UY6 A;  1YSQ A;  3G4P A;  1DJC A;  1MKI A;  3EGD C;  4MN6 A;  2HJE A;  1HTZ A;  1FR1 A;  2W3E A;  3OPH A;  2HDS A;  1L0G A;  2R9W A;  1ONH A;  4E3M A;  4BWI A;  2PYR A;  1I2S A;  4RVA A;  2X02 A;  3EEH A;  3NHQ A;  3BQ8 A;  5HFO A;  5HDD A;  4IHQ A;  4N1H A;  3VP3 A;  4X55 A;  4JGR A;  4LCM A;  4YOF A;  1YLT A;  2ZL1 A;  4PM9 A;  4OH0 A;  4OLD A;  4R0Q A;  4KQO A;  3IXG A;  4XT2 A;  5AVE A;  5G4Y A;  4P6B A;  1RGZ A;  3VOZ A;  4EUZ A;  4GKU A;  1LL9 A;  2PYP A;  4GNU A;  2XFS A;  5E2F A;  3VP0 A;  3GVB A;  1ES4 A;  4Y15 A;  4EW7 A;  2Y2N A;  3NEC A;  3ZG9 B;  1MY8 A;  3F1N A;  4R6L A;  1Q2P A;  3S7N A;  2G2W A;  4I5S A;  2HZ5 A;  5FAP A;  1PRQ A;  2EX9 A;  1BLH A;  3ULF A;  1LLB A;  2O9A A;  4BL3 A;  3OCN A;  5J4E A;  3IHA A;  3QP8 A;  4MBF A;  2ZL1 B;  5A91 A;  1K25 A;  1P9R A;  2BTF P;  4UA9 A;  3UDI A;  4XT2 B;  2L1M A;  2XR0 A;  3OLO A;  1BLC A;  1FIL A;  2O9B A;  3EEA A;  3UE3 A;  2RCX A;  4WUJ A;  3CJM A;  2OWH A;  3F1N B;  1SDE A;  1GA0 A;  4UHU A;  3BLS A;  3G32 A;  3T4S A;  3B42 A;  5GLD A;  2EA9 A;  4LGW A;  4PKY G;  1UGU A;  2KLI A;  3VFH A;  1PW8 A;  4E3K A;  5TFQ A;  2BAS A;  3ZG8 B;  1ZG4 A;  1JTD A;  5KIZ A;  3HVF A;  1H5X A;  4WMC D;  4OQH A;  2ZQC A;  1K56 A;  1XPB A;  3HLD A;  3FC7 A;  4DJ3 A;  2A24 B;  1KVM A;  1YLZ A;  4ETX A;  3LGO A;  1TS0 A;  4OVD A;  1GSX A;  2OWJ A;  3TJZ C;  4A5R A;  3Q7Z A;  2V8F A;  4EV4 A;  1CEG A;  1OME A;  5BOH A;  3LIF A;  4ARZ A;  5FEF A;  2V2F F;  2HP9 A;  2XEP A;  1KDW A;  1VHM A;  5EFW A;  2ZQD A;  5FAO A;  2BLS A;  1KE0 A;  3MXR A;  5EE8 A;  1XXM A;  4E6X A;  4R38 A;  3VE3 A;  3CLO A;  3H82 A;  1PI5 A;  2J9P A;  1YMX A;  1D7E A;  1LL8 A;  5F83 A;  1FSY A;  1XA1 A;  3NBL A;  4I38 A;  4EBP A;  1SCW A;  2EXA A;  1TS8 A;  4G3W A;  4WF0 A;  3GQZ A;  4GD6 A;  4MN7 A;  5HAQ A;  4EXO A;  2C6W B;  3LIC A;  4LRX C;  3D4F A;  3IX4 A;  1K54 C;  2HDR A;  5AQA A;  5HWW A;  3QNC A;  4MLL A;  5CHJ A;  5FEG A;  4LPZ A;  3LR3 A;  2Y2O A;  1ACF A;  3CHW P;  1PI4 A;  5FQM A;  1XJ6 A;  1IEL A;  4C6Y A;  4OOM A;  3A3D A;  2IWD A;  2XA7 S;  3LR0 A;  2OSU A;  1T1B A;  1T1A A;  4X56 A;  1M40 A;  4ETZ A;  3MZE A;  3NOP C;  4PM7 A;  4MBH A;  4BBU A;  2PT7 A;  2V9A A;  3IH8 A;  4HNB A;  1NLZ A;  5DTT A;  3S7O A;  2W3D A;  5E2H A;  4KZB A;  4S2P A;  3P7N A;  5HAI A;  4ZJ1 A;  4S2N C;  5DJT A;  4KQD A;  1CJF A;  1FCM A;  3NI9 A;  1G6O A;  1NWZ A;  2KDK A;  3MFX A;  4BLM A;  5J7E A;  3ZFZ A;  3C4O A;  1OT6 A;  3L7H A;  1OTD A;  4FCF A;  3ZCZ A;  4L0L A;  2FH5 A;  2Y59 A;  4PM5 A;  3GSG A;  3C5A A;  3UME A;  5M18 A;  4FUW A;  4M4X A;  3EWK A;  1J9M A;  2ZC4 B;  2VV8 A;  4P85 A;  3G35 A;  4HOI A;  1GCE A;  1XP4 A;  2XF3 A;  5CGS A;  3VE4 A;  4LLO B;  3NDE A;  3C8C A;  3WS2 A;  1NRF A;  5HPF A;  3DW0 A;  3KYQ A;  3UB9 A;  4X69 A;  3LFV A;  4N1X A;  1ZTU A;  4H8R A;  5FQJ A;  1OTB A;  2B18 A;  4JPM A;  2JKR M;  1JWP A;  4H6J A;  2H0T A;  5TJJ A;  5MC7 A;  3ZVT A;  3LEQ A;  1KGE A;  3PBN A;  4S2N A;  3M2J A;  4Y3I A;  2QHK A;  2PR6 A;  1ES5 A;  2ZC5 B;  3SZT A;  2WKH A;  4D2O A;  3F1O B;  4L9G A;  3JVU A;  3NUL A;  5FQ9 A;  2XLN A;  5DF7 A;  3NJA A;  3C38 A;  1S4S A;  1G5U A;  2Y2H A;  3DTM A;  1UWN X;  1A0K A;  1MWT A;  3WRZ A;  1OJG A;  4H6J B;  3T4O A;  2WK0 A;  3T1S A;  3BYD A;  1XFQ A;  2VJW A;  2ZQ7 A;  2OAQ 1;  2XRO A;  5F5Y A;  5KSC A;  5CED A;  4QY5 A;  2OAP 1;  3M6B A;  3T4L A;  4PHT A;  3M2K A;  3E0Y A;  2XH9 A;  3A0R A;  2Y79 A;  1EI5 A;  2DCF A;  4JXV A;  1LL5 A;  3GMW A;  5EPH A;  2G7U A;  2NUT C;  4WL9 A;  1HD8 A;  5CEC A;  4BMW A;  2PBY A;  4HP9 A;  1M6K A;  1H3Q A;  2W0N A;  5TBM B;  1TDG A;  2NUP C;  3LCE A;  4DRT A;  3G34 A;  1PWC A;  4NXE A;  5FAS A;  1AXB A;  1GSV A;  4KUO A;  3ISG A;  3L9K A;  4LRY C;  3BLM A;  2L4R A;  3RXX A;  4DE0 A;  2A2L A;  4FH4 A;  2O9C A;  2VGJ A;  1YT4 A;  3HLC A;  5D3O A;  3UB8 A;  3IF6 C;  1E3U A;  2VEA A;  4JF6 A;  3DTI A;  3GTC A;  4CLC D;  3T12 B;  3C4P A;  3H7W A;  1NYM A;  3BQA A;  3W4Q A;  2Y2Q A;  4RYE A;  1CI9 A;  3Q7V A;  5GLA A;  3UDF A;  2ZMV A;  4HBU A;  4HJ3 A;  1I2W A;  4WZ4 A;  1W63 M;  3LUQ A;  3SH7 A;  3ITA A;  3KSF A;  5AJG A;  2XSS A;  4EBL A;  3CZD A;  3FPW A;  3BRM A;  1NZO A;  5A90 A;  4JF5 A;  3W4O A;  5CGW A;  3NCK A;  3H7W B;  5CTM A;  4KZ3 A;  4QB8 A;  1FOF A;  4P0M A;  1Z09 A;  3NC8 A;  3Q7V B;  1NRJ A;  4GN2 A;  3LO7 A;  2P9V A;  3UB5 P;  3LR4 A; 
#chains in the Genus database with same CATH homology
 4Q0H A;  3EQV A;  1EW0 A;  4WUJ A;  2EWV A;  3O5Y A;  2OWH A;  4G3V A;  3F1N B;  2H28 A;  3R4K A;  1TS6 A;  4F3L A;  4EU0 A;  2W1T A;  2GX5 A;  1N9L A;  2Z6C A;  4QPR A;  3T4S A;  3B42 A;  4L9E A;  2EA9 A;  3KSI A;  4KUK A;  4PKY G;  1UGU A;  2VGL S;  5F6A A;  4K08 A;  1W63 Q;  1F5M A;  4B93 A;  2KLI A;  3MQ0 A;  1TF1 A;  3E4Q A;  3B33 A;  3LIA A;  4ZRR A;  2HJ9 C;  1DP8 A;  3BW6 A;  2J3W A;  5F69 A;  3KSG A;  3BY8 A;  2BAS A;  2IA2 A;  1LSW A;  1STZ A;  1Y28 A;  2PR5 A;  3LI9 A;  4IUH A;  5L8M A;  3NOT C;  1YAX A;  5I5L A;  3MMH A;  1TD5 A;  2QJ7 A;  1P97 A;  3V67 A;  1JNU A;  4EQ1 A;  2W3G A;  5C5K A;  3TRC A;  3C30 A;  2M1C A;  4WN5 A;  5KIZ A;  3MR0 A;  4NXB A;  2P7J A;  2KX6 A;  4YNR A;  1WA9 A;  3CUE A;  3T4Q A;  3OCL A;  5A8B A;  4HI4 A;  3EGX C;  4F3L B;  1DP6 A;  3LIB A;  4P6Z S;  2W1T B;  3FC7 A;  3U2A A;  2W27 A;  5LBR A;  4O0P A;  4EEP A;  3S7P A;  4GJ4 A;  4UEY A;  4DJ3 A;  3TE8 A;  3UB6 A;  2W3F A;  2A24 B;  3D72 A;  3PBQ A;  4ETX A;  4CLC B;  1S1Z A;  1OPX A;  1TS0 A;  4HHD A;  1GSX A;  2OWJ A;  4Y2F A;  4RQ9 A;  3TJZ C;  4Z1W A;  2HGV A;  1H8M A;  1S1Y A;  2HF6 A;  3LIF A;  4ARZ A;  4I3I A;  4MCW A;  1NLY A;  5HWV A;  3F1O A;  1GSW A;  3OBF A;  1S66 L;  3E4P A;  2Y8H A;  5HDS A;  4E04 A;  2V0W A;  2QKP A;  1VHM A;  5EFW A;  5AVF A;  3T50 A;  5DF9 A;  4LRZ E;  2VZW A;  5HPI A;  3PBO A;  1LSV A;  3S7Q A;  4UQI M;  4CQH A;  2I9V A;  1N9O A;  4R38 A;  3VE3 A;  3CLO A;  3H82 A;  1XJ4 A;  2CMN A;  2VA0 A;  2VX8 A;  1D7E A;  2K2N A;  3CUE C;  1LL8 A;  2V1A A;  1XJ2 A;  3PHY A;  1V9Y A;  3ZYT A;  4FOF A;  4HQA A;  2ZMF A;  2J3T D;  4I38 A;  4II7 A;  1TS8 A;  3OC2 A;  5HDC A;  4G3W A;  4WF0 A;  3CAX A;  4MN7 A;  1DP9 A;  3R7W A;  3KO6 A;  2PHY A;  4BJP A;  4EXO A;  3MQQ A;  2L0W A;  3LIC A;  4LRX C;  3GDI A;  1T18 A;  5G4Z A;  3HCY A;  5HWW A;  2JN7 A;  3FPV A;  4LPZ A;  3LR3 A;  1ZHH B;  4DMZ A;  4IJG A;  1XJ6 A;  3T4J A;  4R3A A;  5J3W A;  2B02 A;  4CLC E;  4OOM A;  5TBM A;  5IS1 A;  2XA7 S;  3LR0 A;  1S4R A;  1T1B A;  3VOL A;  1IFQ A;  4GHI A;  2R78 A;  1T1A A;  4GS9 A;  4ETZ A;  3NOP C;  2M7U A;  1BYW A;  3BJN A;  4BBU A;  2PT7 A;  2V9A A;  3F1P A;  3PBT A;  4UQI S;  4HNB A;  3IBR A;  1NLZ A;  4GCZ A;  3R7W B;  2JKR I;  4Q0J A;  5HSQ A;  5IT5 A;  3S7O A;  2D02 A;  4NEE D;  2V0U A;  2W3D A;  3KSH A;  3P7N A;  2WKP A;  5CX7 A;  2ZOH A;  2Z6D A;  4Y5F A;  5FL3 A;  3CI6 A;  3RFB A;  2HV1 A;  3PR6 A;  5DJT A;  4HY8 A;  4EER A;  4KQD A;  1V9Z A;  5IU1 A;  4EEU A;  3A0S A;  3UE6 A;  1G6O A;  3EOI A;  3PBS A;  1NWZ A;  3T4K A;  2KDK A;  3MFX A;  5J7E A;  3B47 A;  1P9W A;  3PXP A;  4JGO A;  3D3O A;  1OT6 A;  1OTD A;  3DBA A;  2ZBB A;  4DN0 A;  3FG8 A;  4L0L A;  2FH5 A;  2XRN A;  4O8G A;  2K31 A;  4HIA A;  3MQO A;  4GHI B;  4YWZ A;  4GS9 B;  4Q0I A;  3UME A;  5HD3 A;  3SW1 A;  4M4X A;  3F1P B;  2VKS A;  3EWK A;  1T19 A;  2GZA A;  2VV8 A;  2QJ5 A;  3IS2 A;  5HZH A;  4HH3 A;  5HD5 A;  4HOI A;  4BBV A;  5HWT A;  1YKD A;  3VE4 A;  4LLO B;  2XA7 M;  1OTA A;  1DRM A;  3C8C A;  5HPF A;  1F98 A;  3ZQ5 A;  3KYQ A;  4R70 A;  3UB9 A;  3RTY A;  3LFV A;  3C2W A;  2JHE A;  1ZTU A;  4HP4 A;  2DMW A;  2JKT I;  1OTB A;  2B18 A;  4DJ2 A;  1OJ5 A;  2J80 A;  4I3J A;  5DFY A;  2JKR M;  2LB9 A;  4H6J A;  4HJ6 A;  5TJJ A;  1P0Z A;  3MF0 A;  5MC7 A;  2O0Y A;  3PBN A;  1MZU A;  4G3K A;  3EQU A;  3PYP A;  4WEJ A;  3JVV A;  4Y3I A;  2P04 A;  2QHK A;  3LID A;  2PR6 A;  1N9N A;  1LSX A;  2ZOI A;  4WLA A;  4ARZ B;  4B9O A;  1S67 L;  3F1O B;  1X0O A;  4L9G A;  3JVU A;  2EWW A;  2QWS A;  2J3T C;  2W3H A;  3IS2 B;  4GW9 A;  5DJU A;  1XFN A;  4IUK A;  3NJA A;  4HJ4 A;  4MDZ A;  4EET B;  3C38 A;  3KX0 X;  1S4S A;  5K5B A;  1UWN X;  2M7V A;  4ME4 A;  4MMN A;  3A0V A;  3K3D A;  3K3C A;  3G6O A;  1OJG A;  1T1C A;  3MJQ A;  4NKP A;  1XJ3 A;  3H82 B;  4WEK A;  4MN5 A;  2P08 A;  1OT9 A;  3LYX A;  1OTE A;  4H6J B;  3T4O A;  3CIT A;  4NXG A;  1UWP X;  1XFQ A;  2VJW A;  4GLQ A;  2OAQ 1;  2XRO A;  5F5Y A;  2LB5 A;  3LR5 A;  5F68 A;  1F9I A;  3LIE A;  3T4T A;  1ODV A;  2OAP 1;  4BBT A;  3UMD A;  4WEL A;  3RH8 B;  1D06 A;  4PHT A;  2V1B A;  3T4L A;  3E0Y A;  3E98 A;  1LT0 A;  2A24 A;  3A0R A;  3PBR A;  2JKT M;  2Y79 A;  2MJ6 A;  3H9W A;  4CLC A;  2WKR A;  1OTI A;  2G7U A;  2NUT C;  3CWF A;  4WL9 A;  3KYZ A;  1YSQ A;  1TS7 A;  4AFI A;  4BMW A;  2INW A;  3EGD C;  4MN6 A;  4HP9 A;  2HJE A;  2OOL A;  1H3Q A;  2W3E A;  2D01 A;  3BY9 A;  2FZ0 A;  2WKQ A;  2W0N A;  5DKK A;  5TBM B;  3BWL A;  3HJI A;  2NUP C;  4EUV A;  1IOU A;  4NXE A;  1GSV A;  4BWI A;  2KOI A;  2PYR A;  3GEC A;  4KUO A;  4LRY C;  2PDR A;  5HL6 A;  3W2Z A;  2L4R A;  2A2L A;  3LI8 A;  3P01 A;  2O9C A;  3EEH A;  3UE3 A;  3NHQ A;  3BQ8 A;  3VV4 A;  3OOV A;  4OOL A;  5HDD A;  3UB8 A;  4IHQ A;  2GJ3 A;  2VEA A;  4PKY A;  3UB7 A;  2PD8 A;  4JGR A;  2GNX A;  2QYB A;  3E4O A;  3HJK A;  4YOF A;  4CLC D;  3H7W A;  4PAU A;  1MC0 A;  4KQO A;  1G28 A;  3BQA A;  4NXF A;  4XT2 A;  2O99 A;  5AVE A;  5G4Y A;  2VLG A;  4CLC C;  2PYP A;  4HH2 A;  2VGL M;  2ZMV A;  2PD7 A;  5DFX A;  4HJ3 A;  1W63 M;  3LUQ A;  4EW7 A;  2YKF A;  3K2N A;  1YSP A;  3F1N A;  3KSF A;  5AJG A;  4R6L A;  3TW8 A;  2XSS A;  4I39 A;  1MKM A;  3FPW A;  4JGQ A;  3S7N A;  4I5S A;  4EES A;  3ICY A;  3ULF A;  2VV6 A;  4O01 A;  2VV7 A;  2O9A A;  4JGP A;  3OCN A;  5J4E A;  5KSH A;  1KOU A;  2YKH A;  4I3A A;  2K7S A;  5DKL A;  3H7W B;  2W1R A;  1P9R A;  4P6Z M;  4XT2 B;  3IBJ A;  4L9F A;  1VB6 A;  2L1M A;  3OLO A;  1NRJ A;  3MXQ A;  2O9B A;  3EEA A;  4FSF A;  3NOU C;  3LR4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...