2WKQA

Structure of a photoactivatable rac1 containing the lov2 c450a mutant
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
317
structure length
317
Chain Sequence
ATTLERIEKNFVITDPRLPDNPIIFASDSFLQLTEYSREEILGRNARFLQGPETDRATVRKIRDAIDNQTEVTVQLINYTKSGKKFWNLFHLQPMRDQKGDVQYFIGVQLDGTEHVRDAAEREGVMLIKKTAENIDEAAKELIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGLEDYDRLRPLSYPQTDVFLICFSLVSPASFHHVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NPH1-1, RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 1
publication title A Genetically Encoded Photoactivatable Rac Controls the Motility of Living Cells.
pubmed doi rcsb
source organism Avena sativa
molecule tags Transferase, cell adhesion
total genus 108
structure length 317
sequence length 317
ec nomenclature
pdb deposition date 2009-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2wkqA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2wkqA02
3NVAA 1R5OA 1T1AA 3C5HA 4BPBA 3BK7A 3WMEA 4I39A 2BM0A 4CRWB 2V8OA 4US1R 1Q1QA 4Q1FA 1N5LA 5CK5A 1VHTA 3K9LA 2WSSD 1KJWA 3B1YA 3VHLB 1F2TB 3LIEA 5H1YA 1KI3A 2IK8A 4JIMA 5CJ2A 4G5GA 3DHWC 4FCVA 4KFTA 4GSYA 5BQ5A 3AVQA 2I3BA 2QTVB 4Z1MD 4C3ZA 4UJ5A 3UK6A 2P5SA 3UWOA 3LFUA 1JPJA 2GZAA 2GK7A 2GTPA 3JZAA 1R5NA 1MO3A 5G3ZA 2WHXA 3ADCA 4DCVA 1G7CA 2ZU0C 5CIQA 3FKSD 4IOMA 1PUJA 1ZM9A 5CDFE 1OFHA 1E69A 1LTQA 2P2LA 3CWFA 1N9NA 1W48A 3QXXA 1E2IA 5C4MA 2ZR9A 3LDAA 2I1VB 4XWKA 3NWJA 2V1XA 3VR1A 4JLPA 3K09C 4P3YA 4DKXA 3CKLA 4IJMA 3MWLA 4HDOB 4A9AA 2WIAA 2PJZA 4XD7D 3EX7C 2VP5A 3N2EA 3QXJA 3CRQA 2UKDA 1GSXA 1R7RA 2QA5A 4NYIR 5FFMA 3CLOA 4RD1A 2XJ9A 2JJ8A 4JKYA 1GNPA 3RAPR 2OBNA 1YZLA 1G9XA 1QHXA 4JVSB 3QXSA 2Y8EA 1AS2A 3VKGA 4HB4A 2FFQA 5E3HA 1F2TA 4E22A 2IXEA 3WY9A 1ONBA 2JDIA 4Q7LA 1DG3A 4I38A 4H1UA 1CU1A 3B9QA 2VV6A 5J40A 1XB2A 4IOKA 3T35A 2BCJQ 2RH5A 1IAQA 4CEHB 2OWJA 4HJ4A 3M6AA 5AJVB 1G4UR 2CMKA 2O0HA 3QF7A 2V0UA 5DYIA 3GLFE 1R0ZA 3D3QA 4LJ8A 2RGCA 4S35A 1T0JB 4D81A 2AWOA 4I3JA 2QGNA 2R78A 2FE4A 3NBYC 4QRHA 2DWOA 2QP3A 2YKGA 4PC7A 1FUUA 2JCSA 4NXBA 4LJYA 4EERA 3F5FA 4OYHA 1ZYUA 5DHFA 2PYPA 4EPWA 2ODEA 4FCTA 1X1RA 4I4LA 2W00A 1P6XA 1VIAA 4ARZB 4F3LB 1RC8A 4BFVA 4HEJA 4A1FA 2D74A 2XNDD 2PJRA 4XOIA 4Z51A 4QNMA 1J2JA 3TQFA 4DLWA 2C8VA 3GLIE 1KHTA 1ZJ6A 1N9LA 2AK2A 3QKRB 3TE6A 3VU9B 4EUNA 5A4JA 2IYWA 3QKUA 3NDBB 2GXUA 3L82B 4W9MC 1NJGA 4FN5A 3OIVA 3C8UA 4MQBA 3T1VA 2FMXA 2Z0MA 3CLVA 4FMDF 1XEXA 3DOFA 5KDDA 3T1TA 3WRXC 1IY0A 4V0LA 4CEHA 4L9GA 1O87A 1A7JA 1RYFA 1FZQA 3BJIC 2CLSA 1NNEA 1KZ7B 121PA 2P5TB 3DMNA 3D8BA 3U6KA 1OH6A 4ESHA 1UDWA 2V7QD 2IX3A 3CH4B 2PEYA 1UDXA 1CRPA 4M1YA 4CT4B 4MYUA 3M0EA 5KOYA 1U90A 1K5GA 1WBDA 1YZNA 4ARZA 4F3LA 2QMUA 4OK3A 1ZVQA 2YYZA 3P7NA 3PYPA 3TIFA 3U3JA 2OUKA 4R7ZA 1S66L 1NN3A 2R65A 1XRJA 2AD1A 4ZDWA 3HJNA 3DVLA 4DSTA 1H8HA 4L8GA 5JMTA 3QKRA 4F38A 3VU9A 4URYR 2CL7X 2OAQ1 2Z4RA 5DSZA 2FSGA 4ZCLA 4BBVA 2JIZD 3EG5A 3WMGA 5FUYA 1A1VA 2R62A 2YINC 1X6VA 2BDTA 2FG5A 3PJRA 2B6HA 4HHDA 1KK1A 3MXQA 1X0OA 5HKKA 1XJ3A 4ACBA 3EC1A 2GETA 4LGMA 4QJ4A 1YR9A 2F3RA 4NCJA 5E7JA 4B44A 2H17A 3RTYA 2FPKA 3LY5A 1W4AA 1XPRA 3QOFA 3KFXA 4RD3A 4I81A 3IHLA 1EFRA 2R6AA 3WYAA 1B23P 3AF0A 1IJEA 2CCKA 2Q0HA 3E2IA 1GKIA 3QPUA 1PV4A 2REOA 2YC4C 1II9A 2WIBA 3KKOA 4PR0A 1NG1A 3BS4A 2XEXA 3EA5A 4P31A 1MV5A 4FMDB 3U7HB 2VP6A 5FTMA 3IGFA 5LB2A 5B30A 3ZGXA 5FBRB 4OHYA 1C1YA 1VYUA 1RRGA 1NIPA 2C2HA 2OFOA 3H1TA 4NDZA 2VF8A 4F93B 1Z83A 2G77B 2Q9AA 4QGHA 4Q66C 1COWA 4NZYA 2VP2A 4LWZA 3U4QA 1G3MA 2BBWA 2ZRNA 2OEPA 2X2EA 2O8DB 1Z2CA 1G291 2I9VA 5FTLA 3KQKA 1YZKA 2BBSA 1X8KA 5H70A 2OOLA 4MKIA 2ZUCA 5SZJA 2A30A 3A1VA 1LF0A 3Q5EA 1CR0A 4QC2A 4XVRA 3AVYA 1XMSA 4GHIA 2ZYTX 2HT6A 5KSYA 1R5BA 2WJJA 3D6TB 2XGJA 1GSWA 3SN6A 1YZUA 2JEOA 3CRW1 5HDCA 4P4UA 2WSSA 1U0HC 4D4MA 1KSJA 3K0CC 4AD8A 3U5ZB 3CPEA 2E87A 2EVWX 5JEDA 4OBEA 2LKDA 5TBMA 1KI4A 1N25A 1QVAA 4KBFA 4HATA 1DARA 2J0UB 4HQAA 3QPWA 1LL8A 4R38A 4Q48A 3THYB 4AWXA 2W0MA 4TT3D 4Q7MB 2ZPTX 3REGA 2VSXA 3QXHA 4ZIRB 4WL9A 2OBLA 2JLUA 4P4SB 3FKSA 4YDSA 1DP9A 1NY5A 5CB6A 5BXQC 4LYAA 1SZPA 2ZI6A 3LLMA 2XSZD 2D06A 3OIYA 4GDFA 1CP2A 5IU1A 2ZBBA 4UXJA 5DISB 1CJMA 4BUJA 4HZUA 1NVVQ 2W0NA 4NYMR 2PBRA 4PAMA 4PQYA 1AZSC 3FFAA 2WKQA 2QAJA 4G3XA 5BYJA 2GVDC 3PIRA 2OXCA 4XD7A 4GW9A 1OFIA 1NN0A 3JVUA 2ZTSA 3GFPA 3IBGA 4R3AA 3QVUA 4OQMA 4AYWA 2JLWA 3VKWA 1IJFA 3Q8XB 4L9WA 1S8FA 1BO6A 2ZUBA 3LICA 5J4EA 5CLLA 4R9UC 5C46F 2ZJ5A 4M2LA 2R2AA 4F4IA 5F69A 2VV8A 4NXGA 4TYNA 2NTYC 2FSFA 5JS7A 2J0UA 1OXUA 4JKIA 5HDDA 1DVRA 2JATA 3E5HA 5FOVA 3THYA 3NC1C 5JWOA 3B82A 1JECA 3ZJYA 4WZBE 1W0KD 2GA8A 5H68A 2IA5A 3DM5A 1DAKA 3BH7A 4POAA 2QM8A 2MSDB 3ZIAD 5L3SB 5CIWA 3LQQA 2V0WA 1H8EA 1U9IC 4JYCA 2ZYWX 2W2VA 2D02A 3ECCA 3C8CA 4RD2A 2QT1A 3BAFA 1R8SA 1A2BA 3DEFA 5ELXA 1VPLA 4TLAA 4B2PA 5GVRA 2W27A 1P60A 1AS3A 2VHTA 5FUWA 5DYGA 4KFUA 3P26A 2BJWA 3PUZA 5K8LA 3X1YA 1Z8FA 1ZNZA 3SQWA 3GEHA 1II8B 2HDNB 3T1OA 4LHYA 4FMBB 2XNDA 4US0R 3CX7A 3AVTA 1PLKA 4NCHA 2OBMA 1SKYE 4FWTA 3EC2A 3EZ7A 5IS1A 4JGPA 3MLEA 5CITA 5JHGB 3KJGA 3IQWA 1ZM4A 3TSZA 3X1XA 4LYFA 1XCMA 3LW7A 2QUZA 1OTEA 1QHNA 1W44A 3AEZA 4A8JA 2NZ8A 1OSNA 3MG9A 1L7VC 1G8PA 1FW6A 4PAOA 1A2KC 1E9AA 2XXAB 3CX6A 4HAWA 4BLOA 2C95A 1P2SA 2HV8A 1HT1E 1Z6XA 4MH0R 4U5XA 3T06B 2OCBA 3K0EA 4BFSA 3QJYA 1P9RA 1Z6AA 2ONKA 4HLUC 5AJXA 5DE3A 4EETB 2CBZA 4HAZA 4I99A 4JT4A 1Z3IX 4URZR 1XPUA 2V7QA 2HLDD 1XJ0A 4EQ6A 1W46A 4F91B 2D62A 4C0SA 4XTCS 2QSZA 2AN9A 1FX0A 3FKQA 1E79D 2ZRKA 3NOTC 2PYRA 1L4UA 5TV2A 3T50A 1NG9A 2FEOA 2LCFA 2YC2C 4KODA 3KJEA 1Z0FA 2FPLA 4KFRA 4L15A 4I1VA 3B1WA 1XFQA 4MUBA 5KNBA 3TMKA 4HB2A 4II7A 2EWVA 5EXPA 2FOLA 2G1KA 4JLBA 3KB2A 1E1RD 3GP8A 3UKDA 1HV8A 4PHGA 2IS4A 1ANKA 3LAWA 2AR7A 1AGRA 1Y63A 2ZSBA 4B6EA 4LBVA 4BFWA 1KYIA 1SHKA 4PKYA 4B48A 1Z5ZA 3WNBA 2PH1A 2C78A 3RS7A 3AP2A 4K8OA 4PZLA 1YJ5A 3RRMA 3BH0A 2GXQA 1E98A 3SC3A 4RD0A 2CXXA 5GVSA 3AVVA 3SHWA 2O8CB 1GWNA 1P2TA 4FCWA 1R0WA 1N6RA 3LXRA 4TTRA 5LB4A 2QSYA 2ZROA 2KB0A 2W83A 1D06A 3W34A 4JBWA 4CVNA 2XXAA 4TYPA 1D2MA 1S4RA 1YRAA 2JJ1D 4EPYA 4BFYA 2P0EA 3ICEA 1GSVA 4DLSA 2IYUA 1KI1A 3RANA 4C0LA 5F9FA 1EFUA 2D3WA 4URXR 1Q1ZA 1I2DA 1UKEA 3SHFA 4KBGA 4PPNA 3B60A 3Q9LA 4IOJA 1ZU4A 4BZPA 3Q7PA 1XMJA 3CNOA 3BB1A 4QG7A 1IXZA 2W6JD 2DPXA 2RB4A 4JGOA 2EQBA 1V9ZA 4XJXA 4WOPA 4R70A 3IIKA 2KE5A 2VP9A 2ZS7A 3LH5A 3SR0A 1E0AA 1NIJA 3SS8A 3BE4A 3A8TA 3BWDD 4DLYA 4HJ3A 3I73A 3F0TA 1XMIA 3IHWA 1US8A 1OXSC 2W6ID 1TU4A 4IDHA 4M9SA 4TWZA 2YKFA 3WNDA 2NO6A 4B3BA 4B73A 4GL2A 2W58A 4QBIA 4TL7A 2H7VA 4V02A 1RRPA 3VR2A 2X2FA 2PHYA 2VSOA 3ZS9A 3LNCA 1AN0A 1MO5A 1UKYA 1G5PA 2F6RA 3MWYW 4YDHB 1ZM2A 4A6XA 5J3WA 1JAHA 1P7CA 4TLDA 5AJWA 1EX7A 4B3CA 2P65A 5HSQA 4D0GA 221PA 2QZ4A 1XD9A 4OK6A 4DSOA 3IS2B 4US2R 4HP9A 1VG1A 2A5GA 3TNFA 1KOFA 2Z6VA 3U3RA 4EAQA 3U7EB 5F98A 5JJKA 2PX3A 3THWB 3AKDA 3CF2A 1KY2A 3WNCA 1LSXA 4LJ9A 1ETUA 1XZPA 3GMTA 2ECKA 4N0DA 3VOLA 2CJWB 3ZVNA 2YVUA 1G3QA 3ASZA 2QHKA 3KUCA 4TMVA 5FTJA 2IHBA 3ADDA 3RS0A 4RKFA 4GMXA 4KLNA 3S1AA 1BMFD 2ZXUA 4MRNA 3RVBA 3BIFA 2F7SA 4V0NA 4TT3A 1D8TA 1UFQA 5AWFC 5KNDA 1Z28A 1BYWA 3UB8A 3FYHA 2G83A 2XITA 4URUR 5F2EA 1OH5A 2H92A 1IBRA 4DCSA 1M8PA 2C5LA 1HURA 1Q22A 1GRNA 1WA9A 3VE4A 1DPFA 2XSZA 1JALA 2XB4A 2V1AA 3GCGA 1MKYA 5EE0A 2BEJA 3KKNA 3UXMA 2DWPA 5IF9A 2NQ2C 3AF4A 3A1WA 2GNOA 4I1OA 3F3YA 4UNSA 5C2JB 1FQKA 2DYKA 1P0ZA 1C9KA 2BHRA 4ZCIA 4NCKA 5EQTA 1E2JA 2ZRGA 4DXAA 2J7PD 3HR8A 4NMMA 2OCAA 4WA7A 4LJ5A 4JLKA 1RRFA 3W5IA 4G5OA 4Q9KA 2EFDB 3LIFA 2YV5A 1D9XA 2IWHA 2ZRHA 3FE2A 3L8ZA 3LBIA 4RQ9A 3VHXA 4B43A 1E9FA 1ZUNB 4AKGA 1XP8A 2RGXA 4GNKA 1G41A 1T19A 5HCIA 1W0KA 4EXOA 1W7AA 1OTAA 2D7CA 3D7MA 5FPKA 1X8JA 2BVNA 3VFDA 5B64A 3P4YA 3ZIAA 5EP3A 4GS9B 1PZNA 2WJIA 4CF7A 1R6BX 2V54A 2A78A 3HYTA 4V0OA 1OTDA 5EP4A 1U8YA 4I1SA 4A4DA 1OTBA 1WMSA 1E3MA 1XTSA 5TVKA 4BLPA 1ZNXA 3RYTC 2IC5A 3GFOA 1U8AA 2GJ8A 4IDOA 1TAGA 3SU8A 3LW8A 3UMRA 4UXIA 3SOPA 2REBA 4DIDA 3KX0X 3NBZC 4JL5A 4Q19A 3EZ9A 3WRYC 1KNXA 3C41J 2QY9A 4W5WA 5JFGA 4DUGD 3CF6R 4TZ0A 4HI0E 621PA 1ZU5A 4Q1AA 1TF5A 5JCZA 1DP8A 1AA9A 2F1RA 1HE8B 2JASA 5GADl 3LWNA 5GJVC 1W4BA 2QPTA 3K0AB 3TBKA 3TR5A 1K6MA 2D2EA 1YVDA 1IN6A 1XXHB 2PCJA 2KJQA 4BZQA 3ZVMA 2KBEA 1F48A 2REXB 4ZPXA 4JLOA 1MR3F 4JVNA 2EFGA 1Q3TA 4IRUB 1EXMA 3SJAA 3KB1A 2YWFA 2NG1A 1N6LA 1XJ4A 4PTLA 2A2ZA 3JVVA 4WW0A 5BYKA 4RZUA 2VQSA 3ETLA 4QFMA 5FOUA 3MD0A 3IPYA 3EWKA 4PSKA 1RE0A 4NKRA 1GNQA 3A4NA 1NSTA 4OI4A 2HLDA 5JI3E 1W36D 2V1UA 4BLSA 2Z6CA 2QRNA 2ZI9A 1KI6A 1DRMA 3F1OA 2QT0A 1NF3A 3E70C 1E79A 5BN5A 2N42A 4TYWA 4Q21A 4M9QA 5DI9A 2IT1A 1AS0A 4LLOB 2C9CA 1CKEA 5DLQC 5G3YA 1ESNA 3P27A 3TR0A 4AY2A 1WF3A 2J0SA 1DG1G 1AIPA 4ABYA 3QBVA 3I8SA 1NMYA 1DO2A 1E1RA 2ZJAA 3AVOA 3P32A 1XWIA 4JLJA 5E4FA 4YMWA 1ZC3A 2ZANA 3DKPA 2V1BA 3Q5DA 3MWJA 5FOWA 2AKAB 4HLCA 2ERYA 1QHHB 3K0AA 3SJBA 3K3DA 2IEZA 3AUYA 3NG1A 2QP4A 2MSCB 5I5LA 3CIOA 1G8FA 4BQSA 1N6IA 2GKSA 3PUWA 2IYYA 4H6JA 4GP6A 3LI9A 3H82A 1OJGA 4OQFA 3RWMB 4BZXA 5DKLA 1XCPA 2JJ1A 4FWIB 3CNLA 2E9SA 4WXPA 3QENA 1KDOA 1GDDA 1TQ2A 3I5XA 2WWFA 4PO8A 1XFNA 3OIUA 3KUDA 5GJBA 1VDZA 4HB0A 4M1KA 4QJ5A 1LV7A 4B71A 4KUOA 2PMKA 4CDGA 3QG1A 1P75A 2JLYA 1J8YF 2QJ5A 4HH2A 4WAUA 4K08A 2W6JA 3ZD6A 4KO8A 1PUIA 4M1OA 5FL7D 4QBGB 4Q1BA 4Q7KA 1E4VA 1LS1A 2O0JA 1XJCA 3I32A 3VNUA 1OHHD 3THXB 4PPGA 1IM2A 2VHJA 3FMIA 2W6IA 1E2MA 3P4XA 2IYLD 5J5CA 2QE7D 4MKGA 1DADA 2RGNC 2VIIA 4Q02A 3CONA 4LRWA 3BB3A 1FQJA 1PJRA 1QHHA 3EPKA 1AZTA 1NBMD 1W4RA 2WAXA 1UEIA 1KKLA 2XNSA 3Q85A 5IT5A 1ZCBA 1GIAA 1X86B 4I1UA 1YZQA 2CHQA 2A24B 3G5UA 4TLCA 5L3VA 1WE2A 1CJUC 2CNWD 1EWRA 4BASA 1XX6A 1NVWQ 3GLGB 2A5YB 1N5IA 1RW4A 1KI2A 3WYGA 4CEIB 5J47A 1E32A 4TTQA 1BMFA 1DBSA 2OWHA 3HYRA 3U44B 1SHZA 4D25A 1G7SA 4UNRA 1S1ZA 3B1XA 1M7BA 2PD7A 4D4JA 2B92A 4C7OB 5CYPA 1OF1A 3RRZA 1KO4A 2W2TA 1U0LA 4BBUA 4JJKA 2GZDA 3DDCA 1WB9A 4UNPA 1QVRA 1QHGA 3E4OA 4RSGA 4E09A 2ZJZA 1W36C 3RRYA 3UANA 4C0BA 2ONJA 1E2PA 4DWJA 1GOTA 1ZIPA 3GJ3A 2XZOA 1JBKA 3A37A 2EWWA 3SW1A 2ZRBA 5EE9A 3EWSA 1JJ7A 2LKCA 3EZ2A 1KSFX 4GCZA 2QWSA 1C4OA 2QORA 4NE2A 4DZZA 5JCPA 3AVPA 2WWYA 4OI0A 1P3JA 1Z0JA 2YWEA 4GOKA 4OI2A 3E4PA 2ZRCA 4PX9A 4GFDA 5EUQB 5G4YA 2DHRA 3EZFA 2J7PA 4MYHA 2OHFA 1LNZA 1NL3A 1BS1A 2FWRA 4KXFB 3PEVA 1NKSA 2XTNA 3ASYA 4DLUA 4LRYC 2WJHA 1J70A 3D31A 2WWWA 1VG8A 5HPYB 4YXWD 1UWPX 3EA0A 4QHYA 4EDHA 4CEIA 1Z2AA 2VH5R 3LRPA 3RRNA 1MRSA 1JAIA 3UG7A 4B6FA 5DHAA 2XZPA 3T61A 1MOZA 4DJTA 3U44A 1IONA 1CS4C 3MRSA 1EW0A 3MMPA 1XZQA 3AQ4A 5BWMA 1GUAA 3OEHD 1W5TA 4M1SA 4XIGS 1IXSB 4DEXA 1P9WA 1KK2A 2G88A 2D01A 2GAOA 2QPOA 2OO7A 5UKDA 3SYKA 4ZDIA 5KNCA 5KTYA 2QAGC 4PQFA 5AUOB 1W36B 1Z07A 2J9RA 2ZE8A 2RGGA 2ZYUX 2FJUA 3O8DA 1HE1C 4JLVA 1E0SA 1M6NA 4LV6A 3K09A 2RGNA 4LZZA 4A36A 5IK2D 3MQOA 1IN5A 4LI0A 3ZLJA 3OIWA 4TSFD 4NXFA 3U3OA 3MJRA 3LXXA 521PA 5SZKB 3GLFB 1GL6A 1K8RA 4DUGA 3IUYA 4URVR 2WOJA 4I3AA 2ZJBA 4RZ3A 1H65A 1U81A 3BC1A 2JLZA 1ESMA 3QEJA 5IHPA 3NEYA 2QQ0A 1KO1A 4R2HA 1T4GA 2M1CA 5HTKA 4LUCA 2F9MA 2FF7A 2ZRIA 3N70A 4Y0AA 2AKYA 1ZMXA 1E0JA 1KJYA 1XJ6A 1KSHA 1F2UB 4AYXA 2TMKA 4DB4A 2A3RA 2FN4A 1EFHA 1G8YA 4UXHA 1BOFA 1KZGB 4LSGA 1MZUA 4M9XA 2EFHB 2BBTA 5C4GB 4XVUA 3L0SA 1BH2A 3H9WA 1DTSA 3CR8A 4Q4AB 2OV2A 3UPUA 1R0YA 4B2LA 4MGKR 5DGXA 1KTVA 3FC7A 2BJVA 3W6NA 2QAGB 2XOKD 1IN7A 2WJGA 4JLDA 4EPRA 3I1FA 3FTQA 2BKEA 3CAXA 5CYOA 4N3NA 1ZM7A 4GT1A 3EPHA 3A6PC 4KUKA 4TTPA 1LB1B 3WMFA 4JJZA 1NN5A 1U0JA 2H57A 1KI8A 5LPNA 3HPQA 4RCZA 3DO6A 2K5UA 4JBXA 3LX5A 2F43B 2GBLC 3VAAA 1YR6A 2GEVA 2EYUA 1E9CA 3J81k 3VQTA 2QTHA 2G9NA 4LV5B 1GM5A 3EWAA 1FTNA 2GESA 1YRBA 4TYYA 2BIFA 3W9YA 4AKIA 1E9SA 1KSGA 5L8VA 4G5RA 3W5JA 2BBOA 1U94A 3A4LA 5CB8A 3PXGA 2ODNA 3MSXA 2V55B 2FEMA 3U6BA 5DJTA 3MQQA 2UVQA 1F2UA 3EZ6A 3QI2A 4JZKA 2HYIC 2QN6A 2XAUA 4KU4A 2GCPA 3B85A 2RGEA 3FMOB 4ZKEA 3RC3A 1YR7A 3CW2A 2JAQA 2VA8A 3QUSA 4MGZR 2KSQA 1ZC4A 5TY0A 2BMFA 4M1MA 1VB6A 3VTKA 4C0KA 2H5EA 4NYJR 1DEKA 4MDFA 4DT1B 4R2IA 3FWYA 4Z1MA 2FFAA 1CXZA 3RSOA 4C2UA 1S4QA 1SXJD 3UB6A 2C04A 2NO9A 3NTUA 3WXMA 4ZDKA 5D3MB 5F3WB 4WIAA 4MGIR 5J4YA 1YR8A 2AFHE 5BN3A 2ZETA 3MUFA 2DFNA 1L2TA 2BCGY 5KO2A 2QRZA 3GECA 4PSVA 1MT0A 3H2YA 5FL7A 4ACAA 2NO7A 2VYFA 3ZZTA 1YE8A 3W6PA 1OHHA 1TS6A 1HYQA 1MH1A 2ZRJA 2ZUDA 3K0FB 2AFIE 2QE7A 3DL0A 3TUZC 5ANRB 1WBBA 2O8EB 1G1MA 2XX3A 4FW9A 2BKUA 4DDVA 5LD2C 3A1SA 2O8DA 3UB7A 2YJTD 4QJ3A 2PZGA 1ODVA 1NBMA 1VG0B 1D6JA 2KBFA 3WYFA 1UBGA 5KU1A 1M7HA 1J7KA 2WOOA 4CYMA 2RAPA 3SE0A 5HZHA 3JZMA 1LS6A 3HU3A 2B7CA 3KZ1E 4RZXA 1KGDA 4JSTA 4P4TA 3U2QA 2DFKB 2CNWA 4M53A 4B9OA 4JL6A 4TMZA 1TQ4A 5AJZA 3DZ8A 4Q01A 2HCJB 3A58B 1T5IA 1N0VC 3GD7A 2ZSEA 2JHEA 4HLDA 1ZCAA 1LVGA 3IBRA 1N5JA 2VRWA 3AM1A 4QNRA 1S0UA 2IBMA 2VEDA 4IXMA 1CJTC 3IEVA 2Q9BA 2WPDD 5KDOA 1SVSA 4ZIRA 3MAAC 3C5CA 3RC8A 4P4SA 2F3TA 3KTAB 3UATA 4B3GA 3DOEA 2GBLA 3FHOA 1P62B 5B58C 1P97A 3MJQA 2C03A 3TAHA 4D0LB 1TPZA 1S96A 1RPZA 2NPFA 2O8BB 2BMDA 2VHQA 3BFVA 3EXAA 4TMWA 1RRCA 4G01B 2GAAA 2FSIA 1MO6A 3CO5A 1E2GA 4ZI2A 1G16A 2HF8A 3AGPA 4JVMA 5KSZA 5EP2A 1IN4A 2DCUA 1OIWA 4L9FA 1OFUX 1UKVY 1TUEA 1U2RA 4W5HA 3PEUA 2V6IA 4JLNA 3HP1A 1EK0A 1XTJA 3K0CA 2GXAA 2J0VA 1AJEA 5JSZB 1N3BA 2ANCA 2FFHA 1P2VA 3RS4A 4QBHA 4LX0A 2G0NA 2V4ZA 3CZPA 5TXGA 1X3SA 5JWRA 4YXWA 2EU8A 2C9YA 5HDSA 3G82C 3T12A 1MO4A 2OILA 1VECA 5FUXA 3THOA 4TYQA 4IKEA 1JR3D 5G4ZA 4IVQA 3L2OB 3SYNA 4TMTA 3VR6A 4CT5A 4QGFA 2YWHA 4KVAA 4QGGA 4IDNA 4DLZA 1E9BA 3SDZA 1OJLA 4J0QA 5AVEA 3OESA 1ZRHA 2RCNA 1OFTA 1GITA 3OHMA 1NN1A 3ZYCA 5L3SA 1OIVA 4Q18A 3RABA 1KOUA 5B57C 2QTFA 4G5SA 3EIEA 2OSBA 3BGWA 1SXJC 1TS8A 4WN5A 2P6NA 3NXSA 2JLSA 4MN5A 4PZYA 1E94E 2RHMA 4GOJA 3REFA 1T1BA 3ZQ5A 1KDTA 5IK2A 3O8CA 2BMEA 2QBYB 1TQDA 4L4UA 2F9LA 4KQDA 3NJAA 1EGAA 4TSFA 3V9PA 3IO5A 1J99A 3IILA 1UJ2A 5HE8A 2PDRA 1Z0AA 2H28A 1ZM3A 2QMHA 4LHZA 3W3ZB 1II8A 4Q4JB 1DAGA 1WDTA 4MRPA 3K70D 2ZOHA 3NOPC 1YZTA 4GZLA 3QKTA 2IS1A 2VV7A 3B1ZA 4PHHA 2GWHA 1YZGA 4NYIQ 4TL8A 1G8GA 1LSWA 4HAXA 4URWR 5EE5B 4AYTA 4MRVA 1RJ9B 1UBEA 3NBXX 2JIZA 3ZS8A 4BLRA 5JSZA 2QJ7A 1Z6YA 5FOTA 5FTNA 1DAIA 4DCNA 4BFZA 4EPXA 2BM1A 1QRAA 2NZJA 3I4LA 2QENA 3KQUA 2O8FB 4HB3A 1SQ5A 3QNUA 1A4RA 1F5NA 2A7QA 1K5DA 1XD2B 3FPAA 4FMCF 4ILEA 3U3KA 721PA 2J46A 5D3QA 4OHZA 4PO1A 1UM8A 1E2KA 1CTQA 4IEIA 4BE7B 1SKYB 5GJWC 2G0TA 2KDKA 2FFBA 2PEZA 3I5YA 1YHNA 5GJCA 1FFHA 5JLJA 2N46A 1U9IA 1P73A 2W0SA 2IXGA 5FOXA 2GHIA 3GJ0A 3FGNA 4O2RA 4YMVA 2NMVA 5L3RA 1M34E 1SXJB 2XOKA 1TS7A 1KAOA 3NEJA 2NGRA 3PUXA 4RFSB 1N6NA 2ZSAA 4CEJB 3RNLA 5DO9A 1Q12A 4YWZA 4HDCA 3CNNA 1KDRA 2QBYA 2FSHA 4P33A 1N9OA 1CR4A 2RMKA 2OLJA 3O47A 2IYTA 3AVUA 2GCNA 1T18A 2WJYA 2FGJA 4KYIB 2C96A 5FPYA 4C0JA 3VX4A 5TB5A 5HZKA 2R6CA 4Z8YA 5KHOC 4MKHA 4LHXA 2AK3A 4BGDA 1V9YA 2OT3B 1NLZA 1XEWX 3NIBA 1XPOA 1J90A 3AKCA 2EYQA 4OJQA 4BECA 1GRQA 3ULFA 1KK3A 3IIMA 3UMEA 4F92B 3LIAA 1OB2A 5HD3A 4KFSA 1S3SA 2H1LA 3CX8A 5BW8A 2H18A 2WAYA 1XTKA 4IFBA 1WP9A 4TLBA 2WTUA 2O8CA 3WHKA 2VSFA 1GRRA 1UPTA 4GBMA 2QU8A 5L3QB 4HJ6A 5JJLA 3F8TA 5AJYA 3LQRA 2C98A 1BYIA 4GI7A 1QDEA 4LRXC 2WMOB 3QVVA 1V43A 4NU0A 1NKTA 4DIEA 4MITA 3TAUA 1AQYA 3B5JA 4HLUA 3TK1A 2JLRA 2PX0A 4ZKDA 1ZBDA 4XSHA 1SXJA 2Q6TA 3SZRA 4DVGA 2F1JA 3AKYA 4RFSA 2QL6A 3QF4B 4QHSA 4A0GA 4FMCB 3RLFA 4C30A 1ZD1A 2WWIA 3O8RA 4TL6A 4A0RA 5JECA 4XWOA 5DNYB 3BWLA 2SHKA 3K1JA 5DI3B 2X1VA 4DB2A 4BRUA 1L8QA 1LSVA 1IY2A 4EPVA 1E9EA 1TF2A 4F7WA 3IPXA 1G3RA 2J5XA 4R6LA 3K9NA 2YWGA 2PLFA 5FR1A 1UBCA 4M9ZA 1E1QD 1F98A 1NI3A 4A0HA 2QGZA 2IHYA 3EIQA 3L0PA 3UG6A 4B2IA 1ZNYA 4LOAA 3SBDA 2ZVPX 3IS2A 3SFZA 4DDWA 4LJAA 4BEBA 3IKJA 4MGYR 1EWQA 4OHWA 3B13B 1QHYA 1XTRA 3K70C 1VYVA 4JSYA 2CLDX 1G7TA 4TZ6A 1P9NA 2L0XA 4V0MA 4HUQB 3THWA 3BB4A 3BH6A 1XEWY 2WICA 2VO1A 3AF2A 2P67A 1WRBA 2CJWA 2ZREA 2OCYC 2Z4SA 3LO5A 3TVTA 2ZITA 1HA3A 1Z0DA 3NH9A 3QEOA 1AM4D 1U8ZA 5K8IA 2ZM5A 3PV0A 1A82A 5HWVA 3EAQA 1CIPA 1OT3A 2KI5A 1QHSA 2FU5C 3CH5A 4EFNA 5H8WA 1F3OA 3I3SR 2HJGA 3QF4A 4EPTA 4LY6A 2WPDA 1GL7A 2CCJA 3HWSA 5LBIA 4C0HA 4IFEA 1KO8A 4MDEA 1FL9A 1VMAA 5DI3A 3ND8A 1KAGA 4OL0A 4MKFA 3LD9A 2ERXA 3DMDA 5EZ6B 4B35A 1DELA 1OIXA 1J8MF 5FPHA 3SI7A 3FHTA 1W1WA 4OQNA 2F55A 2OM2A 4IXNA 4AK9A 3AGQA 4YONB 5JZVA 4NTZA 1SVWA 2X77A 2E1RA 3Q72A 3R20A 4YMTA 4UQOA 5J4KA 3HR7A 3K70B 4E07A 2BASA 1MABB 1ZNWA 3FHCB 1FUKA 3NH6A 4KSCA 1KY3A 2VF7A 3RDPA 4XT2B 1OE0A 3BOSA 2J1LA 3K8YA 1BYUA 1S3GA 3HU2A 3H86A 2ZSDA 5JBQA 1XU4A 3GLHB 2J7KA 3QPVA 3FMPB 3E1SA 1AKYA 2OFXA 2XTZA 1JQLB 2IYZA 2XJ4A 4CW7A 4I3IA 4D26A 1NVVR 2MSEB 4MYTA 1JR3A 3EARA 5C18A 3R8FA 1G17A 2EFEB 4OKSA 4ZO4A 4LCBA 2V9PA 5JS8A 2IYXA 1OPXA 1G4AE 1XMVA 1Q21A 4F4JA 1G6OA 4O2LA 4B75A 2JGNA 2A5FA 4GS9A 4RJLA 1VKJA 3A1TA 4RKEA 4UNNA 4OHXA 3SEAA 2ORIA 4A92A 4NXEA 3HDTA 1CBUA 2FNAA 4TQ9A 3MJHA 1FP6A 3QG5A 4LJ4A 4NP6A 4NYMQ 4AC9A 3L43A 4A2PA 2FGKA 5E7IA 1NWZA 1OV4A 3AF3A 3ND9A 3F1PB 5DIFA 2H8KA 2FH5B 2BWJA 1G64A 2LWIA 4L5BA 4L9EA 2CEAA 1P72A 4GOXA 2JLVA 4M1TA 2O0KA 4TN1A 1UEJA 3TW4A 3EEHA 1KJZA 2HYDA 4LYJA 4C9BA 2IF2A 2IS2A 4R98A 3CPJB 5P21A 1S9DA 3WP1B 4ZV4A 1PLLA 1SVIA 1XXHA 2D4HA 4LPKA 2P7JA 3C4JA 4KLZA 2YOHA 3V4RA 1YQTA 4Q9LA 2GILA 1ODFA 1Z06A 4C0AC 3TH5A 1D5CA 4M4SA 1AQUA 2VHUA 3U3MA 1XTIA 4KYUA 3BY8A 4LK2A 4AG5A 2GZHA 3HU1A 2ATXA 1T3SA 1EFCA 4PHTA 2QROA 2GJ9A 4PPFA 3GLGE 3WHLA 4A2QA 1HEIA 1XTQA 4OJKA 3PEYA 3RS5A 5EXTA 2WSMA 3HJKA 2DR3A 2ZSFA 1Y3AA 3NKVA 1A5TA 4Q1DA 2OE2A 3TJZA 4MRSA 1YU9A 1NSFA 1XF9A 2ZS8A 2HXSA 4PZZA 5FTKA 4BRWA 4RY2A 3K3CA 5EUMA 2J87A 3KXIA 1CULC 3RH8B 2P3SA 5KPDA 2C9OA 4LJ7A 3A1UA 1ZW6A 2FX3A 3TSWA 2BEKA 1O3YA 1G7RA 5HWWA 3F1PA 3DZDA 1S1MA 4QOSA 3T1QA 3TQCA 3VMFA 1OLOA 2Z6DA 3PUVA 3K0SA 1G3UA 1KNQA 2PR6A 4KSBA 2G6BA 1W0JD 4BFXA 1ZD9A 3AV0B 5FPTA 1E0KA 5TDHA 2ZRFA 5E7MA 4Q4HB 2CLCX 2OAP1 421PA 4WF0A 1G18A 1II0A 4TQAA 2VL7A 2B8TA 3LYXA 1T8UA 3ZZUA 1Y28A 3G6OA 1G19A 4C4PA 3EPLA 2XTMA 4XTRA 1NP6A 2X8AA 3W8RA 5SZIA 1IQPA 2CL0X 4YC7A 5FBWB 3UWKA 4A6PA 1RYHA 2ZAMA 2WWGA 4LBZA 4Q00A 2GK6A 4KJZA 1E2NA 4P32A 1E9RA 4NHOA 4PC2A 4AKEA 1G20E 4LBWA 3NHQA 3QQ5A 3I72A 3MCAA 2WWXA 2L4RA 2ZJ2A 2N1BA 3GJXC 4IVPA 1OXTA 3K9HA 1SVOA 1OT6A 4C0QC 1M7GA 2PZFA 3Q3JB 2ZRMA 2B02A 3HJIA 1VYTA 2IYSA 5EXSA 3W6OA 4EFMA 3QBTA 4ZDJA 3TRFA 2BC9A 4HSEA 4MRRA 4Q5IA 4DLRA 1Q44A 3R9XA 4DJ2A 3THXA 4BBTA 3ZZ0A 3PENA 3FMFA 1WA5A 4HI4A 1EFTA 3N5CA 1ZUHA 2I4IA 3LX8A 5K8UA 1XEXB 5FUVA 1E1QA 3CZQA 2CL6X 1TL7C 1N0WA 2F1HA 4Q4HA 1HUQA 3I92A 3X1ZA 2WKPA 1SVLA 1OH8A 3AB3A 2Q3MA 3HPRA 2OXRA 2R8RA 3BD9A 4Q9JA 4M4XA 1H8ED 3GJ6A 3ZVLA 1FPMA 3BBPA 2A24A 5AVFA 1P2UA 2XB2A 5FPSA 3H7WB 1TNDA 3AVXA 1N6PA 1T0HB 1CLUA 1Z6TA 3GLGA 4HY8A 4JGRA 4JVLA 5AR1A 2PD8A 3MFXA 4YLGA 1Z0IA 4K81B 2WKRA 1F60A 3PCRB 4IHQA 1RKBA 3ADKA 5JRZA 2CE7A 2B8WA 1R8QA 2IYQA 1AK2A 2HUPA 4N1AA 1Z29A 5KSOA 1LF5A 3OE7D 1IY1A 4QL3A 4DSNA 3GEEA 3T34A 3ZQJA 3U7GA 4C7OA 3VE3A 3KQLA 1B0UA 3E4QA 4NCNA 5DN6D 3G0HA 2NIPA 5SZHB 1X8LA 2ODWA 4DBLC 3AH8A 5CM8B 3WP0A 1UGUA 1NRJB 4HLQB 2ZIAA 1OJ5A 2OG2A 3H4MA 4FI3C 2CHVA 4PAQA 2GRJA 4B74A 1EX6A 4FXPA 4LV8B 3DPUA 2AXPA 3TKLA 2HCBA 1QG2A 3VR5A 1JQJC 1LW7A 2ZJYA 5JHHB 3M1IA 5CDFA 2GEUA 4WBSA 4DC9A 4KCGA 1TU3A 3CWZA 3BFKA 3CWQA 2PT7A 3KX2A 3OLOA 4ON9A 4PKYG 5FR2A 3V4FA 4CIDA 3VKHA 4HOIA 3RHFA 1GVNB 1GZSA 3H7WA 4YQFA 2J59A 3RS2A 4KVGA 1NBME 1W5SA 3SJCA 3OFND 4EFLA 2EW1A 4CZ2A 2Q9CA 1DO0A 2IL1A 4B3DA 3O8BA 1G5TA 2FV8A 1T91A 3AKEA 4Q4LA 3I61A 3CUEF 3GLIB 2WZQA 1TF7A 4EEPA 2JLQA 4KI0A 3KDSE 1NVXQ 3L8YA 3U4QB 4HAUA 3SQXA 4H1VA 4PC6A 4KV9A 1GNRA 2VEAA 1NVUQ 1W2HA 5KPJA 4MUAA 3TSOA 3UMSA 1CEEA 2ZE5A 3FFBA 1N6OA 3AUXA 1XD8A 4GHIB 1E96A 5G40A 4FD2A 4U02A 2BMJA 1CR2A 1N6HA 1TUIA 4WZAE 1Q1EA 1LT0A 1JI0A 2B21A 2VBCA 3C16C 1XFAA 4LPSA 4BFUA 4Q7JB 3FDIA 4EW7A 3VR3A 4AI6A 2YNMA 3GLFA 2HXYA 2OCPA 5TBMB 5FL3A 3BFXA 5EXXA 5AUQA 4EJSC 5HWTA 1PLJA 1E6CA 1S2MA 1UKZA 1BKDR 1M1YE 5F6AA 1G21E 3SYLA 1VG9B 3KJIA 2J3EA 4NCIA 5FBVB 4RD6A 1FMLA 1P5ZB 4GMDA 5EE3A 1WQ1R 4B32A 1E2DA 1S1YA 4XSGA 2OESA 4LC1A 1FNMA 1TEXA 3GJ7A 4HZUB 5KUTA 1M2OB 4Q4AA 3GLIA 1FNNA 1VCOA 2JJ2D 2IW3A 3KXKA 4IDPA 2NO0A 2CMNA 1CJKC 2ANBA 5JRJA 3OAAD 2JA1A 5HD5A 2QAGA 2PL3A 4QXAA 1KO5A 2ZVQX 4RFVA 2K7SA 5CJPA 3WBJA 4X8LA 4HUTA 4N0EA 2NOAA 1OW3B 4YMSA 4BEJA 3AP3A 3D72A 1GFIA 4AURA 2AL7A 2ORWA 2RKOA 3C7KA 1OKKD 2RGBA 3GPLA 3CPHA 4ERNA 3X1WA 2HEIA 2ORVA 4M22A 4NONA 3KXLA 4PQRA 4QKQA 1OTIA 2F43A 2FPMA 1D2NA 2QNRA 2ZQ5A 2QP9X 4PC3A 2ZRDA 3LV8A 4EJSB 1W49A 5JEEA 1QZXA 2INWA 4E5UA 2R44A 2IWRA 1ZP6A 2PMDA 1G28A 4TLEA 5FBLB 2BOVA 3CR7A 4PFSA 4A8JC 4DLVA 1KMHB 1U98A 3TGPA 2ZRPA 1W0JA 1KI7A 1T3LA 1HTWA 5EJEA 3V00A 2L1MA 4ASUD 1UWNX 4M21A 1Z47A 4O3MA 1F6BA 1FOEB 5KIZA 1T5LA 1V5WA 1GAJA 3B2EA 4TMKA 1SVKA 3RSLA 4U7DA 3PEWA 4AKHA 1HQCA 1UBFA 2ZJOA 3SFVA 4GPTA 2IS6A 3AVWA 4ITRC 3NHBA 3W8NA 1GILA 3TVDA 4M1WA 2B7BA 5HCNA 4Q9IA 4OQXA 2WM9B 2ATVA 2G3YA 2ZRLA 4IOLA 4JL8A 4QGAA 3CRRA 4DT1A 1GP2A 2KWIA 2ZI7A 3EIHA 3NBFA 5HR5A 1Q20A 2CCGA 1ZINA 2GF9A 3OZXA 2PCLA 2CVHA 5M04A 4MN6A 2OFWA 1VTKA 5D3MA 1E99A 5CLQA 5CM9C 2ODBA 4FINA 3TUJC 2HT1A 3ONWA 4BWYA 2QKPA 4TMXA 5F5YA 3B33A 1N5KA 3LUQA 6Q21A 1EESA 3ICQB 2DFLA 2IUSA 3K0FA 1NY6A 1HQYE 4EJSA 2GJKA 2VP0A 1Z6GA 2GJ3A 2UZIR 3Q7QA 1SKQA 1R10A 4HYYA 4M0LA 4A8JB 2D2FA 5LD2B 2PZEA 2O8EA 1KMHA 5FBQB 2GJSA 1JEDA 4U00A 3ICYA 2ZE6A 2IUUA 1W4CA 5LDDC 1OYWA 4Y0VA 2EA9A 4IVRA 2V6JA 4X8HA 3AP1A 3KKPA 1KDPA 3LIBA 4NH0A 4DHEA 2GEDA 2X19A 4EQ6B 4JBYA 1UF9A 3KQNA 3MFYA 3R7WB 1FX0B 1OH7A 3I62A 3N2IA 1XCGB 3BRWD 1YKSA 1DE0A 3A0RA 1GG2A 3QY0A 1Q3HA 3FB4A 2J0QA 3I8XA 2A5JA 3BXZA 5A5GA 1FTSA 3EASA 1I4DD 1E9DA 2Z5FA 4L16A 2V3CC 1TEVA 1JR6A 3DKVA 3OEHA 1JNUA 1CRQA 3OE7A 4OHVA 3LA6A 4PXAA 4AIIA 1DAHA 1T3HA 2ZI3A 4A82A 1T1CA 3A0SA 3UIEA 1GKUB 2PLRA 3KTAA 5DN6A 2W2XA 3B1VA 3IEUA 5K8TA 1ZD8A 3GFTA 4W7SA 4XVQA 2IYRA 2R9VA 1SXJE 2GCOB 2ZAOA 4RZ2A 2C77A 4AG6A 1T8TA 4LHVA 2OZEA 3KQHA 2XZLA 2O8BA 5DKKA 3NOUC 4XH9B 1R4AA 2GDJA 3TW8B 4BLQA 1IHUA 5B2ZA 1XBTA 4V03A 4GP7A 4X8MA 2QM7A 2JLXA 5FI1B 5IDVA 4KAXA 1GL9B 2IYVA 4EESA 3K53A 4Z54A 2IF0A 4GZMA 1NJFA 3ZDQA 4LBYA 2DFTA 4Q1EA 1HY3A 4JLMA 4Q03A 5KYKA 4DLTA 3R9WA 4B47A 4JGQA 3PG5A 4RVCA 4Z8XA 2CK3D 2ZI4A 3NDPA 3P20A 4RD4A 4WVFA 5E95A 5EZ5A 3SBEA 4G5QA 2ZJ8A 3R7WA 2D7DA 3IIJA 4L9SA 2QI9C 4GRAA 2R6GA 2A9KA 2RHDA 5EFWA 2I1QA 4O25A 5TMPA 3OFNA 1TTTA 1OB5A 2FDCA 1S1CA 3OEED 8OHMA 4RCYA 1E2EA 2NO1A 1G6HA 4X8OA 4V0ME 3GDIA 1US8B 2R6DA 1L4YA 2GJAA 3A36A 4D0NA 4TQUS 4B76A 1QF9A 1T9HA 2QMEA 2DY1A 2WV9A 4Q1CA 3A4MA 4KITB 1N6KA 3X1DA 1MRNA 3W3AA 4ZCMA 4D4LA 2YKHA 1E2QA 3FVQA 2J80A 2AWNA 1D7EA 1AKEA 2GCOA 1KO7A 4TL9A 2VHCA 1P4SA 3IQXA 3KKMA 2P6RA 1DAFA 4FIDA 4QM7A 4NBSA 1JXOA 1E2HA 2GVZC 4ESVA 4JYBA 4Q4JA 3UMFA 2UZ3A 1OYYA 1VCNA 5JWHA 5AUPB 2P6UA 4E03A 3NC0C 1UADA 3S1AB 2Z43A 1KK0A 4JS0A 1Q0UA 3P1JA 4DCUA 2AHOA 3CB4A 2QEQA 4MYCA 4D80A 2C99A 1Q1BA 1RJ9A 4PSAA 4UNQA 4DSUA 4B34A 3PFIA 1DS6A 1HT2E 3KFVA 1ZIOA 2MMGA 3AF1A 4A0FA 2ZYVX 5FH9A 1TQ6A 4DEYA 3ZD7A 3LBNA 2O8FA 2WMNB 1I2MA 2AXNA 1XD2A 1T6NA 3BERA 3T5GA 4EEUA 4V0KA 1S9HA 2F1IA 2NPIA 2ZU6A 3H0KA 2HV1A 1HH4A 5FI0B 5F68A 3BY9A 1QHIA 2JJ2A 5IRCD 1KI9A 3K9GA 2WVJA 3L0IB 4OK5A 1GSIA 1D9ZA 4PC1A 3CM0A 5FOSA 5C1BA 4G1UC 3OAAA 4NL4H 4H9GA 4B3FX 2ZE7A 2VPPA 3B78A 4E04A 1JNYA 1DOAA 1X1SA 3BORA 2YOGA 3T15A 1M74A 1JR3E 1UAAA 4CEJA 3MR0A 3FG8A 2H16A 4EIWA 2DBYA 1D2EA 4WXRA 1OKKA 3PQCA 2ZI5A 4BFTA 2QPAA 4NPHA 1NMXA 4JLAA 2FZLA 3R9IA 5AK0A 4B3XA 2VLGA 4KHZA 4BLTA 2HJVA 4YMUA 5BN4A 2HF9A 4HDQB 2QMOA 1XNJA 2IEYA 4DJ3A 3LVRE 2JDID 3ADBA 1CR1A 1RIFA 5F9HA 1JEEA 2YOFA 3B8HA 2Q3HA 1AGPA 3PITA 1XEFA 4G0NA 3B6EA 4D2IA 3WBKA 5J4VA 1TX4B 5CK4A 3RS3A 1OXVA 2R6FA 1WCV1 3B9PA 1TS0A 1G5RA 5G41A 4ASUA 5JI2E 3C2WA 2J41A 4WZ6A 3SJZA 1DAMA 2DWQA 4CGZA 2YHSA 4HNBA 5TARA 4HP4A 1N0UA 2CE2X 2V9AA 3CRVA 5KSPA 4C2TA 3VR4A 3SNHA 2Q3FA 4A2WA 4R71A 3NHAA 3U60B 2VP4A 5L3QA 4LDJA 5G53C 3UE6A 2DB3A 3LLUA 1PVOA 3LVQE 1Z08A 2ZOIA 3GJ8A 4XWAA 4O0MA 3B7GA 3GLHE 3C14C 5EP1A 3GQBA 5J7EA 1ZUIA 3KL4A 2CDNA 1XJQA 3H84A 4OI1A 1XXHE 4JMPA 4B33A 3U61B 3LI8A 1Q57A 4HZIA 3TLXA 4DRZA 2FA9A 4M8NE 1NMZA 1CJVC 1VHLA 2IUTA 1JJVA 2OLKA 3PR1A 5J4LA 4W5JA 2GXSA 3FOZA 4IW3B 4D6PA 1G3IA 1FP7A 3QXCA 3KJHA 3ZH9B 1Z0KA 3M4YA 4PPQA 2QG6A 4Q47A 1LY1A 4I5SA 2PT5A 2WWHA 1FMJA 3PUYA 4LC0A 1U99A 2ZS9A 1E2LA 3L0OA 2Q21A 2BV3A 2J45A 2AD5A 3DM9B 3T5DA 3W90A 2RGDA 4IDQA 4S2EA 1VCIA 2FZ4A 1R0XA 3CBQA 1I4LD 3LBHA 2KX6A 3F1NB 1LFDB 3LIDA 3UMDA 1TADA 4Q9HA 3GJ4A 4HUQA 1SULA 3VNVA 2ASEA 4LYHA 1SGWA 1DAEA 1KI6B 3F1OB 2QQEA 3EW9A 3CF0A 4EQ1A 3IBYA 4HAYA 5A8BA 2RGAA 3TUIC 3EPJA 4F4CA 2ZR0A 2L0WA 1CF4A 1KMQA 4WUJA 4OQLA 5A0FA 1WXQA 1BIFA 3QKSB 1GKYA 3PVSA 1QBKC 3C15C 4NYJQ 5HE9A 821PA 4WLAA 1G8HA 1Z63A 3KKQA 4LRZE 4PO9A 5J4HA 1EG7A 4DDTA 1R2QA 1RVDA 1ZAKA 2WJVA 4QBFA 1H8HD 3A0VA 4LPZA 1IOZA 1W47A 2G1JA 4IEEA 4EKDA 2AX4A 1RZ3A 1XJ2A 2Z83A 5DH9A 4D4KA 4JT2A 2EFCB 5JJIA 3VX3A 4P0TA 5KDLA 3MWKA 4DCTA 5AUNB 1W2GA 3GJ5A 4DLXA 4ZI3A 4QHTA 5HKKD 5DJUA 3QIAA 3IDQA 1IN8A 1E2FA 4H6JB 1JPNA 3H82B 1RFLA 1VCMA 1S67L 2O52A 2VLIA 1TMKA 1XDBA 2MMCA 2ZR7A 4HAVA 1F9IA 5EE1A 3QSYA 2PR5A 3UB9A 4K46A 1EFRD 1P61B 4MA4A 4LJ6A 3F1NA 4A15A 1DP6A 1ELOA 1MABA 1JXMA 3CRMA 2CK3A 4XT2A 1KIMA 3X2SA 1NLYA 4HIAA 4UJ3A 3GLHA 3IO3A 3MGCA 4PANA 2O5VA 1OT9A 1Z22A 2A5DA 2VTKA 3ZQ6A 3PHYA 1JB1A 4QM6A 2ZRAA 2IXFA 3RWOA 3GEIA 4HH3A 3OEEA 4PHFA 2WBLC 1GTVA 3QKSA 1KKMA 3U7FB 2YZ2A 4D82A 3OF5A 1S4SA 3ZVRA 4LHWA 4DDUA 1COWD 3QE0A 1NLFA 4UKDA 2CHGA 1I4TD 2GF0A 2JN7A 1IXRC 1QG4A 1VIYA 2CVFA 1E4YA 1N2CE 2ZEJA 1OXXK 1SVMA 3R8CA
chains in the Genus database with same CATH superfamily
3NVAA 1T1AA 4B7CA 3NM5A 4TUYF 2G6TA 5C8ZA 4AUMA 1MF7A 1KI3A 1CF2O 4G5GA 4FCVA 1W93A 2E2WA 2X7XA 3FSGD 4V3CA 3PIIA 4Y9UA 4HYTA 2G9RA 4PONA 3U80A 1JPVA 3QW4B 5A7HA 2JGKA 7YASA 5DBIA 3I5UA 1UXOA 3A70A 2AMVA 5C4MA 3NWJA 3THRA 3UC9A 3IAS6 3QWBA 5JYOA 1H4VB 1QXSA 4DYHA 1XAGA 3QW2A 2VPWA 3ZTTA 3A6EA 2B35A 1Y3IA 5BQXA 1YNSA 1ZRMA 1IRIA 1GZVA 4Q7LA 1W8YA 4Q0HA 1E3JA 1D5WA 2XEDA 2CMKA 4IJKA 4WD3A 4XXRA 1EI9A 2R6R1 3CNHA 3ZWKA 1PR2A 4UMVA 3MWEB 4CKBB 4C4TA 3BMCA 3VU9B 4TROA 3QEMA 2O2XA 4EHAA 4MDHA 2GXUA 4W9MC 1WTCA 1X1DA 1QLWA 1T0BA 2WGWB 1RE1A 5EM1A 3WRXC 3O91A 3DTKA 3A3PA 5JDIA 3D8TA 4L8VA 6AT1A 4OU5A 5JAHA 1U0SY 1O95A 4F04A 1NVKA 4EG0A 2ZR8A 1XZEA 3C3JA 1JG4A 1Z5GA 4F38A 3OOVA 3EG5A 2FG5A 2QUHA 2B4KA 5DW0A 4BVJA 4ACBA 4UMFA 3K9FC 5FYDA 3KPVA 4B44A 2RK3A 4JI7B 3LWDA 1XPRA 4W9NC 3IF6B 3BCRA 3SLRA 4ZI7B 2CCKA 2FW0A 2MJLA 3N0VA 1ESCA 1UP4A 3PQ5A 3HCRA 1E7SA 2PU7A 1ISGA 3KOYA 4NDZA 2E55A 2VWPA 5HJ7A 3U4QA 1G3MA 2V6MA 2O8DB 4GVLA 3AR3A 3OIDA 5CA1A 2QMYA 1VKNA 3SN6A 5HDCA 2ZIEA 4EFKA 3HR4A 5TBMA 5AM0A 3OOSA 3THYB 1PT8A 2X2OA 2JFGA 2SECE 3IKMB 4TYMA 1GAXA 2BE7A 4ZIRB 1KARA 3EB9A 1M2NA 3LLMA 2D06A 1D09A 1ZS9A 2I66A 5TJJA 4HZUA 4PQYA 1RACA 1ZSYA 3WC4A 2O7RA 3B6KA 3NW9A 1N2GA 3IBGA 3WLNA 3Q81A 1D4AA 4W4TA 5BQPA 1KU6A 5C46F 4FD8A 2PM8A 1E1CB 2HJ9A 1AKUA 5AHOA 2PU4A 1HDOA 1EG2A 2EX4A 1F38A 3NC1C 3PRJA 3ZGLA 3B3AA 1I7SB 3GA0A 2PQMA 2HA2A 3IX3A 2V0WA 3MTEA 4BQPA 1R8SA 3A9TA 1RXUA 5JDCA 5DF9A 4OKIA 4US0R 1I2WA 4WKCA 2DWCA 1LH0A 3M9XA 2XHEA 4LYFA 3LW7A 4P2BA 2FQQA 3AHHA 4RHUA 3CZMA 3CX6A 4BLOA 3RSSA 3RHTA 4OQYA 1U7DA 2WYWA 1RKQA 1EIZA 1XJ0A 1ZHHA 4XTCS 2NVUB 4DBZA 1QAOA 4ENUA 2ZLBA 1NW6A 3ZDYB 4J3JA 2C3YA 4HPWA 1FQOA 5KYWA 3AP2A 3F6PA 5GVSA 3LXRA 3IMCA 1J22A 5ALQA 1WPGA 4MBKA 2ZROA 3UAGA 2D3WA 4KBGA 4BMNA 3OLYA 2BYTA 1CVLA 3BMOB 4IJVA 4LXTA 1J21A 3IIKA 3LH5A 5FUQA 1H42A 1MWRA 3CF4A 1OFVA 4A1OA 1JWPA 2W58A 2HGVA 1JZTA 1EBUA 5J3WA 2AR9A 3MTAA 4D0GA 1DEAA 4US2R 4N7BA 1TTQB 1KOFA 4DMZA 1MQSA 1EA7A 1LSXA 3V42A 2ECKA 2Z3ZA 3HL4A 5JNVA 1YR2A 4KJXA 4IPTA 2C5LA 2VHZA 4FBGA 4B3TB 3W0LB 4AJJA 2BEJA 2DWPA 3D8RA 3G59A 3A1WA 4ZEWA 5BXYA 4NCKA 4MJXA 5CD9A 4N8SA 2W6CX 3JQ9C 2MDTA 4JLKA 1E18A 1AQ6A 2J9ZB 3OPYA 3ELDA 2XGOA 4Y0OA 3HVHA 4REQA 1LRKA 3E84A 3U09A 5T8KA 4D3DA 5B64A 1HT0A 3H8JA 1RWVA 4BO5A 1L5VA 4GI5A 2ADFA 1U8YA 4A4DA 8AT1A 3TJZC 1WMSA 1OX6A 5TVKA 4NZZA 1X80B 3KX0X 3EZ9A 4W5WA 4L7QA 1PBNA 3UOAB 3GRCA 2G5TA 3A28A 1GZDA 1QRTA 1DP8A 2F1RA 1T4BA 3T7TA 5DM1A 3TZKA 3BSFA 3UT6A 2WKEA 2JAXA 4ZPXA 1A9PA 5FFNA 5B6PA 2W1TB 5BORA 4KZBA 1XTUA 4NKRA 2PAVP 1JUDA 3HRHA 1FXUA 5K0NA 3F5MA 1WF3A 1KGGA 5FIUA 4ZVPA 1IKIA 3MWJA 2AKAB 2CJXA 2B8JA 5KJEA 1V37A 3NCHA 4PNZA 1I3LA 1G8FA 2QX4A 2P69A 3VV3A 1KDOA 1TQ2A 2M9MA 3LU1A 4HB0A 1P75A 5M3BA 1YT4A 2B82A 2QZ6A 3N4IA 4Q1BA 4AJIA 3I32A 5EPHA 4A8TA 1VKOA 1E2MA 5JNTA 3V7WA 5LP6F 4H1TA 5FORA 3HLCA 5LSAA 4YCDA 2V6FA 4OXRA 3C4QA 4FQ5A 2VCHA 1PD1A 1UOQA 1X86B 3N8NA 1YZQA 4M0CA 3UICA 5L3VA 1CJUC 2CNWD 1EWRA 13PKA 1N5IA 3WADA 1KI2A 5EN4A 3OF3A 4EOGA 4RANA 5BMOA 3P4UA 1Y7PA 4W5OA 4GRIA 3RVPA 4QT4A 2WKIA 1QVRA 1QHGA 4RSGA 3LX4A 3D4LA 1W36C 1E2PA 5L3ZA 3AYXB 3ZWOA 5HQ3B 2JI4A 4IH4A 1V11B 4GCZA 2ZRQA 1Z0JA 3IQZA 1ZI8A 4GFDA 1Y1PA 3WLTA 2FWRA 2E4UA 3PEVA 2W7TA 4DLUA 2BTFP 1Q1NA 2V65A 4QHYA 4O29A 1OREA 3LBAA 4XIGS 3AZQA 1RXSA 4L3VA 4EGAA 3IT1A 4OG2A 2J9RA 5BNWA 2X9QA 1E0SA 4YRBA 1MNQA 3KJNA 4OP2A 3E48A 3NEYA 2ZRIA 3DKRA 2BEUA 1XJ6A 1KSHA 3GNTA 2TMKA 3A1DA 3MF0A 1VIMA 2WF6A 1NUSA 4ZZIA 3CUTA 4RSMA 3FDJA 4Y6SA 4ME6A 1SWVA 3FTQA 3CAXA 2Y2VA 4GT1A 4JB2A 1KP3A 3KEOA 1ZX1A 4JJZA 1KI8A 4YCMA 1FA9A 4YVFA 1E9CA 5CVVA 3RT1A 1Q14A 1D1SA 3JALB 2V55B 5DJTA 3QI2A 1XK6A 1P0PA 1QPBA 4LCMA 3ZK8A 2Y66A 3H05A 3DTVA 4MDFA 1A7UA 4H59A 3FWYA 3RSOA 3PHLA 4MGIR 1WOMA 4JJFA 2XA9A 2JKTM 4PSVA 5FL7A 3N7AA 4PMAA 3O7MA 2ZUDA 4GI2A 3E18A 2HIMA 1JFSA 5TQ2B 5DX1A 4DDVA 2SKDA 1T3GA 4XDHA 3ISVA 1A5ZA 4JGGA 4M37A 3WL5A 3LR5A 1D6JA 2ODTX 4W5RA 1QWOA 2GAIA 4RZXA 2BTEA 6ADHA 2RDMA 1KJIA 1GA4A 3HXMA 3JTMA 4LV2A 1CJTC 2XODA 3IDOA 3MAAC 1LJLA 5DEIA 3K4PA 3A9VA 1OI3A 3T7AA 5THQA 2ZB3A 4AZVA 1YDHA 4NBWA 4FGSA 3EXAA 3WS0A 2XMRA 1E2GA 3TZBA 2HMYB 3CWCA 3PYLA 2GXAA 5FJJA 4AJEA 4ZVSA 1KDZA 5HDSA 2IPOA 4GRDA 4U9IS 3CMCO 3ZOKA 2ZQ7A 3A3OA 4DQLA 4TWIA 3DUFB 4F1JA 2ZYIA 2JVKA 2O05A 5F1FA 1OIVA 3H8WA 4DCCA 1OA0A 2PRFA 4DVJA 1G2IA 4EMBA 1SXJC 5KYYB 2ZC4B 4OMUA 3BDAA 4GOJA 3NM6B 1ZG3A 4TSFA 4YJHB 2UYHA 3QEKA 1IYOA 4Z4EA 1YZGA 4AYTA 5CFRA 3ZX4A 1RADA 3I4LA 3SS7X 1N7IA 2A7QA 3RUEA 4Y1RB 4IEIA 4BE7B 3TX6A 3BFDA 3BICA 2VYVD 4DLAA 2IHVA 1NFFA 3FF4A 2UAGA 5BN4B 1T18A 2WJYA 4N40A 4MKHA 4BBJA 1P18A 3ULFA 5ECDA 4HBGA 1G66A 2X4DA 4KFSA 1S3SA 4IFBA 2WTUA 4D9HA 1UPTA 2W2LD 2LW7A 1XRQA 4JKTA 1W9MA 4UCFA 1B1CA 1UFRA 2RH8A 3D7RA 1JEOA 5LZ5A 4DV0B 1SKBA 2PX0A 1PWEA 2ZYGA 4D46A 4YPOA 4G5FA 4CM3A 4CLXA 1P5RA 2WWIA 1K7EB 5DNYB 4YAFA 3K1JA 4C2AA 4CPKA 4HWKA 2P41A 2XT0A 1JWZA 3BTSA 3IHKA 2CEKA 2P9JA 1NI3A 4A0HA 1GGKA 1EJ0A 2OKCA 1QHYA 4TZ6A 1I1QB 5TT0A 4GUAA 5HFOA 2YTZA 3IURA 3CH5A 4KE6A 1KQGA 2HK8A 3CNEA 4MCJA 4KN8A 3B3JA 2IDZA 1T4MA 4N01A 4Y2FA 1Q1AA 3T3PB 3BWXA 5T57A 1N7HA 3FOAA 2QE6A 4BXOB 1ODKA 3EFOB 4V1CA 5KQMA 3O4FA 5J4KA 5FNVB 1CJSA 3PX3A 1UPBA 2YIVX 3QZUA 1Y1KE 1BYUA 3EOZA 3ZGNA 3LDHA 1UJ6A 3GPDG 2PUEA 1EMDA 4UAGA 1FFGA 1JA0A 3EVFA 4LYGA 3X3HA 3RKUA 1XI2A 1F3LA 5F23A 4GS9A 1ESIA 4ZAYA 2WIKA 4XDGA 3PGJA 3L6BA 3EZNA 3IQFA 4GLOA 5IP5A 2AVDA 3RUCA 2WJAA 3OQVA 1V96A 1NWZA 5DIFA 4DANA 1Z4NA 3QP8A 3IA7A 1C8KA 3N8IA 5HF6A 1G5HA 2QN7A 3ID6C 4TN1A 1DDIA 4F94A 1CDEA 1ORHA 3ZWQA 1SVIA 1XXHA 4BN5A 4LPKA 4OMCA 1U4OA 4LNUA 4PHTA 2YR0A 1TMYA 2DHDA 4WADA 2NYVA 1TK2A 3I76A 4G3WA 5SYAA 4XEHA 1CP3A 4LMRA 3RH8B 3W5CA 5KPDA 3WRYA 1ISIA 2VNIA 1PTKA 3OQHA 4KSBA 4X20A 5E7MA 3IJPA 2CLCX 3N3BC 1T8UA 1XVAA 3V50A 1WDKA 4N65A 4N0MA 2XTMA 4MR7A 4BPRA 1T1SA 2ZAMA 2D5CA 5KI6A 2VJBA 3SYRA 3NHQA 3NTOA 2ZJ2A 2QZ9A 1MX5A 1E66A 1VYTA 2IYSA 4YJ2F 2R1UA 3EZLA 1D6SA 4NHEA 4Q4HA 4ZZ3A 3HPRA 5EESA 3HJAA 3PNOA 1FPMA 1XDDA 3JQ7B 3CV3A 4I66A 4EHDA 1CW2B 4DR5B 3PUIA 2BTQB 2W2KA 4DSNA 2OOKA 1UIMA 3G0HA 2Z1NA 4DBLC 4U7WA 4BP9A 3ZXXA 3WK8A 4FFPA 1XQ6A 3OOJA 2C9BA 2I4TA 3VR5A 2R1TB 5G2OA 5DULA 3BGSA 3V4FA 4PKYG 3JWJA 4BNFA 4OOEA 4LJRA 3RS2A 1JVJA 4CZ2A 4UTRA 5CJJA 2Q9CA 1DO0A 4B3DA 2H9AA 2FV8A 1QH1B 3AKEA 4TVOA 1RBMA 1L4MA 3BWEA 3OQIB 5FQJA 4FB4A 1FYWA 3N39C 4WZAE 1X70A 4LPSA 3CLTD 1S5PA 4IO0A 1SK8A 3FPVA 5JVDA 3B36A 1M1YE 1ZQ9A 5AIAA 2A57A 1YWGO 5JG7A 3D3NA 4RK0A 2AXEA 3GH3A 3FOWA 3I1YA 4LCEA 1USUA 2IELA 3N2KB 3KXKA 1I2AA 4GSLA 3OAAD 2QV7A 5I7HA 2ZP1A 1Z6FA 4UHKA 2RKOA 5U4QA 4M9RA 2A86A 3BFCA 1DHRA 2P6MA 4MQ6A 1D2NA 2CKDA 4RPJA 4FX5A 3R3UA 4E5UA 1NBAA 1JDZA 1G28A 2PX6A 4WT7A 4BX3A 1N2ZA 1Q0TA 5ARDA 4UEQA 2YVKA 1T1EA 3ZHBA 1BWRA 3WL3A 4KO4S 2POQX 3IWQA 1RCTE 4M1WA 1H2BA 1RJDA 5M04A 2HMUA 3GW8A 4ZAZA 4TMXA 1PX2A 2IUSA 4EJSA 4JK3A 4Q82A 3RUDA 4TV8F 4LZLA 4I2NA 1GYPA 2DE0X 4DJAA 2FWBA 4B5KA 2HLPA 3KOZA 5JD5A 2EA9A 1PZEA 5TLSA 3KQNA 4GE3A 1NYMA 1GG2A 1QP4A 3BXZA 4L16A 5ITWA 3DKVA 3EIWA 3WQHA 1DNPA 1AHHA 2IOQA 1QGYA 1ZD8A 5F83A 4QXRA 2YRXA 3OBBA 4ZOCA 4R8MA 4FSFA 3TW8B 1XBTA 4K1LA 4FZRA 4J76A 3P2JA 5DVZA 4YP9A 2YXNA 3TI7A 3R9WA 5G18A 2CK3D 5E95A 2V8FA 3OX2A 2VT2A 3IIJA 3K30A 4LNHA 5ENZA 5TMPA 2XWPA 4C4RA 2B1RA 3PL1A 3ZGZA 3ZDAA 2VSNA 1VETB 5ILOA 2X5NA 1V8PA 5EHXA 4YCBA 2A1IA 3W1VA 4CL0A 3LUKA 2R9XA 3NC4A 2PSJA 1QFSA 3E9RA 2I03A 3RJ9A 1TCVA 3ZOZA 4DCUA 2O14A 3NORA 4B34A 1UM9B 1PYYA 3ZHUA 2ZYVX 2V4UA 1C0IA 3GA7A 1NVDA 1HLGA 3HDJA 3N6RA 2FAXA 3WLLA 4OK5A 3DBLB 2RL3A 2CUTA 3CVXA 1DOAA 1UAAA 2O48X 3T7IA 2H16A 2DBYA 3HB9A 4XPIA 1CR1A 2PVPA 4EG4A 2JGIA 1EM6A 3GRUA 3C2WA 5JZOA 2HJEA 4ETXA 2QUBA 5TARA 1HNZB 5L3QA 4JUCA 3LLUA 5FA8A 4FMPA 3LVQE 2VQ6A 1L7EA 2I3GA 2ZB2A 3WL8A 3O3VA 1DGQA 2VJLA 4PGHA 2M6RA 1V26A 3EGXA 3EIFA 1N77A 1VHDA 2I4LA 1VFNA 1O8CA 5M1AA 1PW5A 3PUYA 1B14A 2Q21A 1AK1A 1PQWA 3WNQA 3ROPA 5HM8A 4MR8A 4UUBA 4PS0A 2CV0A 1UFOA 3IJEB 1KGFA 1N3LA 3T1NA 4NZNA 2UV0E 1RNLA 2D1TA 1C7QA 3GT0A 2ZR0A 5H3LA 4NFHA 3WZLA 2CC1A 3VZBA 1C0KA 3E8MA 1TXGA 2XKAA 2H85A 1KR5A 4QBFA 3RPEA 1IOZA 4MXDA 2Z83A 5JJIA 4O8GA 1CY0A 4P0TA 5DN9A 5SYMA 1GYQA 1I3OA 2ESRA 4C6YA 5KAPA 3MWGA 3FAKA 1DCTA 3EQ9A 3R9KA 2QUKA 2YZNA 4QSHA 5AVYA 4O59O 5IC4A 1UDCA 2BLLA 1KIMA 1LDNA 2G63A 4OLHA 4S3MA 4Q0JA 4GKUA 3SZTA 1PSWA 1TJ4A 2A9QA 2XT9A 3MIZA 1HZJA 4DS3A 1ZITA 1B73A 3R8CA 4HXEB 1R5OA 1Y3DE 4D99A 4QVIA 1G5IA 1DC3A 4QLOA 3UK6A 1G0NA 3ADCA 5C7OO 4ZBEA 1N9ZA 1OFHA 3QXXA 2QPNA 1B8OA 4BJ6A 5LQDA 4F5YA 3DF7A 4P3YA 3CKLA 3EZYA 1VMEA 2G28A 2YFQA 3CLOA 1PK7A 1KE3A 1M0TA 1QHXA 2C5HA 3VKGA 1QG0A 2ZJ4A 4L74A 1Z6ZA 2G1PA 5AOBA 1CU1A 2XBMA 3D2AA 1KIAA 4EKIA 1U2SA 5E6RB 2Q4OA 4PWYA 2OWJA 4HJ4A 3M6AA 3N1UA 4TUYB 3DOCA 5BR7A 2VJOA 4D81A 1XGIA 3OI7A 3ENWA 4QUEA 1QQ7A 2VPYA 1Y81A 4QRHA 2UUAB 1EWTA 2EBFX 1SFRA 4I4LA 2NSLA 3V1YA 3UDFA 2PT9A 3TOIA 4XM1A 1HL7A 1TJYA 4L22A 1ODCA 1CUEA 1JFTA 4KTTE 3CLVA 3GFFA 5CGSA 3LZDA 2VHVA 3E6AA 3M6MD 1UBMS 2H4HA 1AHNA 3GSGA 1CY1A 2M7UA 3HBNA 1U90A 4PFJA 2P9TA 2JBWA 3PYPA 1JR4A 3QJGA 2OCXA 1H8HA 5GIOE 1T5OA 2JIZD 3IEVA 2ZATA 3W7BA 1GJRA 4HHDA 3BD6A 1IZZA 3R7BA 3Q41A 2L19A 3CUEC 5EQDA 1JGTA 1IU9A 3KKOA 3EA5A 2G4VA 1B1AA 1MV5A 3BK2A 2Y2OA 3LUGA 4MA5A 2YXDA 1I94B 3H1TA 2F3SA 1S6RA 5LQUA 1XOIA 3MZFA 1XMSA 2HLHA 3UO8B 2HT6A 2XGJA 1KMMA 4S04A 2HH9A 5JEDA 2XWBF 4MS4A 2CHUA 3VV2A 1KAHA 3UY4A 1YI8A 4PN3A 4TT3D 2VWQA 1CJFA 2ZPTX 3UPDA 5KU7A 1YVEI 3EFHA 1LVUA 1TYEB 4J9UE 2V5UA 3PNVA 4RE6A 1TC1A 1QMGA 2WAEA 4MW4A 2H7XA 1C41A 3VI4B 3JVUA 5JZMA 1M9NA 3QP4A 4OQMA 4L9WA 3SPXA 2ZUBA 3O21A 1NR5A 1LLDA 3ONEA 3RROA 4EF6A 4IIBA 4OXNA 1E5VA 1CQJA 4JKIA 3WFIA 2KPOA 1W0KD 1T29A 3WYCA 2JA2A 3DAGA 3EDCA 3C5VA 3HKBB 4EY4A 1JT9A 1YIAA 5GVRA 5BRNA 4RXMA 3FZNA 3W5HA 1DIRA 1JYFA 4Q3AA 2VTBA 2HDNB 4NV1A 1HETA 3JVEA 5DIZA 3PK0A 1WVIA 2ATEA 1SCJA 3KAJA 1VOTA 1N9KA 3GLKA 2VTDA 4GLQA 1OSNA 2XXAB 4DXHA 2HRQA 4RPCA 2A9JA 4CI9A 4EQ6A 1W46A 2WAFA 2B30A 3HU5A 5BPFA 3LCVB 1C3OA 2DPYA 3TM5A 5AD1A 3ZUPA 3DBRB 1SBYA 3V3TA 2EX9A 1HV8A 3WMRA 3QHQA 4NBRA 4B48A 5HFNA 4R1OA 1KH3A 1GR0A 1N4AA 5LB4A 1OI7A 5K0TA 4JB0A 1W5FA 4KG5A 4ENTA 3S7NA 3SX2A 3JWGA 4IOJA 4U5QA 4EECA 4FR0A 5ECWA 2VP9A 1AC5A 1KFEB 4MYDA 4P7KA 3VAZA 3F0TA 1XMIA 3Q10A 3R5TA 2CWDA 1V6CA 1J8QA 3IS2B 1VSUA 4P1ZA 1DJNA 1KY2A 4N18A 5IDWA 1YQWA 3GRZA 4GMXA 4G26A 1ETHA 1C3XA 1CYDA 3O8QB 4CNBA 3IAAA 2XSZA 1BHQ1 1DPFA 2V1AA 4ZQBA 1YLWA 1QCYA 5ULLA 3O73A 3TL6A 4EEZA 4CE6A 1MJFA 3GGPA 4X6YA 2ID9A 4FE3A 3A6ZA 1L1QA 2DKFA 1T2VA 5A5EA 3JW8A 5IKOA 1QGDA 1ES5A 3LM8A 2FUCA 3WK4A 2B95A 1Z88A 2HA3A 1JLLB 1AO0A 5EIEA 2W3DA 5H59A 4FT4A 3SZMA 3SQNA 3AFIA 2ZIGA 4CDNA 3IXGA 3FZQA 4FT2A 3UFBA 1KXJA 4EUVA 1G63A 2REXB 2P04A 2MSKA 2AQIA 4YACA 1KY5A 3UJCA 2X9VA 1JWVA 4P3OA 1QTRA 2FMFA 3RFTA 5K05A 4RMIA 1CKEA 3RE1A 5DLQC 1Q2PA 4YP1A 5IYZA 1TRKA 3JQ8A 3I8SA 4ALIA 1T34A 3IDZA 4ZT5A 4KUGA 3CJQA 3CVOA 3K0AA 3OH8A 3IUBA 2IYYA 2Y4AA 1GPJA 2NU7B 3T1HB 4JDUA 3DF9A 1HE4A 1LV7A 2CNOA 2C3UA 5A6SB 3LY8A 5BYBA 4HNAB 3GU3A 3QQPA 1OLUB 5CVUA 3OT5A 1KIFA 3GD5A 5JRDS 3VYSB 2XMSA 1Y7IA 5FI6A 2YQ5A 3OTOB 3A4VA 1BMFA 4PLWA 4ZVVA 3E1KA 2B5WA 4R0VA 4EMTA 4PZ0A 3QVOA 3HLKA 3WNZA 2J8YA 3OT1A 1XPJA 1JBKA 5IVIA 1C4OA 4OI2A 2CVOA 4E12A 2ZRCA 1Y5IA 4MYHA 1LNZA 3ASYA 1R88A 3CNBA 3G9TA 5HDQA 1RAFA 1ZMBA 5LP6B 3EZXA 4CEIA 2WVHA 1JAIA 3RXXA 5DHAA 1XZQA 5JCOA 4EITA 1K0UA 1SHVA 2JK1A 5KNCA 2BZSA 4J29A 3ZLJA 1GPH1 3ILHA 1HFEL 1SUBA 2EF1A 3QEJA 1HG1A 3HJHA 2HI0A 1KS9A 3NY4A 1CNEA 3MTGA 4AYXA 4DB4A 4HHEA 1BOFA 4JXWA 4Q4AB 4B4KA 3PNQA 3AWIA 1F7UA 3KLNA 3UMJA 3FC7A 4RGQA 3U9TA 2XA1A 4N3NA 3F97A 1XKQA 1IG0A 2LIPA 3WMFA 1ZD2P 4Q3LA 3VO2A 3LHFA 1O0SA 3HPQA 4G63A 1SB8A 1CUZA 3L84A 1I10A 2WTAA 2NW6A 1YRBA 7ABPA 4AWBA 4DUPA 1TW2A 1OLXA 1SVUA 1Z4PX 5FBKA 4INAA 3IJ5A 1ZC4A 3CPSA 1ONOA 1YS6A 1EWZA 2DBRA 5H9WA 3BFEA 4ZDKA 5F3WB 4WIAA 4KG2A 2AFHE 4BBAA 3ZI0A 3I6BA 3EXHB 1S7CA 3HLYA 3JD0A 5TIIA 3EMKA 3DE7X 5JPIA 1K38A 2XX3A 4FW9A 5ILGA 4R8LA 1LNSA 2GTIA 1PRQA 1E2UA 1XA1A 1UCFA 4RPHA 5IANA 3H2JA 5I4KA 5ECYA 4B9OA 4FYPA 4Z4GA 4WOBA 4N0PA 1TYDE 1K9SA 1N5JA 5AP9A 3OPYI 5C5EA 3ZCTA 3ZUGA 2Q9BA 5KDOA 1V45E 2IIPA 1WPXA 5AXAA 1XPBA 2C03A 4XYBA 3WIBA 1WLSA 2BMDA 1G21A 4MR9B 2QN9A 1RIIA 4BNTA 4ZI2A 3AGPA 1IN4A 2DCUA 1OFUX 4V3BA 1U2RA 3R23A 1UK6A 4JLNA 4E7OA 2ZL1B 5F78A 1ITZA 1OFUA 4PRKA 3AKZA 1VL1A 1X3SA 4EQZA 2BMAA 3L46A 4IVQA 3L0YA 5ARCA 1S8AA 1O97C 3SDZA 1OJLA 3OESA 4IIVA 1ZRHA 3UK1A 4E6WA 5IXSA 4ZAGA 1ZSNA 2X23A 4W9RA 7MDHA 3GR2A 2NLOA 3MMNA 1T1BA 2QI9F 5CDHA 4BMXA 3IO5A 4E3ZA 3KZCA 1II8A 4BVEA 4R3WA 1V16B 1L0DA 2VNHA 4CQMA 1P1KA 1GZUA 3GT4A 1DAIA 1Z39A 1C0LA 4JJ6A 3C1UA 1A76A 3PR3A 1C1HA 3A9CA 5JLJA 1P73A 2Z2JA 1TM1E 5HKAA 1F8FA 1M34E 4DM4A 2IHUA 4AZSA 2Q3CA 2CMGA 2FSHA 4P33A 3MRTA 1XA7A 2P91A 1XHLA 3V7YA 4RHEA 2EYQA 3KSRA 4I50B 4ZTBA 5EYPB 1F8GA 5HD3A 3CLRD 5BW8A 2H18A 3U1TA 4F2GA 4FYXA 2M6LA 3JXEA 1YR3A 2C98A 4BC1A 3W8FA 5ALVA 4P34A 4DC0A 1FLDA 1D7AA 3NT4A 3AKYA 1DV2A 3SKYA 4Z4IA 1P2FA 4BNYA 3V2IA 2CUZA 4CKZA 4CIYA 4DB2A 3NTLA 1F12A 2J5XA 2CDAA 2RK6A 3LECA 4M9ZA 1E1QD 2FG6C 3S5UA 5LQKA 1G60A 1KMNA 4MGYR 4TZKA 4CLHA 3PTAA 1X7GA 3BH6A 1XEWY 1JIVA 2WICA 3UMBA 4RJIA 1P7ZA 1Z7GA 1C2TA 3QUCA 5K8IA 1O77A 3V4LA 1YB1A 2OM6A 1T25A 3I3SR 2E5WA 1U9CA 1E1NA 4LE1A 4NZMA 5NLLA 3CCCA 2QTBA 5DNCA 2E1RA 4UQOA 3MXTA 5E2IA 5FQNA 4MBHA 1KZ6A 1KY3A 4EHFA 1A88A 5HCUA 3H86A 1WSWA 3K94A 1EYZA 1P1FA 4G89A 1M1ZA 2PUCA 3WDMA 5DDIP 1KAQA 1DQSA 4ZO4A 2HPAA 3NDIA 3CYFA 2WUEA 3LKDA 2P2GA 4Z7JA 1FDWA 1NM5C 1I2SA 1JEQB 3SEAA 4OTZA 3LDGA 3TQSA 3U40A 1KVRA 5E7IA 5JC8A 1NYQA 3S4YA 4BB9A 4OQPA 3WQSB 2YJZA 5C8VA 2H1IA 1YS7A 4ER3A 1ODFA 3TH5A 3ZV6A 2FUG6 1A5TA 3S7OA 2W2QA 2R8EA 4KPUB 4X94A 2QNBA 3V1LA 3UWPA 4J7CA 4WY2A 2IXAA 4QOIA 3LKBA 4R0QA 2BZ1A 1UZMA 3RS9A 1RAEA 1TZKA 1T35A 4PZ9A 3TFWA 1GSAA 1TLLA 1OROA 5F7ZA 2Y68A 1RYHA 1LVHA 1T13A 1CQAA 4W99A 4PC2A 4MVYA 5AIBA 4LRSB 1XN4A 4CKCB 1GG9A 3BD7A 1SVOA 2PV0A 1OFGA 3W7VA 4MO2A 3THXA 5DHUA 3UT5B 5K8UA 2I72A 2XE7A 4ZJYA 5D01A 2KLIA 1IEQA 3D4IA 4IJ5A 3B70A 4S1WA 3UW3A 5JD6A 4Q16A 4JGRA 3RUFA 5TGDA 3KPWA 2CE7A 1WZNA 2ZUVA 2NIPA 1MKMA 3S2IA 4LOJA 3AH8A 5H5JA 3DCJA 3WP0A 4CF4A 1X7ZB 5EQFA 5HZMA 1ECLA 3UMYA 6LDHA 4FXPA 3DPUA 4WL0A 4JU8A 1ZVJA 4WBSA 4DC9A 4YJ2B 1B93A 2R1ZA 1MENA 1QAMA 1B0ZA 2VRCA 3RYIA 3IEMA 3HA5A 4RA6B 1HK7A 1N4DA 5H82A 3EXIA 4J7XA 4FH2A 4MIKA 1Z5UA 4WNCA 3GLIB 4OGWA 3DXZA 2DG2A 2FW8A 2PMFA 4KI0A 1Z4LA 3SQXA 3EGIA 3P5BA 1Q5PA 2H1SA 2JC7A 1N6OA 4XWWA 5G40A 1L4LA 2PQ2A 2Q1XA 1MW8X 4EW7A 3HB7A 3KEGA 3ZGVA 5A7GA 2WSYB 4KQEA 4CV0A 2XCRB 4ZEMA 2WVAA 1P5ZB 1PJ4A 1RI4A 2AE1A 3TL2A 1CZOA 2WG2A 1PI5A 1AHIA 5E3JA 1CF9A 1N9BA 1XO1A 5HD5A 4K6MA 4AB1A 5CJPA 4LS3A 3C7KA 2Q50A 4DRXA 2HEIA 2FPMA 2WQZA 4N7RA 1FMFA 3O4RA 4LRQA 4X1IA 1W29A 2YWXA 1VMIA 1DKQA 3P97A 1H85A 5EWLB 2BGGA 1TDLA 1CE8A 4F84A 2XE8A 4R5HA 3DKIA 4PSDA 5T3UA 4Z9AA 1MB0A 2PCLA 8GPBA 1E99A 3AZOA 1XQ9A 4CLCD 3CX4A 1K2VN 2E5LB 2HP6A 4RH1A 5BUSA 4M0LA 4EG3A 4X7RA 2OLEA 2BELA 1Z5OA 4Y0VA 3TBHA 3MN1A 4XX0B 3K2EA 5A9RA 4V1CI 2WABA 4ZALA 1VZ2A 2XFSA 1NYTA 2NZXA 4PG8A 3EA4A 2ORYA 1JIKA 5K3FB 1I4DD 2Z5FA 1Q7RA 1CRQA 2CYCA 1T3HA 3UTDA 1Z38A 3B1VA 1RYYA 2HK7A 2OBFA 1LI9A 3KK0A 3RSQA 4QUJA 3G13A 3T4EA 4BLQA 2H3HA 5EZYB 2IU3A 2JLXA 5K09A 3B6ZA 1RP7A 2J6BA 1DTEA 4TV8B 4F3RA 3ZG9B 3RYHB 5KOJB 3OFNA 5C8XA 1TTTA 1J33A 2CHEA 5DBHX 3ZZMA 4BNIA 2WHQA 5IZCA 5JR3A 4RKQA 1QH8A 1ZH6A 3FIUA 5ALOA 4YQEA 2GO7A 1L0GA 4QM7A 1KYYA 1ODSA 3WWZA 2Y9PB 4YUZA 3T4UA 4JYBA 4KR9A 2Z43A 1Q0UA 1XJWA 3EC7A 1W63M 4GM1A 3OCVA 1AWIA 1TQ6A 4ZJUA 3D4OA 4PYNA 3T5GA 3M2JA 1GARA 1KFJB 5C1BA 4H9GA 2AMLA 4D9NA 4DC1A 2GN2A 2JG3A 1ZZGA 1LV8A 2IZ1A 5AVXA 3LVRE 2JDID 1OZGA 4R68A 3GJZA 4N6OA 5A05A 4WH0A 4GBED 5ER9A 1DAMA 3HCYA 2V9AA 4ENVA 3VR4A 5JNWA 2ZW9A 3H3JA 3H9EO 3GLHE