2WKQA

Structure of a photoactivatable rac1 containing the lov2 c450a mutant
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
317
structure length
317
Chain Sequence
ATTLERIEKNFVITDPRLPDNPIIFASDSFLQLTEYSREEILGRNARFLQGPETDRATVRKIRDAIDNQTEVTVQLINYTKSGKKFWNLFHLQPMRDQKGDVQYFIGVQLDGTEHVRDAAEREGVMLIKKTAENIDEAAKELIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGLEDYDRLRPLSYPQTDVFLICFSLVSPASFHHVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A Genetically Encoded Photoactivatable Rac Controls the Motility of Living Cells.
pubmed doi rcsb
source organism Avena sativa
molecule tags Transferase, cell adhesion
molecule keywords NPH1-1, RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 1
total genus 108
structure length 317
sequence length 317
ec nomenclature
pdb deposition date 2009-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2wkqA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2wkqA02
4V0NA 2QJ7A 2WJGA 1FQJA 2GCOA 3WRXC 1H8HA 3I1FA 4MRRA 5CB8A 2PLFA 2WOJA 2WWYA 1VKJA 2R65A 2D7CA 3BB4A 3HYTA 4Q9HA 2BCJQ 3C8UA 3OE7D 3PXGA 1R5NA 2JJ8A 5AUPB 1NVVQ 3OEEA 2ZU0C 4PO9A 3GP8A 1U99A 3I5YA 1PLLA 3NOUC 1E9SA 4DEXA 4LJYA 5GVSA 2WAXA 2H5EA 4ZO4A 2DY1A 5JBQA 1TF7A 3VTKA 3WBKA 1F3OA 3SJBA 2BASA 1CEEA 3NVAA 1P61B 1J99A 1U0LA 1KDPA 1S9HA 1XJQA 1VG1A 3B5JA 4HNBA 1CJUC 3AF0A 4DLWA 4G5RA 1KSHA 3TKLA 4KQDA 3QE0A 1EW0A 3UKDA 2ZSAA 3THWB 1Y28A 1W47A 2VP0A 1JAHA 3WMGA 4YWZA 1NMXA 1FFHA 4US2R 4TTRA 3WNCA 3FC7A 2E87A 2CJWA 3WNDA 3TVTA 3LH5A 1XXHA 2ZJBA 1Z6AA 1NBMD 4OHXA 1DARA 1XDBA 4LC1A 4URZR 3FTQA 5LBIA 3H9WA 2J45A 3PQCA 5FUWA 4OKSA 1GOTA 5F69A 1KJWA 2WOOA 3K3CA 2F9MA 5CB6A 1N9OA 2ZOIA 2FPLA 2JLWA 2W0MA 4P0TA 4WW0A 1V9ZA 4A6PA 3R9IA 5F5YA 1KKLA 4N1AA 3W8NA 1AJEA 2FF7A 2IW3A 5FI1B 2Q0HA 2QAJA 4ZIRB 1F60A 4WVFA 3GCGA 4XWOA 1E0AA 2RCNA 1UADA 4GBMA 1PJRA 2FFAA 4PZYA 1QVRA 4H1UA 4UXIA 6Q21A 3T35A 4HY8A 1G3QA 2C78A 2HLDD 1EX6A 2PZEA 3KTAA 4L9WA 5DIFA 4AY2A 1JPNA 4Q9IA 4CRWB 2QRZA 1MO5A 1KAOA 3H2YA 2AD1A 4QM7A 1AKEA 3MGCA 3AB3A 3UANA 5G4YA 4N0EA 4E09A 1DP8A 3U2QA 2EW1A 3UXMA 5IRCD 2JA1A 3CNNA 4ARZB 4LZZA 2EYUA 4D4KA 5C2JB 3P4XA 2OFXA 5FTNA 2RHMA 2V7QD 5BQ5A 4XIGS 2V55B 1N5KA 2MMGA 4QGAA 1G18A 3D6TB 2NMVA 3N2IA 1NN5A 4LHXA 3W34A 1QHSA 1ZNXA 2GESA 1GNQA 4JKYA 1B0UA 4QHYA 3VKHA 4M4XA 3QF7A 4PHGA 2KJQA 4YQFA 4CEJB 2ZR9A 3LICA 1S4QA 2JLQA 4M9XA 2VV7A 4W7SA 1P97A 2X2FA 4XT2A 3KDSE 4JVSB 4B3BA 3IBRA 3ICQB 4GS9B 2OLJA 3GJ4A 2CLCX 2GJSA 4D81A 3ZVNA 1AZTA 1KO4A 4HB3A 2NIPA 2Z83A 1WF3A 3C14C 4QGGA 2DFLA 1Q3TA 3THWA 4BLQA 3R9WA 4P4UA 4BUJA 3PITA 5B58C 2CE7A 3L43A 4HAZA 3PCRB 1FZQA 4V0LA 1BMFD 5FOWA 4DVGA 5JRZA 1WXQA 4NZYA 1NKTA 3FB4A 5G41A 1W2GA 1IXZA 2C5LA 4LUCA 3RC8A 2ZI7A 1QHNA 4B76A 2A3RA 3FWYA 4QBHA 5B30A 3LO5A 5J4LA 2QN6A 5IDVA 5JWRA 521PA 1VB6A 3VQTA 1E9DA 1NLFA 5IT5A 3ASZA 3BBPA 3U7FB 3KXKA 2GHIA 4TQUS 1P9WA 3LBHA 1D2NA 2ASEA 4HB2A 2ECKA 2J41A 4X8MA 2QY9A 5TDHA 3BY8A 3T1TA 1CR1A 3MLEA 2XJ9A 1FTNA 3VMFA 2GCNA 2I1VB 2JCSA 1P60A 1W48A 5UKDA 1R5BA 3B85A 1VG8A 3ZZUA 1Y3AA 3ND9A 2VSOA 4QHTA 2PMKA 1W1WA 1NL3A 4A8JB 4OQXA 2J0SA 3PHYA 1V9YA 2YWFA 4CW7A 4RKFA 2FX3A 3CUEF 2ORWA 3IPXA 3WXMA 4Q18A 3RABA 3REGA 2BBWA 721PA 2OBMA 4RD4A 5CM8B 4PQFA 5JEEA 3MMPA 2B02A 3SJZA 2QUZA 5IS1A 3EA0A 2C9OA 1G7CA 2FU5C 3BY9A 4TYPA 2OEPA 3DOEA 3MFXA 2VHTA 4CT4B 2BKUA 1OYWA 5GVRA 2AL7A 4HOIA 2DR3A 5FUXA 1E0SA 1N5IA 4F3LB 2JJ2D 3TW4A 3PUVA 3ZQJA 2FPMA 2V9PA 4EJSC 621PA 2J3EA 2CMNA 4GS9A 2AHOA 1CXZA 2WJJA 2D06A 4Q9LA 3VU9A 4EQ6B 4KO8A 1NP6A 3V4RA 4A15A 2F7SA 5SZHB 1I2DA 4MRNA 1C9KA 3CX6A 4PZZA 1W5TA 2J0UB 4CEIB 2HT6A 1M7BA 3KB2A 3QG5A 1UKVY 2IL1A 1M74A 2NPIA 1ZINA 1G28A 1D2EA 1G8FA 5KPDA 3QXCA 5AUQA 4DC9A 2W27A 1BMFA 1U0HC 3RWOA 2V54A 1E2KA 3TBKA 1E2NA 3DPUA 2RGAA 4ASUD 3MJQA 4OBEA 1CF4A 4KFRA 1E9BA 4I39A 3TK1A 1OV4A 1PUJA 4CF7A 1X3SA 1Z07A 3EASA 3OAAA 2QP9X 2F3TA 3VR4A 3HR7A 1KNXA 3U5ZB 2AKAB 2I4IA 2WWIA 3MFYA 3AVTA 1XP8A 4UXJA 5KO2A 1OJGA 3LIAA 3PUXA 2IWHA 3FHCB 4H1VA 1TS7A 2B21A 4QJ4A 1D7EA 1UDXA 5E7IA 2WHXA 4DLTA 2RGBA 3NHQA 1U98A 4C7OA 3ZQ6A 3FMFA 5A0FA 4HP9A 2VHQA 4WUJA 2FSIA 4ARZA 4M1SA 5HTKA 1KMHA 2O8EA 2HV8A 1EK0A 1VDZA 2C04A 2GXAA 1E32A 1FL9A 2CHVA 4W5JA 5KIZA 1SVSA 1E6CA 2OBNA 1D8TA 3EC2A 2OWHA 4NCJA 2DWQA 4C0BA 1VIAA 3CZQA 2PHYA 4TYNA 5CM9C 4WF0A 2F9LA 1UWPX 3U3RA 1XXHB 4YXWD 2ZYWX 4Q9JA 2NO9A 3A1TA 1HQYE 3RRNA 3IKJA 1GVNB 4PZLA 2W6JA 3GJ6A 3SBEA 4WZBE 4CDGA 2BM0A 4P33A 1TADA 2F1JA 2WVJA 4IEEA 1KHTA 3O8RA 2XGJA 3A4LA 4MRPA 4R38A 2ERXA 1JR3E 4FMBB 4IJMA 4L16A 2CNWD 4M8NE 2SHKA 1GG2A 2AX4A 3IEUA 1RW4A 5P21A 1E98A 3TAHA 4A2PA 1KO8A 4DJTA 4F38A 1W36D 4TQ9A 4DDTA 1E99A 5DJTA 2CXXA 1JALA 2P0EA 1CJTC 5K8TA 1KY3A 1OYYA 4IOLA 1NF3A 4A8JC 3PG5A 1CP2A 4LY6A 1SHZA 3KKQA 3QOFA 4D25A 1ZU4A 2E1RA 3IIJA 3RSLA 3IDQA 3KKNA 1P2TA 4RFSA 1IM2A 5GJBA 1M7HA 1Z6XA 2ZUBA 2OLKA 3QPUA 3SYLA 4Z8XA 1HA3A 1F9IA 1W5SA 3AP1A 4Z1MD 2PEZA 2KSQA 3CIOA 5FBRB 1W0KD 2AXNA 1TTTA 4DBLC 1TL7C 4QNMA 3PJRA 3K9NA 5CYOA 1OHHA 4LX0A 3FMPB 4MKHA 2WJHA 3PUZA 4QGHA 5EP2A 5AVFA 4Q7MB 1Z6YA 2GF0A 2WZQA 3R9XA 5EFWA 4JL5A 4V0OA 1TS6A 2XOKD 3MQQA 4Q4HB 3THXA 2AFIE 3TMKA 4GMDA 3VE4A 1F2TB 1VYVA 1GKUB 1TF2A 1P4SA 1US8A 3U44A 3QF4B 4GNKA 1OXUA 1CRPA 1U8AA 2EQBA 2WPDA 3CPHA 3MWYW 4JYCA 5ELXA 2VEDA 2FA9A 2EFHB 3SC3A 3T34A 3K70D 5DLQC 1T3LA 3CRW1 1OT9A 2VHUA 4UJ3A 3NEJA 3BK7A 4LK2A 4XSGA 3RSOA 1BYWA 3I3SR 3B6EA 3AVQA 3EEHA 1YR7A 2AXPA 3ZVMA 3B1YA 2F3RA 3W6NA 2PR5A 1IOZA 4F4JA 2ODBA 1ZM7A 5HKKA 4I38A 1TU4A 1G7TA 1UPTA 1KSGA 1W4AA 2W6JD 5HE9A 2NOAA 1OFUX 3K0AA 2EFEB 3LXXA 4L9FA 2G83A 5D3MA 2WSSA 4ZV4A 3ZD7A 1HY3A 2RGEA 1R0ZA 4PC7A 3H1TA 4S2EA 4AG5A 5D3MB 4I5SA 1G19A 2G0TA 4JZKA 1E4VA 2VL7A 4LCBA 2ZJOA 1Z2CA 1W0JD 2ZE6A 4NYIQ 1T18A 3IO3A 4M9ZA 1KI9A 1XX6A 2BMEA 4IOMA 2KDKA 3FFAA 1XD8A 3AVUA 1JJ7A 3AF1A 2PYPA 1KK2A 1FOEB 3WBJA 2L0WA 3CAXA 3GDIA 3QY0A 3LIDA 4JSTA 2P7JA 2NO6A 4QBGB 4Q19A 3OESA 4AKHA 5F2EA 4X8OA 1W4RA 4P31A 4BZPA 3EARA 2WBLC 3E5HA 4DCVA 1QG4A 2FSFA 4KODA 4Q47A 4GFDA 2BCGY 2X1VA 3B1XA 4OI2A 5DGXA 3TSZA 3LQQA 1XFAA 5GADl 2QAGA 4P4SB 4Q7LA 2OCPA 3B9PA 5KUTA 1ZVQA 3AP2A 1II0A 3GFOA 4B74A 1GL7A 5J40A 3OEHD 5JSZB 3L8YA 4UXHA 3UB7A 1NMYA 2PJZA 2ZANA 3MJRA 2QTVB 3WMEA 1RE0A 4BFVA 5KNBA 1R10A 2BVNA 1Q1EA 2R44A 5EP4A 3GJXC 3O47A 4RFVA 1COWA 4QC2A 3EAQA 2BDTA 1OE0A 2YYZA 3UG7A 4E03A 3WP1B 3D7MA 1II8B 1FTSA 2BBSA 4B34A 2BOVA 2W6ID 4QOSA 4V0KA 5J4KA 4XTCS 4NYIR 1JAIA 2QHKA 2J7PD 4EPXA 1CBUA 1Z83A 5ANRB 4URYR 1DP6A 1MABB 3ZH9B 4QJ3A 1RRFA 1T0HB 1W46A 4HAVA 4RZ3A 2KBEA 1M1YE 5IU1A 1XMIA 2OAP1 3N5CA 5JECA 4TQAA 2ZQ5A 3ASYA 3P7NA 3QKSA 2ZEJA 3RYTC 3QNUA 3R8FA 1Z8FA 2CHGA 3TUJC 1FMJA 1JR3A 2GAOA 2W58A 1MO3A 3GJ5A 1XTJA 1OSNA 4M2LA 3QXXA 4AURA 2O8BA 1A2BA 3BD9A 2H57A 4MYCA 4DCNA 1E9CA 5BN4A 4DUGD 1IJEA 4FCWA 1J90A 1KAGA 1DAIA 1IONA 1F6BA 1DO0A 4L9EA 1DG1G 1E2DA 1JI0A 3TJZA 4DZZA 4H6JA 2OE2A 4RD0A 4LV6A 3Q5EA 1BIFA 4TWZA 4XH9B 3L0OA 3G5UA 4D80A 2FFHA 2EFCB 3F1OB 2EFGA 3GJ8A 4KCGA 1EWRA 2B7CA 2P67A 1Z0IA 4XVQA 4OI4A 1P6XA 1XJ2A 3KZ1E 3PUWA 1ZD1A 4MRVA 3VR6A 2ZE5A 3VAAA 1GSIA 2RMKA 4PAOA 4HAWA 4IFBA 5K8UA 4NU0A 4PC6A 1Z47A 3I8SA 4JKIA 5FPSA 4WBSA 1T6NA 1Q22A 3AVWA 1MR3F 2EYQA 2BEKA 3SHWA 4DB2A 4IEIA 5DKLA 1DS6A 1SXJA 3PFIA 1G3MA 4URVR 1GITA 1T8UA 3PEUA 4Q4JB 4DLRA 2PMDA 1II8A 2W00A 2ZM5A 2H7VA 4Q21A 1RC8A 2WM9B 4JT4A 2HDNB 2IXGA 1ONBA 3CWQA 4U02A 3REFA 1ZU5A 4TZ6A 1P62B 1XTQA 5CK5A 2A9KA 3ZYCA 5JLJA 1WDTA 3O8DA 3A0VA 3IHWA 3LLUA 4LRWA 5DH9A 5CDFA 4CEHA 2BHRA 5C4MA 2VQSA 1U9IC 5L3QB 5M04A 1OXSC 2P6UA 5H68A 4B9OA 2AWOA 4HEJA 4P3YA 1ODFA 1E94E 2CLSA 2FV8A 3VHLB 4P4SA 1QHHA 1YZNA 2FJUA 5G40A 4PTLA 3FKSD 3CNLA 4JBXA 3SEAA 1YR9A 4DJ3A 2IS1A 2VRWA 1WMSA 2B6HA 2DHRA 2PT7A 1QVAA 2RAPA 4WZ6A 2V1UA 4B3FX 1A82A 4JGPA 3U61B 4LYAA 4Q1CA 3IEVA 4UNQA 2QT0A 1XCPA 3OZXA 4HZUB 5CIWA 1ZP6A 5CIQA 3UB8A 2IYRA 2GETA 4A36A 5JS8A 4K46A 1XPUA 1WRBA 3MUFA 1UEIA 3LY5A 1Y63A 2ZYVX 2QE7D 5FR2A 3VU9B 4DLYA 4BBVA 3HYRA 4AG6A 1NVVR 1XEWX 1KNQA 3UMRA 4KUKA 1ZM9A 3AVPA 1F98A 2RKOA 3GMTA 1KTVA 2PDRA 5H1YA 2FZLA 2H1LA 2HCBA 4Q03A 1H8HD 2LCFA 2IS4A 4N3NA 5G3ZA 4OK6A 4NE2A 1UWNX 1CRQA 2DCUA 3K0FB 2GDJA 4BBTA 5KPJA 3LRPA 1G8YA 3Q85A 3FGNA 1GIAA 2O5VA 3DZ8A 5J4VA 2HLDA 4Q02A 4KBGA 1DPFA 1WBBA 2ATXA 2UZIR 3T1QA 4D2IA 1SQ5A 2JN7A 1C1YA 2ZJ2A 3B82A 5HSQA 1MH1A 3GEEA 4LHZA 4BEJA 2IX3A 2QPTA 2D7DA 5TBMB 3TR0A 2FSGA 4P4TA 1EXMA 4IDQA 2JLVA 1JNYA 3JVUA 2HF9A 2N42A 4HUQA 4IDNA 3ADCA 4IFEA 1AQYA 4HHDA 1AQUA 1M34E 4QJ5A 4Q9KA 4JVMA 1G4AE 3QF4A 4NDZA 4DKXA 4LJ4A 4JGRA 2CEAA 4CT5A 2P6NA 1KGDA 3EA5A 2PLRA 3RNLA 4U5XA 3QVUA 4DHEA 1QHXA 1G8PA 4FN5A 5EP3A 3RLFA 3GJ0A 3ZIAA 2EFDB 1XB2A 2P5TB 3K0CC 4HAUA 5SZIA 1XTSA 1E3MA 3A0RA 5FI0B 3P20A 4R6LA 3IS2A 1VIYA 2WJIA 3PIRA 2R9VA 1GUAA 1TS0A 1C4OA 4PANA 4GDFA 4C0LA 3T06B 3AF3A 1LY1A 4M9SA 4U7DA 1G41A 3DHWC 1SZPA 5A5GA 4MDFA 3GLHB 4GRAA 1NJGA 2IYUA 4MDEA 2QG6A 1BS1A 2GJAA 2LWIA 2EVWX 1KI6B 5F9FA 1U90A 2OCAA 4FCTA 3KQLA 4RFSB 1KKMA 2C96A 2I9VA 1RZ3A 2QTHA 5L8VA 4LLOB 1IXSB 3AF2A 1XEWY 1OH7A 1OKKD 3T1OA 1ZW6A 4RZUA 1KZGB 1QHIA 4MITA 1WA9A 2Z6CA 2IYXA 1KI2A 1IJFA 3E2IA 5CDFE 4OQMA 5JJLA 1VMAA 1OPXA 1U2RA 3KJIA 3FHTA 1SVOA 5FR1A 3MWJA 4Z54A 3KJHA 3X1ZA 4YMVA 3V4FA 1KDOA 2ZRKA 2J5XA 1Q44A 2ZBBA 1J8MF 4DLVA 4NCKA 5BN5A 4QXAA 4D4MA 3PEWA 3H86A 4KHZA 5FBQB 1DAEA 3DOFA 3CF0A 2C9YA 3IQWA 3NC0C 1P7CA 2RH5A 4QBFA 4C0QC 2C77A 2G88A 1MZUA 3NG1A 1P2VA 4Z1MA 2O8FB 3CNOA 2ZRLA 4UKDA 1BYIA 2QSZA 5FL7D 5FUVA 4JL8A 4FWIB 1Z63A 3NBZC 1XJ6A 4C0SA 2CLDX 3AF4A 1KO5A 1ZIOA 3EZ2A 3LFUA 2XZLA 3GLIA 1P72A 3EIHA 4AYXA 5FH9A 2YKFA 2JAQA 1G7RA 1XRJA 2LKDA 4Q5IA 3GFPA 2O8EB 2ZE8A 2IBMA 2CVHA 1E9EA 3BORA 4BFYA 1E1RA 2VIIA 2RGGA 3B1WA 5J3WA 5C46F 4OJKA 3GLGA 4ZKDA 4KYIB 1GZSA 3CB4A 4TMTA 1IY1A 4B2IA 1DE0A 5JI2E 1S1MA 1ZJ6A 2REOA 3TUIC 2XB2A 2YC4C 3H7WA 2QI9C 4XTRA 3SN6A 1YHNA 5HPYB 2MSEB 1W36B 5EJEA 1Q12A 4UNNA 4G0NA 3CH4B 4NHOA 2J1LA 3H84A 2RGNA 5JZVA 5FPTA 4DCSA 3LWNA 1Q20A 1N2CE 1SVMA 1RRCA 1ESNA 3ADDA 1KI4A 5FUYA 1Z0KA 1LT0A 2DBYA 3NDPA 3RC3A 5LDDC 2WPDD 3ZD6A 1TX4B 2VP4A 1GFIA 1CTQA 3NBXX 4JLKA 4PR0A 4EW7A 2ZROA 4DCTA 5JJIA 2F6RA 1Z0JA 1S66L 1N6IA 2QENA 2PCJA 2G0NA 1XJCA 4PSAA 2PT5A 2WTUA 2DFKB 1XD2B 1D06A 4DXAA 3GQBA 5HWVA 4C0AC 2IUSA 4JBYA 4MKGA 4M1WA 1P2SA 4JLNA 4PPFA 5F6AA 1T8TA 4JLAA 1DAKA 2J0UA 3PEVA 2A5GA 3V00A 1E96A 3LX5A 1GRRA 2XOKA 2GEUA 1ZUIA 1X8KA 2C8VA 3OFNA 3AQ4A 4ESHA 2QL6A 4XD7D 1CS4C 4X8LA 2ZRMA 2ZI3A 2WWGA 4KBFA 3PEYA 3CO5A 5AJWA 1KJYA 1S1ZA 5AR1A 2QM7A 2W2XA 1Q21A 1ZM4A 4L8GA 1RFLA 4B3XA 2FNAA 2OOLA 2ZSBA 5L3VA 1ZCBA 3GECA 4KAXA 4BLOA 4QM6A 3EPLA 2DFNA 4DIDA 2GK6A 1ZC4A 2OFWA 3EWAA 3RDPA 2YZ2A 2V6JA 3UMSA 3A58B 2YOFA 4H9GA 1JB1A 2L4RA 1E2EA 4ZDIA 5DE3A 1NRJB 4US0R 4A8JA 3F1PB 2A24A 4LPZA 2ZJYA 2R78A 3FPAA 2JLRA 3TAUA 1TEVA 2W2VA 3U7HB 2WMNB 2XSZA 2ZETA 3BFKA 3D8BA 3RRMA 3K0SA 1CR2A 3LYXA 3W6PA 5DN6A 5HCNA 1XBTA 2CL0X 3L0PA 2VH5R 3QPWA 3L2OB 4HH2A 4POAA 2OXCA 1Z2AA 2B8TA 4XOIA 2XX3A 1TF5A 3IQXA 2VBCA 5DI3B 2DB3A 1AA9A 3U7GA 4GZLA 3RS0A 3GLFB 1BOFA 2IEZA 4XWAA 4BFWA 3DZDA 2C98A 3PENA 2GILA 4EPYA 2Q3MA 2JIZA 2PCLA 2HV1A 3S1AA 4JGQA 5CJPA 3TW8B 4CIDA 1ZYUA 1G7SA 4A0RA 4JYBA 4BRUA 1N9NA 4RD3A 4EPVA 1LS6A 1XD9A 2Y8EA 3BS4A 3CM0A 4DLSA 3LLMA 1BKDR 3R20A 4FWTA 4DSNA 1FP6A 2ZUCA 3Q9LA 4LBWA 3VX3A 2PYRA 4LJ7A 1OJLA 2QP3A 3Q7PA 1LW7A 1DAHA 3KXLA 4TT3A 3WMFA 4O3MA 1J8YF 2CMKA 4EJSB 4L9GA 2W2TA 4YMSA 4BFZA 1AIPA 2ZR0A 4NXGA 4JJKA 1J2JA 1NIPA 1RKBA 2R6DA 4LJ6A 3SR0A 3B9QA 2ODNA 5L3RA 4LSGA 3RH8B 1TQ2A 5G3YA 3ZDQA 1OH6A 1CR4A 3QBVA 2ATVA 4AKIA 2PX0A 3MR0A 4MQBA 3PYPA 2GKSA 3UATA 3ZVLA 4I4LA 1NKSA 3OHMA 4PX9A 4TTPA 1E4YA 2CL7X 1M7GA 4M22A 4ASUA 4JLPA 1T1AA 1XTKA 3VFDA 4DT1B 1W36C 1VECA 2DPXA 4LV5B 1G16A 2IC5A 2VSFA 3QXJA 4I1OA 4QHSA 3F1NA 4PSVA 3FDIA 1R0XA 1CIPA 4IOJA 4NMMA 3FMIA 2B7BA 5H8WA 4IXMA 3MXQA 3QEJA 1GSVA 1U8ZA 3A1SA 1G5TA 3AV0B 2X8AA 3AGPA 2AK3A 4GOKA 5FOTA 4ACBA 1HT2E 1OXXK 2D4HA 4TL7A 4E22A 5IK2D 2IF0A 4LRZE 4GP7A 3C5CA 2ZITA 4FI3C 1U94A 3CRMA 3UMFA 1P0ZA 1LB1B 4BLSA 5CK4A 1SKYE 3K1JA 4XWKA 4ACAA 3NTUA 1DP9A 1NN1A 3OE7A 4HSEA 3D31A 1Z08A 2D62A 3ETLA 3GJ3A 1VYUA 5E7MA 5BN3A 2J9RA 1WBDA 2HUPA 3KTAB 3RS5A 3LIBA 1ZC3A 3H82A 1W7AA 3ADKA 3CRVA 3U3OA 5CITA 2XJ4A 4R70A 4ZIRA 1UAAA 2HYDA 3U4QB 2RGCA 2WKRA 2G77B 4ZCMA 4B47A 3B7GA 3DO6A 3RS2A 3E1SA 1F2UB 2XTZA 5IK2A 1IQPA 4UQOA 1PV4A 4KUOA 1T1BA 2R2AA 1SVWA 1AKYA 3DVLA 3QEOA 5FBLB 3BOSA 1G8HA 4MGYR 3TIFA 3LBIA 5EE9A 2YKGA 4AIIA 4MKIA 4PC2A 3W5IA 4CVNA 3TQCA 3VX4A 5LPNA 3ICEA 2WIBA 3B33A 2JEOA 4S35A 1UKZA 3F1PA 3IIMA 1GL9B 3QG1A 2IWRA 2JDID 2H18A 3U3KA 3H0KA 2XXAB 1N6LA 2DWPA 4QGFA 1K6MA 3OLOA 4ZDWA 1KO1A 1HQCA 1IN6A 3CPEA 2VF7A 2NG1A 3RS4A 2CCJA 2EWVA 3KQHA 1YZTA 3SJAA 4OK5A 2QROA 1VCOA 4K8OA 4RD2A 2WWXA 2X77A 2QMOA 1OXTA 3C4JA 3GEIA 2FGKA 4AWXA 1XFQA 3PR1A 3WNBA 5K8IA 1DAFA 4LJ8A 3RS3A 4UNSA 2XZOA 3QSYA 1R0YA 3GD7A 4EEPA 5HDSA 1J7KA 1QF9A 4G01B 4IVRA 1UBGA 3KQUA 3THYB 4LPSA 2R6FA 1JR6A 1TMKA 4EFMA 2P2LA 3NOTC 4FMDF 3T61A 3SNHA 4BFTA 2ODEA 1GSWA 3CKLA 4D0GA 2UZ3A 1R4AA 3ZIAD 2F55A 1YU9A 5KDOA 2F43A 5BW8A 1UJ2A 4HAXA 5DISB 3SU8A 3I62A 4LWZA 1GSXA 2O0KA 1S4SA 2ODWA 1G20E 4FW9A 1HURA 1F48A 4OHYA 1K5DA 2P5SA 1KDRA 1XCGB 4IRUB 5IF9A 2VP2A 2PL3A 3A0SA 3K9LA 2O8DA 4JLOA 3KX2A 1Q1QA 3HR8A 4PFSA 1E79D 1XEXB 1OTDA 1KMQA 4M0LA 2WSMA 2OHFA 4TSFD 3P27A 1TUIA 3KUCA 4LV8B 4KSBA 3GLFE 2VYFA 1NG1A 3C16C 3T5GA 3DKVA 5HDCA 4D0LB 2OFOA 2YOHA 4IOKA 2WICA 4KLNA 4LC0A 4URWR 2GJ9A 4BRWA 1R8SA 1CJMA 4JLDA 3H82B 3RHFA 2OZEA 4EAQA 3X1XA 4JLJA 1W2HA 4DDUA 1JJVA 2L1MA 1OKKA 2YNMA 4FMDB 5KSOA 2REBA 2OCYC 2IHYA 5H70A 5HCIA 5EQTA 1IN5A 4LJ9A 4O25A 3LXRA 2IXFA 4M1YA 3A1WA 3NKVA 4PHTA 1G9XA 2G6BA 2NQ2C 1E79A 2CCGA 2XAUA 4HLQB 4NPHA 4ZPXA 5EXXA 5HZKA 3NH9A 4V0MA 3M6AA 1E2FA 1VHLA 2QMUA 4LJAA 2HT1A 4TMKA 2O8CB 2Q21A 5KDLA 1LS1A 2GTPA 2QP4A 1SKYB 2FMXA 2C95A 4AK9A 4ZI3A 4BZXA 3NOPC 4DDVA 4TMVA 3GLGE 3BH6A 1K5GA 4NONA 2JATA 4R98A 4LHYA 4NH0A 1Z6TA 3O8BA 4A9AA 2OILA 2ZSEA 4GCZA 2IEYA 5DHAA 1XU4A 4HDOB 1AK2A 2PJRA 2ZE7A 4MYUA 4YMUA 5JFGA 1XCMA 2ZJAA 4B43A 3P26A 4EFNA 1G3RA 4HATA 5EXTA 1MKYA 5HD3A 2P6RA 2AK2A 3I4LA 2FG5A 3K8YA 3AKYA 1S8FA 2PD7A 1ZIPA 2BKEA 3B2EA 2ZREA 2GXUA 2R6CA 4QFMA 4EDHA 5KTYA 4AI6A 1DAMA 1AZSC 1OT6A 1M8PA 2AD5A 4HDCA 3LA6A 5FPKA 5EE5B 2NO7A 1T3HA 1IBRA 3CRRA 4W9MC 2J80A 2AN9A 3CR7A 4IVQA 3O8CA 1V43A 1OF1A 1UF9A 4U00A 2HJGA 2D2EA 4B3GA 5J4EA 5EXSA 2G9NA 4F91B 5DI9A 3EIEA 1QHGA 3EPHA 1WA5A 4YMWA 1RIFA 1VHTA 2XTNA 4ZCIA 1FX0B 2A5DA 4GOJA 1GP2A 4GL2A 2V0UA 1S67L 2YHSA 1WE2A 3QXHA 1E9AA 3B1VA 3E70C 5KDDA 2Q9BA 5J4YA 2JHEA 2QRNA 3OIYA 4FINA 2B8WA 4R7ZA 4Q4AA 5HR5A 2LKCA 4GHIA 2ZVPX 4C9BA 4C0JA 4I3AA 2XEXA 2ZS7A 3GEHA 3AKDA 4JSYA 4M4SA 5DYIA 3LV8A 2KWIA 1NNEA 2IS6A 2Z43A 1KYIA 2ZRJA 5DNYB 1TU3A 3SS8A 5E3HA 5J7EA 2VTKA 1KZ7B 4W5WA 3M0EA 1NY6A 1ETUA 2G1JA 3QKUA 3UWOA 3QJYA 1CJVC 4NCNA 4LYFA 2J46A 3HU1A 4B2LA 4ON9A 2ZSFA 4DWJA 3HPRA 2OCBA 3OF5A 2WWHA 4BBUA 3IUYA 3R7WB 5J47A 1N6KA 5KNDA 4YDSA 1G17A 4BE7B 1ZCAA 2JASA 4HUTA 1XPRA 1COWD 4UNRA 1HH4A 4C0KA 1JNUA 2OG2A 3LD9A 4IKEA 1G1MA 3TVDA 3WHKA 2K5UA 3WHLA 2JLYA 5FFMA 1LTQA 1XTIA 4YMTA 4NL4H 3ULFA 5L3SB 4URXR 1N6RA 2ZRHA 1KY2A 3SFVA 3TSOA 1GRQA 2EWWA 4TLAA 3QKTA 2VLGA 2IYYA 2ZVQX 1NLZA 3E4OA 5LD2C 1BH2A 1QRAA 1HT1E 2FPKA 1N3BA 3AM1A 3RRZA 1MRNA 1G64A 1O3YA 3FG8A 1MOZA 1E2JA 4A2WA 2PZFA 4ZCLA 4PHHA 4F92B 3H7WB 1T4GA 1X1RA 2JJ1A 3UIEA 5HE8A 3LI8A 3K70C 221PA 4WL9A 3WRYC 3HU2A 3GJ7A 1YKSA 1KO7A 1OFTA 3T50A 3RWMB 1QHYA 1GWNA 4TL8A 421PA 1T5LA 4NTZA 5TY0A 3IO5A 4LYHA 1KDTA 3NXSA 1R8QA 4DSOA 3C2WA 4L15A 3EZFA 4HAYA 1SXJB 1UKEA 1D9XA 1R2QA 1ZNZA 2HXYA 1S9DA 3G6OA 1J70A 3FHOA 5GJWC 4GPTA 3LAWA 3MD0A 4LBVA 4V0ME 1QDEA 1Q3HA 5KSPA 5FL7A 3CONA 3QI2A 4M1OA 5FPHA 4DJ2A 4M9QA 1G6OA 5HKKD 1UDWA 4E5UA 4I99A 3THYA 1XPOA 2GZHA 4IW3B 2QA5A 4I3JA 2D02A 2QSYA 4Q1AA 5HWTA 4MA4A 2DWOA 2GA8A 4NYMQ 3WYFA 2EU8A 4LJ5A 3UMEA 2JLSA 4GI7A 4GT1A 4EEUA 4V03A 1D6JA 4MGKR 2V7QA 2IYVA 1L2TA 1I4LD 1ZNWA 3M4YA 1DELA 4H6JB 4B48A 1XJ4A 3KKMA 1YZQA 3CZPA 4BPBA 3JZMA 1W44A 4BECA 1E2PA 2Z4SA 1DEKA 1A7JA 3GPLA 4DCUA 1FUKA 4HH3A 2V8OA 4M1MA 3KFVA 4TMWA 2OT3B 2F1HA 3CX7A 4JJZA 2IT1A 1UBCA 2ANCA 1DBSA 3L82B 1RJ9B 4UNPA 1T3SA 3VR2A 4B71A 1G3IA 1TUEA 2RGDA 3B8HA 4JS0A 3K0CA 1PUIA 2JLUA 1KI6A 4L4UA 5TV2A 4R3AA 1HUQA 2VLIA 2XB4A 2C2HA 3IIKA 4NCIA 3WYGA 4N0DA 3CLOA 3NEYA 3Q7QA 1N6NA 3FMOB 1E2QA 2R62A 3GLHA 4D0NA 3NIBA 4WAUA 4MYHA 1VG9B 2CK3A 5EUMA 1CULC 2Z6DA 3BB1A 4RCYA 1UKYA 4LYJA 3H4MA 3HJKA 1G3UA 2VSXA 2QT1A 3TH5A 3I72A 5J5CA 5AJXA 1W0JA 4BFUA 1FPMA 1YRAA 4PO1A 4TLCA 4PPQA 4V02A 5FPYA 1FNNA 2QMHA 1FW6A 1P9RA 1M2OB 1T0JB 2NGRA 4NXEA 2PZGA 5EZ5A 2FDCA 4UJ5A 3SBDA 3UPUA 1XFNA 4BZQA 2W83A 4J0QA 1X8JA 3F8TA 1JQJC 2CCKA 4I1VA 4L5BA 5B64A 3K0EA 4PHFA 3SE0A 4D82A 1DG3A 3QXSA 4KV9A 4DRZA 3U6KA 5DSZA 4HIAA 4EESA 2ZRPA 3W9YA 5DN6D 3M1IA 3NJAA 3CPJB 2BM1A 1E1QA 2VPPA 1NN3A 2NZ8A 3C5HA 2OWJA 1OIWA 3F1NB 5KNCA 2GZDA 5HDDA 2IYTA 4LDJA 3EZ7A 4BQSA 1EFHA 4MN5A 2WMOB 2AR7A 4A82A 3BERA 1AS0A 5A8BA 2MSCB 3CF6R 3LNCA 1N0UA 1JECA 1GL6A 1OTEA 4Q7JB 1U8YA 4EPTA 4M1KA 3SFZA 2VV8A 1EX7A 2BMFA 4F4IA 4HI4A 2IYQA 2WKQA 4KXFB 2ZRDA 3K70B 1TNDA 5FOUA 1K8RA 2J59A 3ZVRA 3AVYA 1CLUA 2BBOA 4G5SA 1RPZA 2O8CA 4EUNA 5EE1A 1NN0A 3LQRA 4LHWA 4X8HA 1HTWA 4AKEA 4EJSA 5I5LA 3RTYA 1NVUQ 1NSFA 1IN4A 3CBQA 3A1VA 4JIMA 3EPJA 4LPKA 2P3SA 3B60A 4KVGA 3VKGA 4RCZA 2XITA 1Z0FA 2PR6A 1I2MA 2GJ8A 5CYPA 3I73A 4EERA 3EG5A 1ANKA 4QL3A 1OB5A 1A2KC 4ESVA 2ZI5A 1N5LA 1CR0A 1UFQA 1JEDA 4B73A 2ZU6A 2GXQA 2ZUDA 3TQFA 1TPZA 4HJ4A 5FBWB 2R8RA 2BBTA 2YWHA 3OEHA 2GK7A 2XTMA 2GBLC 4YDHB 4JLVA 3IHLA 1QHHB 1S3SA 2YKHA 4HJ6A 1NLYA 2ZRAA 4MYTA 2GEVA 4PC1A 3HU3A 3TUZC 4C3ZA 2ZAMA 3RVBA 3W6OA 3SW1A 3KX0X 1JPJA 2QEQA 5KSZA 2ORVA 1F2TA 3EZ6A 1OTAA 1YR6A 4JBWA 4Z8YA 5DO9A 1KOUA 4YONB 3IBGA 4EPWA 4NYMR 4A2QA 2C99A 1IY0A 3MJHA 3JZAA 4KVAA 1ZAKA 3KQKA 2QZ4A 2I1QA 2V4ZA 4HP4A 3D3QA 1G291 1XMSA 1RRPA 2HF8A 3W90A 5CJ2A 3ICYA 1R7RA 4Q4JA 4DSTA 3TGPA 1IN8A 2YWEA 4OK3A 2JJ2A 5HWWA 4YXWA 3UB6A 4ABYA 1RRGA 5K8LA 2JDIA 2FOLA 1G21E 1FUUA 1KK0A 2N46A 3SQWA 1ZM3A 1E2LA 1OT3A 4CGZA 1KI3A 2XXAA 2Q9CA 3UK6A 2DYKA 3RRYA 4KFTA 1FNMA 3E4QA 1EG7A 3K53A 4Q48A 2IYSA 1HE8B 4WLAA 4R9UC 1D2MA 1IXRC 2CK3D 4HZIA 1IHUA 4XVRA 1E9FA 1OFHA 3ONWA 4F93B 2V3CC 3VOLA 3BE4A 4OQLA 3ZQ5A 1E2HA 1L8QA 1FX0A 2Z6VA 4NYJQ 3SYKA 4MN6A 5G53C 4PXAA 2VHCA 3CR8A 2PBRA 3OIWA 5GJCA 2JGNA 4FMCB 1UBEA 1EFRD 1F2UA 1TQDA 2FFBA 3C41J 3CH5A 3QBTA 1E0JA 1XD2A 3HWSA 4OHVA 5AJYA 3CW2A 1JR3D 2WWFA 1OH5A 1ZMXA 3OAAD 2ZOHA 1Z0DA 5F9HA 2CBZA 5TB5A 3MQOA 1VCNA 1B23P 5F98A 4HLUA 1LF0A 2IS2A 1EESA 2Z0MA 5JJKA 3LIFA 1QZXA 2FWRA 1OXVA 1NSTA 2VV6A 4G5GA 2D3WA 4RKEA 3PVSA 1E69A 1VPLA 1AGRA 4Q1BA 4US1R 4A92A 1QBKC 2AWNA 2WKPA 4Q1FA 3VKWA 4C4PA 4MRSA 2J7KA 3KL4A 4BFSA 2GRJA 2YC2C 4QNRA 1G5PA 3EZ9A 1PLKA 3P1JA 4A0GA 3GLGB 2AKYA 2Q6TA 2X2EA 4FD2A 2FH5B 2RGXA 3AP3A 3MAAC 4I3IA 1XWIA 1P2UA 3A37A 5KYKA 4M1TA 1N0VC 5KOYA 1E0KA 1VCMA 2HYIC 3F3YA 4AYTA 2REXB 2NTYC 2Q3HA 4EPRA 3L8ZA 4G5QA 2Z5FA 2XNSA 1G5RA 2A78A 3C8CA 2H92A 1PVOA 4FMCF 3GLIE 3HJNA 4WN5A 5BYJA 2GVDC 5DKKA 2IUTA 4MUBA 3D72A 2OM2A 3JVVA 2QPOA 1Z22A 2E9SA 1KK3A 3Q5DA 3B1ZA 1GILA 4M53A 4W5HA 5AJZA 3VHXA 4KI0A 2V1BA 2V9AA 1FP7A 4HLUC 3BRWD 1YQTA 1YVDA 2BJVA 3QVVA 4AC9A 1LSXA 2HXSA 2JJ1D 3HP1A 3SOPA 3CWFA 4JLBA 4LRXC 4DIEA 2BV3A 3THOA 4B75A 1DTSA 4KU4A 5KU1A 3UE6A 2XNDA 1TQ4A 5A4JA 1VG0B 3VR1A 2ZTSA 1N0WA 1XEFA 3AVOA 2CHQA 3SHFA 2QJ5A 3BWLA 2OESA 4Q66C 4TMZA 2IF2A 3SJCA 3S1AB 3BB3A 2FZ4A 3MWKA 1S0UA 2XZPA 4TN1A 4G3XA 4NXBA 4F3LA 1Z6GA 5DYGA 2ZYTX 5HD5A 3AVXA 1YZUA 3SZRA 3SDZA 1A4RA 5EE0A 3K9GA 1GDDA 2QE7A 4Q01A 4RJLA 4L9SA 4NKRA 2D74A 3UMDA 5FTMA 1XEXA 2AFHE 3AKEA 2ZSDA 4Q4LA 1GAJA 1MO4A 4GOXA 4MUAA 1RVDA 1RJ9A 4OL0A 3MWLA 4DEYA 2F1IA 3AUXA 4MGZR 1Q1BA 5JHHB 3EW9A 2HJVA 4I1UA 1SVLA 5C4GB 1DADA 2BJWA 2GZAA 2A5YB 1P73A 3ZS8A 3FKSA 2GAAA 2F43B 1RYFA 4OI1A 2WJVA 2W0SA 3LVRE 3CX8A 1KI7A 2IA5A 2PEYA 2QORA 4WZAE 3MG9A 2C03A 3F0TA 4ILEA 4PQRA 4LRYC 2ZRBA 1XJ3A 4TL6A 121PA 3RS7A 1XTRA 4LHVA 1EWQA 1HV8A 2W6IA 1ZUNB 1W4BA 2BWJA 4PAQA 1N5JA 3NHBA 2ERYA 1OJ5A 1XF9A 4DLUA 3ZJYA 1NVXQ 3TR5A 4EFLA 5KHOC 1BO6A 1DRMA 2B92A 1WB9A 2G1KA 3VR5A 2KI5A 2ZJ8A 2D2FA 5SZJA 2YWGA 5AVEA 3DMNA 3AEZA 1SXJD 2GNOA 3T1VA 3K0FA 1S4RA 3W8RA 2QQ0A 3KB1A 1AS3A 3BH0A 3U7EB 3K09C 1VTKA 3AGQA 5C18A 4K08A 1ESMA 4MH0R 1YZGA 1N25A 3EX7C 1EFRA 3LW7A 5C1BA 3IILA 5JCPA 1JQLB 5FOXA 1EFUA 2CNWA 1TEXA 3OIVA 1G4UR 4DLZA 4LBYA 4XT2B 2ZRGA 3A4MA 4I1SA 5E4FA 3NH6A 3B13B 4EETB 4TLBA 1PLJA 1LF5A 3TE6A 4G5OA 4R2IA 2H17A 5FL3A 3FVQA 1NIJA 2GBLA 1LFDB 1U9IA 1FMLA 1KI1A 4BLPA 3KKPA 4EKDA 3FKQA 1I4TD 3K9HA 2J87A 2ZIAA 2ZXUA 3Q72A 5G4ZA 3U4QA 4DUGA 1H8EA 5BXQC 4RD6A 2UKDA 5J4HA 1M6NA 2QM8A 3J81k 2RGNC 1UM8A 3DEFA 2WSSD 5EP1A 1ZRHA 3X1DA 4IDPA 2ZRNA 1SULA 1JBKA 2BEJA 4CYMA 2VF8A 2KBFA 5JWOA 2QU8A 3I8XA 3I61A 2O52A 1X0OA 2O0HA 1CU1A 5CLLA 2FGJA 2J0VA 3L0SA 4FXPA 4OHWA 2OUKA 2GCPA 3G0HA 1OTBA 3R7WA 2VP6A 4C7OB 2K7SA 1IN7A 1NJFA 4ERNA 4JGOA 4FCVA 1Z5ZA 5B2ZA 5JCZA 4GMXA 3TLXA 2RHDA 4HLCA 3WP0A 4Z51A 2OV2A 2V1AA 3LIEA 4B6FA 2M1CA 2IHBA 5DHFA 3E4PA 3KFXA 5TMPA 3OEED 2OAQ1 2QKPA 2GVZC 5LB2A 3F5FA 1P75A 1S1YA 3GLIB 3N2EA 1SVIA 2NO1A 2BMJA 2CVFA 2R6GA 2ZAOA 4PPNA 4QG7A 2X19A 2JLXA 2FN4A 2WJYA 4C0HA 5TARA 2EA9A 3Q8XB 5AWFC 1LVGA 2VP9A 1NWZA 2WAYA 1OIXA 1LSWA 3G82C 2CL6X 4OJQA 5DJUA 2V1XA 3A1UA 2ZRCA 3MRSA 2ZI9A 2ORIA 3F1OA 2ZRIA 1KI8A 4B3CA 3A4NA 1HYQA 5JRJA 1OHHD 1G6HA 3T15A 4I81A 4B3DA 1Z29A 4IDOA 4CEIA 2J0QA 1X6VA 1T9HA 3B78A 1LV7A 4OYHA 2ZS9A 4NXFA 3BFVA 1P5ZB 4RY2A 1ZBDA 2A2ZA 2DFTA 3I92A 4K81B 4GSYA 5KSYA 1TAGA 2QGNA 1E2GA 4EQ6A 2OSBA 5HZHA 2NPFA 3IS2B 1X8LA 5FOVA 1EFCA 5JHGB 1Z0AA 4RQ9A 3HDTA 3WYAA 2W0NA 3QKSB 5JWHA 3GLFA 4PKYG 3KKOA 3UWKA 2A5JA 4Q1EA 5EUQB 4E04A 3EIQA 3ZLJA 2VP5A 3LX8A 1A1VA 1XZPA 2FFQA 2F1RA 4RZ2A 1YE8A 1UGUA 1T5IA 1XXHE 1T91A 4WOPA 3SI7A 3HJIA 3LUQA 4HDQB 3VNVA 1E1QD 5GJVC 4JVLA 5LB4A 4TZ0A 4HUQB 2QWSA 4A4DA 1Q0UA 2VHJA 1AGPA 2IK8A 3W5JA 2A7QA 1L7VC 4WA7A 2A24B 3NHAA 5EZ6B 2ZI4A 2KB0A 4P32A 1NY5A 4R2HA 1S2MA 4Q00A 3KQNA 2VA8A 3IGFA 4PO8A 5SZKB 4ZI2A 4KFUA 3MSXA 3VNUA 5FTKA 2MSDB 4O2LA 3K3DA 3NBYC 3TNFA 4PPGA 1XJ0A 3RAPR 3BXZA 1R5OA 5B57C 3DDCA 2O0JA 5FBVB 4ZDKA 1BYUA 2HCJB 3C7KA 1X1SA 3PUYA 1SXJE 2H8KA 2QTFA 4LI0A 4OI0A 4QRHA 2GXSA 3C15C 3X1YA 3LBNA 1FQKA 2ZJZA 4D4JA 1AN0A 1KK1A 1SVKA 1OW3B 1Q1ZA 2FEMA 4O0MA 2D01A 1YJ5A 4A1FA 1OIVA 2IUUA 3R8CA 4BEBA 1EGAA 1S96A 1Z28A 1Z06A 4Q7KA 4BLTA 1OTIA 1GM5A 2PD8A 1W0KA 2INWA 3HPQA 5FTJA 1W4CA 2H28A 1VCIA 2JIZD 5D3QA 3V9PA 3ECCA 3QQ5A 2Z4RA 1MRSA 1VYTA 2BMDA 3QUSA 5EXPA 2FSHA 3MCAA 1I4DD 3AUYA 4HB0A 4JMPA 3I32A 4KSCA 4GW9A 2YJTD 3KUDA 5E95A 1L4YA 1U81A 4RZXA 3Q3JB 1HE1C 2GWHA 5IHPA 1UEJA 2RB4A 4A0HA 3VR3A 3SYNA 3L0IB 2MMCA 3FE2A 4CEJA 2QAGC 1KSFX 3IBYA 4HZUA 1TS8A 2XSZD 3CWZA 4CEHB 3NWJA 4D6PA 1DVRA 5FTLA 4PKYA 4NYJR 2H16A 1EFTA 3RANA 4URUR 4C30A 4DSUA 2JLZA 2GF9A 1N6HA 1NG9A 1WQ1R 4HQAA 4LBZA 4OQFA 4IDHA 5LD2B 3LDAA 5L3SA 5F3WB 1E9RA 5AK0A 1OLOA 1T1CA 4JLMA 2R6AA 4F7WA 5JMTA 1IY2A 5BWMA 4BASA 1US8B 3U44B 4LGMA 1OFIA 4GZMA 3ZS9A 5BYKA 1GKIA 2P65A 3FOZA 1ELOA 4D26A 4NP6A 1MV5A 3CRQA 4RD1A 4BLRA 1O87A 4JL6A 2XNDD 2V0WA 2ZPTX 2BC9A 4Q1DA 5AUOB 3IPYA 2UVQA 4NBSA 4HJ3A 4WIAA 4B35A 8OHMA 1H65A 4RVCA 2NO0A 3BIFA 4XD7A 4DB4A 1AM4D 4QKQA 3OFND 1OB2A 1SXJC 2IYZA 2WWWA 2ZI6A 2QQEA 1YZKA 2QGZA 5E7JA 2G3YA 2L0XA 1D5CA 1Z3IX 3QKRB 3ZZTA 4OHZA 3AVVA 4AYWA 1N9LA 2ZRFA 3KJGA 1NBMA 2GJKA 1CJKC 5CLQA 3NBFA 4IXNA 1U0JA 2QNRA 3U6BA 1DOAA 1JXOA 4TYWA 4LOAA 2CDNA 2IYWA 3U3JA 4PQYA 3T12A 3WY9A 4GHIB 4B44A 3A6PC 1R6BX 3BAFA 4Q4AB 3DM5A 4WXRA 2CJWB 1RYHA 1E2MA 1A5TA 1E2IA 3QENA 4BFXA 3ZGXA 1SGWA 5EE3A 4KITB 2J7PA 3P32A 5TVKA 2KX6A 1SKQA 3GFTA 3QIAA 1DO2A 3T5DA 1XNJA 1G8GA 3PV0A 3BGWA 4YLGA 1ZUHA 4EQ1A 4CZ2A 3QKRA 4BGDA 4TTQA 2KE5A 2NZJA 3CF2A 3ND8A 4QBIA 4EXOA 1E1RD 1UBFA 4B33A 1MO6A 4PC3A 4E07A 4HYYA 2O8BB 4A6XA 2YVUA 1P9NA 4KFSA 2O8DB 3VE3A 3NDBB 4Y0AA 2Q9AA 1NBME 2ANBA 3U3MA 4XSHA 1ZM2A 3EXAA 4KYUA 1JXMA 4JVNA 3TRFA 4HB4A 4DDWA 2I3BA 5JSZA 4ZKEA 1MABA 2GCOB 2VEAA 1DAGA 3OIUA 1V5WA 1XZQA 4XVUA 1F5NA 1HEIA 3N70A 2N1BA 4TLEA 1KMHB 2O8FA 4OQNA 1GNRA 1GTVA 4TSFA 1IAQA 4DLXA 1NVWQ 4R71A 4D4LA 1AS2A 3CLVA 5TBMA 1QG2A 2OXRA 2TMKA 3A8TA 2IXEA 3GLHE 2YINC 2V6IA 4C2TA 1KIMA 2A5FA 3BH7A 1P3JA 3EPKA 3P4YA 1II9A 3BFXA 5TXGA 4DT1A 4A0FA 4TYQA 2CE2X 1D9ZA 2C9CA 1LL8A 3LI9A 1NMZA 1ZNYA 1XMJA 2YV5A 1N6PA 1NI3A 3ADBA 4MKFA 1XMVA 4II7A 1Q57A 5JS7A 2QAGB 3ZZ0A 1X86B 1WCV1 1KSJA 1TQ6A 2OO7A 4FIDA 1ZD8A 3QPVA 2ONJA 4B6EA 4BWYA 3NC1C 4HI0E 4JT2A 3A36A 2HEIA 3FFBA 4TLDA 3W3ZB 4B32A 3U60B 2ZR7A 5AJVB 1PZNA 3EC1A 5FOSA 3K0AB 2QBYB 1KOFA 3DL0A 1ODVA 4PSKA 1T19A 2YOGA 4TYYA 4YC7A 3DM9B 4PAMA 4WXPA 4B2PA 4TT3D 3FYHA 1JEEA 1SHKA 2PX3A 3DMDA 2BIFA 3KJEA 2Q3FA 4RSGA 2ONKA 4AKGA 2PH1A 3SQXA 3W3AA 4F4CA 1ZD9A 2QBYA 4Y0VA 2QPAA 1S1CA 4KJZA 5F68A 2ZJ5A 5JEDA 1N6OA 1LSVA 2QMEA 3X2SA 5AUNB 2A30A 2VO1A 1GRNA 1W49A 2GEDA 2ZYUX 3LVQE 1GNPA 1OH8A 4AD8A 3LW8A 2IYLD 3UB9A 1R0WA 1CKEA 4ITRC 1GKYA 4NCHA 5DI3A 4ZDJA 1H8ED 1YR8A 3DKPA 2WIAA 4GP6A 2WV9A 3X1WA 4XJXA 5L3QA 3TSWA 3AH8A 3BC1A 3EWKA 4HLDA 4Q4HA 3THXB 3KXIA 1YZLA 4TL9A 1YRBA 4MGIR 1MT0A 4EIWA 3AKCA 3I5XA 3BWDD 4KLZA 5JI3E 2OBLA 4M21A 1WP9A 3EWSA 3K09A 821PA 2ZS8A 2GJ3A 4G1UC 1S3GA 2FE4A 2FEOA 4O2RA 3UG6A 1KJZA 4IVPA 1LNZA 1L4UA 3BJIC 4IHQA 4C2UA 4TMXA
chains in the Genus database with same CATH superfamily
4V0NA 1J1UA 1UZUA 5J23A 1JKXA 4MRRA 5A4KA 5CB8A 1LBIA 4Z7OB 5KYUA 2R65A 2C3MA 1L5VA 3HYTA 5H59A 5KTSA 3K94A 3VP2A 3AETA 5LZ8A 3SFTA 3QFHA 4NARA 5EQFA 2GD6A 1BJTA 3CEHA 1PLLA 3NOUC 1E9SA 1L3LA 3AI2A 3PYXA 4MB2A 2WAXA 2H5EA 2ZM6B 3I4FA 1WSAA 3VTKA 1UMCA 2F64A 1FNSA 3NHRA 1E5VA 1NVEA 1VLHA 2C5EA 2DJIA 1NR7A 2ZUUA 4XEHA 3RVLA 1UP6A 5BSFA 2XYQA 5CLGA 3BECA 4G5RA 1M2FA 1AUOA 1EFAA 4HSGA 3ROTA 2Z2MB 1EBBA 3SZUA 1Y28A 3THWB 3DMTC 2GBCA 3NIDB 3K5IA 1JAHA 4LWQA 2M1XA 3WRZA 3GRCA 1NMXA 3IKLA 4N7JA 2HHCA 4C4SA 4ZICA 4TTRA 5M18A 1O58A 3OKAA 3H5OA 5BWBA 2CJWA 5L4SA 4Q3KA 2HRCA 2QTRA 3O38A 3ABQB 2PT6A 3KSUA 3WV5A 4TSRA 1NBMD 1VSVA 1N2EA 3D0KA 3FTQA 3FNBA 4E6PA 3S29A 2XUPA 3SQLA 4O7DA 1FFBA 1KJWA 3M6LA 5CVEA 1A5AB 3K3CA 4V1CI 3CUUA 4G8BA 3HO8A 3JAWB 5AW4A 3AX6A 4D8VA 1IG3A 1PJ4A 2FPIA 4WW0A 3T94A 4MKZA 1ZH0A 4K6FA 1EG2A 2R96A 1Z39A 3R9IA 3W8NA 4E11A 3P71T 1IVNA 2FF7A 3AO0B 4JXJA 1V37A 2Q0HA 1JQEA 1LC3A 2QAJA 4TSKA 5HM8A 2O3QA 4XWOA 1E0AA 2VC2B 1C14A 3JW8A 4Q3NA 4NQRA 1Q92A 1Y4UA 2D1TA 3FBWA 2ZYAA 2C78A 3T35A 2HLDD 1IYPA 1VJCA 2PZEA 4AY2A 1QVZA 3DFFA 1JPNA 4U2CA 4DIMA 4YPFA 5K0EA 4LYGA 4YFVA 2ONYA 2AD1A 1M8KA 1SUEA 2EIHA 1VETB 3MGCA 2CXNA 3UANA 1XIVA 1BMDA 1QUFA 4CF3A 3M83A 2GN6A 1VKRA 5AVXA 2MR5A 4J16A 3P4XA 3R3UA 3AKZA 3V4SA 2V7QD 4XIGS 4WCVA 4H60A 1N5KA 4IDDA 4N18A 5JLAA 3VR6H 2ROQA 3DLBA 4QGAA 4F0JA 3GNTA 3OE7D 2PHZA 2ZYGA 4LHXA 4ZVQA 4ENRA 4W5RA 3LOQA 1GNQA 2VQ6A 2O6HA 1BNCA 1EB9A 1USGA 2YXLA 3UE3A 3F98A 3L4EA 3V1MA 1L5GB 3A1NA 2EG5A 4ZHSA 1VPWA 4PHGA 8GPBA 1RSZA 4YQFA 1DY6A 1WOYA 1EUDA 1AUQA 4TVBA 3LICA 2I3DA 1G63A 3GFVA 2G2WA 2VV7A 1C7ZA 2DTEA 3SVZA 4P4NA 1NUQA 1PR9A 4YO7A 4G5YA 2DPHA 4JVSB 4XT2A 3AB7A 3ZW9A 1A50B 4LECA 4YCNA 1L7MA 2DQ4A 1GNSA 4JI6B 3VHQA 4AS3A 4RXUA 3ICQB 2R8EA 3LECA 5EC8A 3EGEA 2GJSA 3ORHA 3ZVNA 1A3CA 4YK7A 1LDGA 3NIGB 2W3EA 1RQXA 1Z45A 3KUUA 3L79A 4BE4A 2PG3A 4L0QA 4H6XA 3DW0A 2DFLA 2E18A 4LRUA 5IWAB 4GYKA 4BRUA 1FMCA 4RAQA 1BJRE 2WT4A 5B58C 3EUAA 3L43A 1N2HA 2Y1GA 4F2WA 2UXCB 4UM7A 1P5JA 5FWXA 4KXLA 1WXQA 1VE1A 3LDHA 3MCTA 5ES4B 2CXTA 4BVKA 5LOVF 1USVA 1NKTA 2VAWA 2PMCA 3FB4A 1A0OA 4EU0A 4LCLA 4IL5A 3BIOA 1W2GA 4G24A 2QRUA 5G41A 3Q7VB 2WPNA 3WVNA 2BGMA 5B1HA 1T0UA 1O77A 2O2JA 3H2BA 3TRHA 2HX1A 4D8YA 3RTEA 5B30A 1KXJA 1MPXA 2WUEA 4HYQA 4XCXA 1UOOA 2QN6A 5IDVA 3STVA 2GASA 3BMNA 5IT5A 1NLFA 3ZY4A 1H69A 2CJFA 1LX6A 4IV0A 3GUUA 3UGJA 2FLWA 1N1GA 1N4OA 2LDXA 3KXKA 1FYEA 1VMIA 3A11A 1QAOA 1L5ZA 4MUGA 1JRLA 3EAFA 1QGAA 2J41A 1TMOA 5EV0A 1HC7A 2OSUA 3IOEA 4R5MA 1CR1A 3MLEA 4IO1A 5JSQA 5JD6A 2HNKA 1K0UA 3IQEA 1UMKA 4H15A 5D1HA 4B45A 1ZH8A 2Q1WA 3AIMA 2SNIE 5AI8A 4F86A 1U1IA 4Y2YA 1HTBA 2AE1A 2EP8A 2VSOA 4UCFA 4LDZA 1W1WA 1DJMA 3IP5A 2QRQA 3LCCA 3VYTB 5GP1A 2J0SA 3WYNA 3IX3A 2Y2OA 3C7UA 1ES5A 5DNWA 3CUEF 3WXMA 4Q18A 2JBHA 2WKWA 2OBMA 4GDNA 2IY9A 4PQFA 1Z4NA 2NWQA 4YFMA 1IOLA 1U3WA 3EA0A 2FU5C 3MAJA 4IO0A 2OXEA 3C8DA 4TYPA 2PXHA 1YA6A 4KIGA 3MFXA 5FXMA 2VGLM 1ZJ4A 1X80B 1OYWA 2PGAA 2AL7A 4ZODA 5GVRA 4BKQA 5CEBA 3RVPA 3MPUA 3OY7A 4FNOA 4X1YA 1JWZA 1EVJA 4FTWA 4I1IA 1I24A 3ZQJA 2Y1WA 3EGXB 2XOEA 2V9PA 4EJSC 3IXBA 1NQUA 621PA 2D1RA 5IKEA 2RHJA 1JE0A 3KOUA 1GTG1 4Q9LA 4YLYA 4IHJA 1AXBA 1O7EA 1NP6A 1GO2A 2A35A 4K0RA 4KTTE 5E0KB 3Q7VA 3OVMA 3T1SA 2QTCA 5IKOA 1PNQA 3VC7A 5ALVA 5MN4A 4FUWA 1C9KA 1VL1A 1JH8A 2LNDA 4IICA 3LPAA 1BU5A 1Y1KE 4PZZA 4CQLA 5JNLA 2J0UB 1A8UA 1XTBA 3FCOA 3L8HA 5ITZA 1M7BA 3GQBB 1Q2PA 4XJTA 3IA2A 1UKVY 1E3TA 1M74A 2IL1A 2NPIA 1G28A 1VXRA 4O63O 3OIGA 3AFMA 3QXCA 5AUQA 5D00A 1MVLA 3RE1A 4HX2A 3ROGA 1E2KA 4LZJA 5I9MA 2KQUA 5DV9A 1W79A 1AZLA 1Y1QA 4KN5A 4PS1A 1F14A 1MG0A 1VGQA 3AZQA 3QEKA 4I39A 4EBBA 5H3HA 5A4IS 4K87A 2BEWB 1LVUA 1OV4A 1QVWA 3SJUA 4C04A 5IJWA 3E3LA 2VJAA 2H5LA 4C7VA 4A6DA 5KAPA 3OAAA 1D8AA 4NZOA 3TS1A 1XU7A 2F3TA 5K0GA 1T2AA 3PXBA 3RJ9A 1TQHA 4CPDA 3AVTA 1XP8A 2QPLA 2IHUA 3EXG1 4MTCA 4R9SA 4RHUA 3LIAA 5ALIA 3PUXA 1YLWA 2VJYA 3PJFA 3FHCB 3RIYA 2CJPA 3VHRA 1TS7A 3AHDA 1MB4A 2O7QA 4I9HA 3Q7ZA 2O8VA 2P9BA 4LS3A 5FASA 3IAS6 5KCZA 4RTJA 4DN6A 4P5EA 1BCSA 4C7OA 4PTZA 3U1BA 2F2TA 4KYVA 2XQIA 5A0FA 3KAQA 4WCFB 1LZKA 2R6ZA 2W48A 2IYFA 3PI7A 3QP8A 1KMHA 2FSVC 5IHXA 4AJHA 1FRNA 2HV8A 2AN4A 5BUQA 1E32A 2IWCA 4WJLA 2E48A 2EZ9A 3ICVA 4HQKA 3QYFA 2OBNA 2OWHA 2Y2MA 4U63A 1T34A 1KVTA 3D4LA 2PR2A 2B94A 1J0DA 3CZQA 2PHYA 4TYNA 1HLGA 5EJAA 3CZCA 1UBUS 3U3RA 2ZYWX 5F12A 2R8ZA 4K6GA 2C5WB 3WGJA 1FR1A 2P9GA 2PX5A 1NM5A 3BCUA 4RENA 5F1KA 4BVBA 3A1TA 2XY4A 1M2JA 3IKJA 1ZONA 2VTBA 1D1TA 4CDGA 4QUHA 4B7ZA 5LZ9A 1TADA 3G5TA 1JE1A 2WVJA 3UN7A 3DCYA 3R7DA 2FPIB 2XGJA 1DZIA 1NFQA 1IRXA 3P4UA 4ALIA 4D02A 3RUCA 3KYZA 3E23A 3KK0A 1JLLB 1T8RA 4IIVA 3TTTA 1R4NA 2FP4B 2QMQA 4GAEA 1E6LA 2CNWD 1BVUA 5DYYA 3F73A 1GG2A 4RVHA 4JC8A 1RWQA 2EARA 4Y2XA 1Q74A 4A2PA 2HWWA 3R44A 1KO8A 3QLJA 4WY8A 4DJTA 4F5DA 4KDFA 4EUKA 1E99A 4DBZA 1YHZA 1FSFA 3EVTA 5GONF 4YJKA 4MIOA 4UA9A 4OGKA 3HLWA 1OWMA 3BYZA 1KE0A 1TZJA 1EWYA 1PTJA 1TVMA 3CSUA 2J9FB 3SOIA 3D8RA 3H6GA 4I55A 4BRSA 5LQCA 1JEYA 1HE3A 2PPVA 2VJMB 4TKUA 3I2HA 2JIQA 2J3DA 1BEZA 1ZR4A 4D0SA 2A6PA 2ZUBA 4LMAA 3N6XA 5AKJA 4MHOA 3O4IA 1EJ2A 3G02A 1Q6YA 2GCIA 3M4ZA 3LEQA 4A2CA 1SQFA 3S3TA 4HG2A 4Z1MD 3STUA 4Z7JA 3LLSA 2AXNA 1K4FA 1O6BA 1SURA 2OY0A 3MIZA 1RIIA 1Q0ZA 3K9NA 1OHHA 1X87A 5C81A 4L27A 4JYAB 3EDMA 4MKHA 4MVJG 3PUZA 3BXEA 5EP2A 1Z6YA 1SNYA 3COPA 4CFYA 5EFWA 4KQ1A 2AN5A 3QELA 4MW9A 4FFWA 1PX0A 4S3MA 2NN3C 1C1DA 3TMKA 4GMDA 1U1FA 2P11A 1D4FA 1ZOPA 4UEKA 3IAM1 3VC3A 1F2TB 1EINA 2AJTA 3LMKA 4AZ0B 4RF5A 4DQVA 4KMOA 5FFNA 5CVUA 3RU7A 4C29A 4DN0A 1US8A 2PMEA 3U44A 5BXYA 3GL9A 3GW8A 3Q6NA 1BMTA 2JKZA 3HSSA 2EQBA 4C7BA 3LHFA 3ODPA 1YCGA 5TIIA 3L18A 3TECE 1IBLB 4QDKA 2JH3A 2DBQA 2E5FA 2I6GA 5IUNC 3WGHA 1ENPA 2D4AA 1T3LA 4WMCA 5TJHA 2VHUA 4D56A 1GR1A 3NANA 2JFQA 3RSOA 1VL5A 3I3SR 3T1QB 3HNOA 4LDPA 1VJRA 3ITAA 4PHCA 4TRNA 3EEHA 2XRMA 2V8FA 1RXUA 2IZ5A 3ZVMA 3B1YA 3OJ0A 1NMEA 3V8MA 1T0BA 3EHDA 3UBTA 1SBTA 2WB4A 3MHPA 3U7RA 2ODBA 3UCEA 5CGSA 4ARSA 5HKKA 2QJOA 4I38A 1UDBA 3F6SA 3JSXA 3OPVA 4KLCA 5K05A 1T6YA 3FWNA 3ZY5A 1OFUX 3T3NA 1RXCA 4TKVA 2EZTA 1A8IA 1ZIXA 4DWOA 1YAHA 2YUTA 1T1IA 2G83A 3LXXA 1ONPA 4MRAA 1Q7CA 3ZD7A 1DWQA 2I9KA 2RGEA 1BROA 1U7HA 1XN4A 2EOAA 3H1TA 4GLLA 4YASA 4YJ3A 4DDSA 1L3IA 1RKVA 4PXSA 7ADHA 4ZFNA 4LCBA 2J6IA 2VA0A 5BORA 3ANMA 2V74B 1R0KA 3F7TA 4WNYA 1T18A 3IO3A 4UEYA 1JEQB 5F23A 3TRIA 2A9VA 2GLTA 4XASA 1TU0A 1JJ7A 3A4IA 5ESRA 3E7XA 1T4CA 3FWPA 3WBJA 4EF6A 1GGMA 1SQ0A 1UWVA 2MSWA 4P34A 3H5VA 5FD8A 3CPTB 3GDIA 3LIDA 2DUWA 3FF4A 1PT5A 1YZ3A 1RGYA 2AFIB 2QR3A 3S81A 4DUYB 4QBKA 4JD5A 3NYWA 3ER9A 4AKHA 4YGXB 1RPTA 3TZCA 4E2WA 1QUEA 2QWXA 4B84A 4B3SB 4QT0A 5CB4A 2YV1A 1KQOA 3AZPA 3SM3A 3NC4A 4EH1A 1QG4A 5KTTA 4KHPB 2BCGY 4IG9A 3KYCA 3L77A 5DGXA 5K1ZA 5GADl 3ZNNA 4P4SB 2OCPA 5KUTA 1U2EA 1NJ5A 3JARB 1SCBA 2WG1A 3LE8A 2HAEA 2ZT6A 3E9EA 2ST1A 2C92A 2XDWA 5CVVA 2WD9A 5J40A 4BCCA 1I8TA 4L5YA 2M2IA 2PBLA 1TCVA 1NMYA 2ZYRA 2IY7A 2E8IA 2ABWA 3RVMA 3S55A 1R10A 2BVNA 5IUJC 3PD7A 5KNBA 1JDBC 1UJNA 3QU7A 1GZ4A 1KBZA 3W8DA 5EP4A 4C6TA 3O47A 4G0WA 2FPGB 1C30A 2QTAA 1COWA 4XJVA 2BDTA 1FFSA 1OE0A 1X1QA 3N6RA 3UG7A 4E03A 5D5PA 2EBFX 1YMQA 4OV6B 4EYSA 4M3KA 1J7JA 3EBPA 4L4ZA 3G23A 3ECAA 5EVJA 5J4KA 4FJ0A 4XDYA 3NNDA 1T36B 4NYIR 1JAIA 2J7PD 3CCCA 4Z0PA 1CBUA 3TZLA 5LDHA 5CFZA 3E5RA 3ESQA 1T0HB 2C9BA 2FUNB 2XF2A 1P1BA 2O3UA 4RZ3A 2OAP1 1QOPB 1PU2A 1B00A 1AUPA 3BD7A 1CIVA 1K57C 4FT4A 4PZCA 4RABA 3RIMA 3S5UA 4O4HB 2PD3A 1IWPB 2CHGA 3GEMA 1EVIA 1C8VB 16PKA 2PXCA 2VAPA 3OE5A 1FMJA 5HIKA 2VRNA 1JR3A 3CMCO 4M2LA 1XTJA 4IQ4A 1A2BA 1TK2A 4L0DA 4NG2A 5DWVA 4MAAA 3GJTA 5IVIA 3IQDB 4BUCA 1O2DA 2IEIA 1JHPA 1RS0A 4YACA 4O8GA 2EF0A 2V7GA 5L09A 2VRBA 3KQVA 1OZFA 5AM2A 4L9EA 1ZITA 4UM9B 2D1SA 4DZZA 4E5DA 5BSWA 4QU8A 1DJAA 4XH9B 4EHIA 1UFRA 1QG0A 4PSUA 1ODIA 4AMYA 1I1HA 3BVPA 3UDXA 5DF7A 1E1CA 3GT4A 4RPKA 4BVGA 2VDOB 5LQJA 4DE3A 1TDJA 1EVYA 4XVQA 3U62A 3CVOA 4E1BA 5D5HA 1MBLA 2XR0A 1AKWA 1U9YA 1ZD1A 3PUWA 1GFWA 5ED0A 3EG9A 4LAFA 5ENZA 4ZRNA 3HUTA 4G09A 2Y99A 3KKEA 4OQZA 4HAWA 3KEGA 3IURA 4KJXA 4QSMA 4DMZA 1M6HA 3I8SA 4JKIA 4GVPA 3WJAA 3ORFA 4I4CA 4WECA 5FPSA 5LWQA 1ECLA 1FVOA 2RH4A 3WK6A 4IV8A 2D2VA 1MR3F 1LD3A 2F4NA 2A0FA 2BEKA 2FPPB 2FVYA 5FFFA 3ZTYA 4KQIA 3GRFA 2AUNA 1MUUA 3R3SA 1DS6A 4P0MA 4EF4A 4DW8A 1QX3A 1G0NA 1UJ6A 3AI7A 4UVDA 5AMXA 1G3MA 3MCWA 1GITA 4OY3A 4ZV7A 4AJ2A 5IJAA 3I2YX 2IX9A 2W00A 3K8QA 2Y66A 3B5EA 3UF0A 5FEFA 3GCXA 3DZKA 2WM9B 2IXGA 2PUCA 1Z3CA 2BFCA 2RBEA 2YMLA 2HA4A 3CWCA 3REFA 2BHNA 3LO8A 2QGFA 1XTQA 3EAGA 4PCLA 5DYTA 3ZD8A 1RRMA 3A0VA 4LRWA 4HESA 2BHRA 1Y5NA 1IU9A 3QNCA 2YCBA 5HM6A 2HSZA 3PFKA 1U9IC 1O94C 4ETWA 4GZ5A 5M04A 5JW6A 2AYXA 5LBRA 3RM3A 3N58A 4Q0MA 4LC9A 3F90A 2C97A 4P3YA 1SHVA 1JDZA 5BYAA 1QJCA 2EFJA 3BZBA 4FK8A 4BGEA 4G0UA 4OFBA 4ZYLA 4ZVNA 3FKSD 3ORQA 1RD4A 2HP5A 3CNLA 5KTNA 4PZAA 1OUMA 3JQBC 3E3NA 4ZCTA 3SEAA 3IYLW 4ZI7A 4DJ3A 3CNQS 5DGTA 1NTRA 1QVAA 4RMJA 4WZ6A 4LE0A 1QP8A 5AVQA 1IM5A 1BCRA 2QVGA 4JBNA 4DA8A 2HHHB 4COOA 2BFNA 4JGPA 1BVYF 4LYAA 3U61B 4DZRA 1PFLA 2O3SA 4FTXA 1XCPA 2VYCA 3GCDA 3OZXA 3F9RA 3RYCB 3IE1A 3NHYA 5AI5A 3I1IA 1ZA2A 3BGDA 1K4EA 2XF8A 2VJKA 4K46A 4D3ZA 5LMUB 4JJGA 4BX9A 2OSVA 4JCCA 2E21A 1A88A 1Y5LA 4YI3A 3IESA 5C1OA 2OQRA 3BJZA 4QQ8A 2ZYVX 5FR2A 5F73A 2UVDA 4X71A 3I12A 5FPPA 4CJXA 3IBCA 1F1JA 1PJBA 4FOLA 1CE8B 3I58A 3PUHA 3RKRA 4RULA 3SX2A 4R8LA 2YJ5A 3FUXA 5H83A 4BFLA 2GNPA 1YDFA 5CDUA 4MW2A 2GZ2A 4BB6A 1CQPA 2H1LA 2NTEA 1UODA 4Q03A 1CUZA 1JDTA 3BFDA 1H8HD 1KH2A 3ASUA 3PNVA 4GP9A 3DONA 3ZDRA 1QQTA 1RADA 4RETA 1KDYA 1YIOA 3THRA 5HBRA 5KPJA 2QSUA 3SQMA 4BEWA 3LRTA 3G9XA 3DZ8A 5BUZA 4BP8A 5HGJA 4EECA 3DVAB 4WKCA 1DPFA 5LFAA 1HQKA 2FG7C 3D6AA 4D2IA 3BSWA 2KHZA 1UZLA 3GEEA 3UPDA 3UV6A 4YNRA 1KU0A 4KZ7A 1ZGZA 1FFDA 2ACKA 2FZ5A 2QRVB 3B9RA 3GOHA 4FILA 2FSGA 2PU4A 2E6UX 4NEHB 5FI2A 5L07A 1EVKA 1JNYA 1QDLB 3GNSA 3I1JA 4ZT6A 4F6RB 1SJ9A 3WC4A 3IDSA 3PQ6A 1T0PA 5JASA 3DDUA 1XKZA 2G7UA 1PI3A 1M34E 3OLYA 1VE9A 4Z9BA 1DB3A 1G4AE 4Z3DA 4JGRA 4YN3A 1HDZA 2WSLA 2P6NA 3O4FA 3EA5A 1WHTB 1BD4A 4G0PA 1Y1LA 4CMIA 4IS3A 4PLWA 2NVUB 2VNJA 1QHXA 4EKIA 2EX9A 4FN5A 1EUCB 4M0KA 3GJ0A 5A4FS 3V4PB 1JU4A 2YBEA 1SEVA 2WGWB 4HNAB 4RV4A 3D81A 1BG6A 4RNDB 3IAAA 2QN2A 1XTSA 4X1IA 4P6ZM 1YMUA 1QV6A 5T4FA 2CBGA 2A3NA 3WKBA 4WKGA 4ZMRA 3GH1A 5LUAA 3IS2A 3TQIA 3PIRA 2R9VA 2HBQA 4PANA 2GYUA 3MJTA 5E9AA 3FJOA 3KO6A 4TPKA 5E4JA 3T06B 3AF3A 3PGVA 1LBSA 1QIJA 3HNPA 4GD6A 1BFDA 5A5GA 3BCHA 1Q17A 4JXGA 1XYYA 2VYND 3BWMA 1BE6A 1HT3A 2ENWA 2R60A 3GLHB 1K56D 3OX3A 1NJGA 1QLJA 1ALQA 4GRAA 3WS1A 3SP1A 4OYLA 4X1OA 5CFMA 2GX6A 1ZG6A 4NIMA 1GADO 1G5UA 2GJAA 4QZVA 1KI6B 1U90A 2OCAA 4FCTA 2V7PA 3AUJB 4EW6A 2GPTA 1TW3A 2DHEA 2QTHA 1L4BA 4KE9A 4O4JF 3HTXA 5L8VA 4Z7QB 4DPLA 2EZUA 3OEYA 1V95A 1D03A 1DBRA 4RZHA 3T1OA 4E7PA 2P4SA 1KZGB 1M40A 4MITA 1FU8A 2X9GA 3PF9A 4WXHA 5BUCA 2YZKA 5CX7A 1WUYA 1Y8QB 4Q39A 3UC5A 4G8CA 3B8EA 4MUJA 3Q1KA 4GOLD 2VNHA 3GQZA 1F9EA 2HA0A 2FX2A 4FXOA 4TXNA 1U2RA 4YX9A 2C57A 4Z54A 3KJHA 3O93A 1U9CA 1KDOA 5C37A 3V4OA 4KQCA 1AQLA 1EXWA 2QZZA 1Q44A 1LPMA 2C5GA 2FMKA 2QX7A 2ZP1A 3G85A 1LDEA 1K56A 4NCKA 1DKRA 5BN5A 3PEWA 5FBQB 1DAEA 3DOFA 3WR5A 4D9MA 2Y4AA 4JT8A 4Y1RA 2X7HA 1KBOA 3EGDC 1UOPA 3KRTA 1CCWA 2G88A 1MZUA 2QUKA 2R86A 1P2VA 1ONHA 2WP8J 3NBQA 4LGVA 5IC5A 4XQ0A 3A2NA 3R8XA 3TEJA 1BULA 3HFRA 4UKDA 1BYIA 4GQIA 1I51A 2IYAA 3HN7A 4GR5A 5IULC 2HI0A 4ETXA 3C30A 1KYXA 1OR8A 3AF5A 5EWMA 3RJUA 1XJ6A 1V16A 4UUPA 4BC1A 2CLDX 3FRIA 3O7MA 2HZ7A 4J0DA 1KGGA 1P72A 3RSFA 4M86A 4AYXA 4QXOA 2QTNA 5C7YA 3SKYA 2TMDA 1Y0BA 1D07A 4CLEA 2Z5VA 1XRJA 3BIJA 3N7AA 4Q5IA 3WWEA 5LIPA 4W5TA 3OKFA 2IBMA 1CEXA 2MINB 2CVHA 5D51S 2PRIA 1AZWA 4C4AA 5TGDA 1EXVA 4QXMA 3OJCA 2OHVA 4PX3A 3PNPA 3H42B 1QFMA 1SMKA 4CM4A 1PL6A 2VHWA 4OJKA 3S0JA 4GM1A 5B2FA 4MS3B 1NE2A 1CETA 4HDSA 4RVFA 4Z4IA 1IY1A 1XLVA 4QRIA 4LXGA 4RHYA 3H7WA 2QI9C 1N2JA 4GD3Q 3SN6A 3TLMA 1IEXA 4Z99A 1L7XA 2IZ6A 5G1OA 2J1LA 3CYFA 2RGNA 3H84A 3URKA 5FPTA 1CPYA 1V4NA 3ZGNA 4DCSA 3IV6A 5IJ0B 4LRTB 1N2CE 3I23A 4R0QA 1BKSB 1ESNA 2ID4A 3Q3CA 4PLHA 3STXA 4EY6A 1EFPB 5DHTA 1Z0KA 3FX2A 2DBYA 1ND6A 3L8GA 3NDPA 1SN7A 2WPDD 1Q6ZA 1M72A 4FHFA 1BW9B 2VP4A 1GFIA 1BDJA 2GD2A 3EUEA 1H5UA 4EW7A 4GI5A 4DCTA 5CDSA 4NAVA 1N6IA 1B6RA 1JFFA 2PT5A 3VFHA 1UPUA 3TSAA 1J5XA 3G2JA 2PQ2A 3KVNA 4DXAA 1S0WA 3L1KA 4MKGA 5C8ZA 3L4JA 5F6AA 1T8TA 5GZ3A 3V00A 4FI3F 3MJVA 4Y2RA 4OG2A 4RMGA 3EEQA 1X8KA 1UMCB 1K9VF 5IPFA 4XD7D 3R76A 4CNBA 2RIPA 4DMFA 2COKA 4S2PA 1T5HX 4AS1A 4DG9A 2WWGA 3QU5A 1YRYE 4KQEA 5KNDH 2P4HX 4JUBA 1ZXLA 4KBFA 4GHWA 1XTPA 3CO5A 3AG5A 4F8YA 4KIWA 5LP6A 1P2GA 3C4VA 1R37A 4CL8A 4AO8A 3J80A 5JYBA 2FNAA 2ZSBA 3OMWA 5F4ZA 1Q2QA 2GPNA 3NIFB 5AHKA 3I64A 1JTDA 2WFAA 4RIIA 1S2OA 1V8PA 1RXYA 1LJLA 2OFWA 2V8BA 2W6PA 3BIWA 1UC5B 3HB4X 3SK0A 4ETMA 1CEYA 5JD3A 3TSYA 4FUQA 4PGAA 3OPQA 3VR0A 2YOFA 1JB1A 3SBXA 1E61A 5DE3A 1JQDA 1CNMA 4EFMA 2A24A 4FYPA 1ZD4A 2VDWA 1TEVA 2W2VA 3G88A 4UDXX 1RCFA 1TB4A 3TCXB 5EFZA 5K6AC 3WKEA 1DXOA 4HFMA 3S22A 3T3IA 5FDFA 3WB2A 1CR2A 3VAZA 1NC1A 3W6PA 3QBDA 3PHBE 3UJ8A 2VCEA 3WLEA 2JE5A 1TYEB 5EHXA 2CMGA 4R9RA 3A3PA 4IIFA 4QYMA 3PBRA 4HH2A 4E51A 1O0BA 5CHJA 3IHBA 2OVBA 2B8TA 3QUBA 3R5XA 4H0NA 1LDNA 1Y9DA 4YUXA 4XUZA 5DI3B 1ORTA 3D6FA 5AW3A 4GZLA 4M0MA 3WL6A 4RORA 1CW2B 3TB4A 2Y2QA 1UDCA 2WHQA 2IEZA 3GLFB 2Z9DA 4JNCA 2GYWA 2V45A 4JYMA 4QY6A 1ZHOA 4OA5A 2AJCA 4GKJB 4D4IA 4RTMA 1SHJA 4DE1A 2ZOSA 3EGDB 4JX9A 2PCLA 3BWBA 5AI4A 4JGQA 5CJPA 3S1AA 3TW8B 3G2NA 3ZNPA 1G7SA 3N8SA 1YGYA 2A0KA 2H7YA 4JYBA 4ODIA 2OYCA 1H2WA 5ER9A 1Z82A 3ROKA 1LS6A 1XD9A 3CC8A 3S7NA 1P7WA 3BS4A 4MNTA 4ROSA 1ZK3A 2ZIEA 4LYDA 5D84A 1L7DA 2LW7A 3M1YA 2NZYA 5H82A 4B5KA 2JGKA 3Q3VA 4Y0TA 4YAFA 3Q9LA 1DJCA 2Z5GA 2KS6A 3H2GA 4LJ7A 4GYJA 5HNKA 1DAHA 1FYDA 1HDOA 1IUKA 2Z08A 1J8YF 2P0YA 3JASB 4L9GA 2A0YA 3KFLA 1AE1A 3A2MA 4EMSA 4F9EA 2ZR0A 4JJKA 4OHBA 4LJSA 3VNAA 1L0BA 3FKJA 3HMQA 2ODNA 4RM3A 4LSGA 3RH8B 3G2LA 3W2ZA 2HQOA 5L6MB 4AKIA 3U4LP 4C3QA 2R66A 2VTVA 3MCZA 4XOUA 4MQBA 2CC1A 3ENQA 3UATA 1I6KA 3K1TA 3PGA1 4HTFA 4RS4A 5IN5A 3IT9A 3OHMA 4N0PA 4PX9A 3LY7A 1P4RA 4TRJA 4ASUA 1M7GA 1T9DA 4MS4B 5EZYA 1WQ3A 5DKFA 3T38A 3JQ6A 2VN8A 5DOZA 3GMDA 2VSFA 2P5YA 1SG0A 4CV0A 3EIWA 1ZICA 1DRKA 1DOHA 3AFOA 5IN4A 1O1YA 2NUPA 4M9UA 1J5EB 1ZI6A 4IXMA 5FQQA 1QP0A 1GSVA 5TR7A 3A1SA 1G5TA 2X8AA 1P74A 3AGPA 4GOKA 5FOTA 5K3EA 2E6KA 1OXXK 2D4HA 3RV4A 3H83A 2IF0A 5TPWA 1W581 1YMSA 4C22A 1NAIA 4GLQA 1MX3A 1AKRA 3BICA 3JQAD 1A95A 4G36A 3M6BA 1T4MA 3NTUA 5BN3B 5M29A 3V1LA 2BFFA 2R8PA 2JBWA 3GAAA 1V7PC 1N3LA 4G5HA 4IDBA 3ZDZB 4WKBA 3E35A 4XX0B 4P7BA 1UZNA 5IVKA 4NCAA 1VYUA 1ZK2A 1ISFA 2HUPA 3G3EA 3AM3A 2BZ1A 4KACA 3CLHA 1VGRA 1W7AA 2FZWA 1MHTA 3G0IA 4NDNE 4XLTA 1X74A 5CITA 5JBIA 2FFFB 3WRTA 3P9RA 4UCXA 1GPYA 2X3UA 4G8DA 4ZCMA 1JEJA 3T5BA 3Q6IA 1MIOA 3PVZA 3EXEB 3QUCA 1HKUA 1QAQA 1F2UB 1ZUWA 2XTZA 3KDAA 2V8CA 1JSCA 4I4TA 2HCTA 2VQFB 3EZLA 1FIKA 1TD9A 1WJGA 2R2AA 1T1BA 1RLJA 3G89A 4DWVA 5JAZA 1G8JA 4C07A 2RJOA 3ET4A 4JBFA 5I9SA 3HKDB 2JVKA 1NFRA 1XP5A 4EHDA 3ANTA 3HDGA 3LYUA 1KFKB 4PC2A 4YRIA 3GYGA 3UA4A 2WIBA 4NNJA 3PFHA 2J8ZA 3LFTA 2YTZA 5LP6C 1NRJA 1KWKA 1GL9B 3QG1A 2JDID 1ISJA 2A94A 2H18A 3A4YA 3DAOA 3H0KA 4NOKA 2X0IA 4GB7A 1N6LA 3DH0A 5T3YA 1M2HA 4BATA 5I7OA 4M1ZA 3T7CA 2D8MA 1BSGA 1HQCA 4KKXB 4D99A 3EDYA 4BMCA 3K8OE 2VF7A 2NG1A 1PW7A 4DEVA 2EWVA 3QLVA 4LZNA 5G18A 3A04A 2FWIA 1I80A 4RAOA 1K55C 1G2IA 2VZ8A 4IF6A 1AN9A 1N2IA 2WWXA 3D8SA 5JS2A 3C3CA 2J9GA 3RQSA 4C87A 2IYNA 5FNVB 1U0BB 3IOCA 3PR1A 4CIAA 1GM5A 1DAFA 4LJ8A 5IVPA 1L8XA 2O2YA 1R0YA 4OQGA 1Z4QA 3GD7A 3NTLA 1J7KA 1QF9A 1ULZA 4RPJA 4WESB 2XKJE 2FN3A 3N2NA 5H3CA 3RJMA 3NIAA 4D3YA 3OQNA 3THYB 2PZKA 1TMKA 3LR0A 1SKFA 4D1YA 2Y0CA 4AJPA 4MJXA 5T6BA 1GSWA 1QPGA 5BPFA 2UZ3A 4CMBA 3L1VA 3AJ9A 3RHTA 1MTOA 4PZEA 3ZIAD 5IU6A 2W11A