2WKQA

Structure of a photoactivatable rac1 containing the lov2 c450a mutant
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
317
structure length
317
Chain Sequence
ATTLERIEKNFVITDPRLPDNPIIFASDSFLQLTEYSREEILGRNARFLQGPETDRATVRKIRDAIDNQTEVTVQLINYTKSGKKFWNLFHLQPMRDQKGDVQYFIGVQLDGTEHVRDAAEREGVMLIKKTAENIDEAAKELIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGLEDYDRLRPLSYPQTDVFLICFSLVSPASFHHVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NPH1-1, RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 1
publication title A Genetically Encoded Photoactivatable Rac Controls the Motility of Living Cells.
pubmed doi rcsb
source organism Avena sativa
molecule tags Transferase, cell adhesion
total genus 108
structure length 317
sequence length 317
ec nomenclature
pdb deposition date 2009-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2wkqA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2wkqA02
2ZAOA 1A4RA 2Z4SA 1GVNB 3KXKA 5KNDA 1I4TD 1WRBA 2RH5A 4RFSB 5BN3A 5FR1A 1CXZA 4L5BA 1EFTA 4PQYA 3U3KA 3DMNA 3I73A 4R70A 1R10A 3TMKA 1E2EA 3IIMA 2DHRA 3PUZA 4H1VA 3M0EA 3B33A 4I3IA 4YQFA 4LJ6A 1ODVA 4R38A 3IBGA 4TWZA 2ZRCA 2D4HA 1FX0A 1U8YA 1G16A 3W3AA 2H8KA 2OFOA 3MAAC 1YKSA 3BY8A 1Z29A 3BORA 4M1KA 1OW3B 3KQKA 4EERA 3AUYA 2FMXA 2YJTD 5EE0A 1G4UR 1GDDA 3W8NA 4BFUA 1QVRA 1RW4A 4MN5A 1G8GA 1DARA 2G0TA 1T1BA 4DCTA 4UXJA 2NPIA 2XEXA 4D4MA 2VLGA 1FUUA 3THWB 1F3OA 1X8LA 3U7EB 3IPXA 5JRZA 4TQ9A 3RS2A 4B32A 2CK3A 1DG3A 2GJ9A 4Q1AA 3A6PC 1KI6B 1NIPA 3ZQ5A 3UE6A 1KK1A 1TEVA 3DHWC 2ZXUA 4DUGD 1KHTA 1XJCA 1NIJA 2BKEA 1VG9B 4O2LA 4G1UC 3X1DA 4TYNA 4A82A 3GLGA 2A5GA 3C16C 3GMTA 3TR0A 1JQJC 1MO3A 1W2GA 2BM0A 3QF4A 1OJGA 4DB2A 1P4SA 2B7CA 4NONA 4BGDA 2GEVA 3CWFA 1E2FA 4EKDA 5JHHB 2XXAA 4HLCA 1LSXA 1OFTA 4RZXA 4GP7A 2BMJA 2EYUA 3C8CA 4UXIA 2CDNA 1SZPA 3GEEA 1Z08A 3GJ3A 5EXXA 4ZDWA 1XEWX 3Q72A 4I1SA 3VFDA 2ODBA 3HJNA 3IEUA 4JL6A 2G9NA 4W7SA 2WWGA 1OYWA 2RGNA 1TS8A 1TS0A 1FOEB 4C4PA 3E4QA 4I3JA 2IHYA 2OBMA 2V1BA 3CBQA 4BRWA 4CGZA 1FX0B 1AS2A 2LCFA 3D8BA 2WTUA 4C2TA 1S67L 2NTYC 2I9VA 2K7SA 1NL3A 3U3OA 3FMOB 2FWRA 2QE7D 2JHEA 4R2IA 1ETUA 4MGIR 4BLSA 2JDID 1VCOA 1KKLA 1T3LA 4ZKEA 3CKLA 3GP8A 2WMOB 3VNUA 2DFKB 1G64A 1MABB 3A58B 2PCLA 4DIEA 2ZSFA 3Q7QA 1XZPA 4Q9KA 1T9HA 1VIAA 4PPNA 4US1R 2IS2A 1DBSA 4OL0A 1XJ0A 2ODNA 4E22A 4OQMA 1ZM3A 4A2WA 3N2EA 2D62A 1BYWA 3RWMB 2P6UA 2QEQA 4ZKDA 4ZO4A 2EFDB 2EWVA 2RGCA 1U0JA 5SZJA 3F1NA 4BLQA 2GF9A 4N0EA 2FFAA 4QJ3A 5J4LA 2JN7A 1ZINA 1W2HA 3EPHA 5KTYA 3C8UA 4QBIA 1P9NA 1CR4A 1E1RD 1VDZA 1TU4A 4JKIA 1AJEA 3WBKA 1KI7A 3W3ZB 1HV8A 2WIAA 4AWXA 3A1VA 1PZNA 4PR0A 3SFVA 2C78A 3KKMA 2QAGA 1T5LA 4YDHB 1SKYE 4CEJB 2V54A 1K5DA 4TT3A 2N42A 1LVGA 2A24A 1XJ6A 1P61B 2JJ2A 2F6RA 2IYQA 1COWD 4GP6A 4GI7A 2ZJBA 2RGAA 4RD6A 5K8UA 2WSMA 4JGOA 3LO5A 3RC8A 3X2SA 3DEFA 5J5CA 1L2TA 1XTRA 3F3YA 4JGQA 2PH1A 2XTMA 4NCHA 5AJYA 4MH0R 5H68A 3Q9LA 1S1ZA 5E7JA 4XVQA 4PANA 5E3HA 1PLKA 4GOXA 2Q3HA 1RRCA 1E0JA 4V02A 4JVSB 4ESHA 5G41A 3VNVA 1GNPA 3RWOA 1KSFX 3VKGA 4RCZA 3NOUC 4DCUA 1NKSA 4DLXA 2HV8A 3VR1A 2J0QA 1KK2A 4BECA 4DB4A 2BWJA 4KFUA 2PT5A 4JS0A 1J70A 3F1NB 4FIDA 4Q9JA 1V9YA 2Q3MA 1CKEA 2H16A 2QP4A 4KODA 1US8B 3AQ4A 1GILA 2CE2X 4RJLA 3QSYA 2GK6A 4HUQB 1E2GA 1OF1A 3BFVA 1JJVA 4RD1A 4RVCA 5HCNA 5C18A 1NRJB 3O8RA 4KFSA 3VOLA 2EFGA 2ZI9A 3MG9A 3UWKA 4CF7A 2VHJA 1UBGA 3AVPA 1IXSB 1TUEA 4WLAA 2JJ8A 1W49A 2CNWD 1C1YA 1FP6A 2IA5A 4PHHA 3FOZA 5DN6A 2H5EA 1D9XA 2A24B 1DAHA 2OO7A 2XNDD 4A0HA 3TQFA 3H1TA 2OLKA 1ZU5A 1E4VA 2ZITA 1S8FA 3AF2A 4E07A 3HPRA 4V0KA 2O8CA 3BC1A 3X1XA 3KX2A 3PUYA 3ZVMA 3GCGA 1QHYA 5HDDA 4L9EA 5KIZA 5EQTA 4BE7B 5K8IA 2BMDA 1U81A 5L3SB 3TBKA 3Q5DA 3LA6A 3UMRA 1FNMA 1UBCA 2GRJA 3ECCA 1LS6A 1QHSA 3BOSA 5HE8A 2MSDB 2Q9AA 1E9FA 2VIIA 2EU8A 4OI1A 3WYGA 3M4YA 2Z6CA 4NE2A 1VB6A 4NHOA 4BRUA 3L0IB 2XSZA 4OYHA 4XWOA 4O25A 1SVWA 1GNRA 1W47A 2HV1A 2OCYC 3BJIC 3UATA 4LV6A 1HY3A 2YINC 5BN4A 2BV3A 4Q1FA 1TL7C 1UKVY 1EGAA 1VIYA 4UJ3A 3IDQA 4X8LA 3TW4A 1OH7A 4KJZA 5AJWA 5ANRB 3RVBA 1VTKA 2QQ0A 4AK9A 1W36B 5JWRA 3ADDA 2WPDA 2C5LA 1GL9B 4D82A 2CK3D 2Q9BA 3PENA 3AVYA 5EXTA 5G3ZA 5JJKA 3T50A 1GIAA 3IQXA 2B02A 3MQQA 1KOFA 1NNEA 4AG5A 2J80A 1OT9A 4QGGA 4TMTA 5HTKA 1XEFA 1NMXA 2IYSA 4QGAA 3TE6A 1YRAA 1OTEA 1UADA 5DHFA 4JLOA 3GJ0A 4LJYA 3W6PA 1FZQA 3DMDA 4AKIA 3AP2A 4KVAA 4CRWB 4WOPA 2Y8EA 2AWNA 3OLOA 2GZHA 2AL7A 2HT6A 1GKUB 3CX7A 3CPJB 2A7QA 1E0SA 4IKEA 2HJGA 4EPXA 3I32A 5AJVB 3EIEA 4DSUA 1IY0A 4C3ZA 2KX6A 1KMHA 3CONA 4D4KA 3T35A 4DLRA 4IHQA 2W58A 2PZGA 2EYQA 5HWWA 3PEWA 1OLOA 1YZUA 5FUXA 4RZ3A 4YC7A 2EFCB 4EPYA 4YMTA 1FQKA 1SULA 2KWIA 2ZR7A 3HWSA 3FHCB 4NYIR 1XX6A 3FHTA 1K5GA 5DH9A 3VKWA 5B64A 2V1AA 2W6JA 1MR3F 3CLOA 5FPSA 1N6HA 3LDAA 3AKEA 1C4OA 2VL7A 4OQFA 4B73A 1N5KA 4EEUA 4C7OB 2YOHA 4YXWA 5KSPA 2GJKA 4F38A 2G1KA 5AUNB 4HB0A 1CRQA 3TAHA 3ASYA 1TF7A 4F4JA 3N2IA 3E4PA 2GKSA 1DAIA 5CYPA 2J0SA 4I38A 1MKYA 2OM2A 4MGKR 4WF0A 3DDCA 5ELXA 3CRMA 1T0JB 2XJ9A 3RSOA 2Z6VA 4Q19A 1T5IA 3FHOA 3SQXA 1Q1BA 2UZ3A 5HD5A 1N6IA 2HF9A 2IW3A 1M1YE 1KO5A 4HJ4A 3NIBA 1A2BA 4KAXA 2H18A 2R2AA 2Z6DA 4O3MA 1W0JA 4HLQB 2QI9C 4R3AA 4HOIA 2JEOA 1GSXA 1Z2CA 1MRNA 1Z22A 1ZD1A 3KXIA 1S3GA 4XVUA 1OJLA 3GLFB 1G7SA 2RHMA 3SBDA 4LJ7A 1U99A 3X1YA 3I5XA 5A8BA 4V0MA 1KMHB 1N0WA 2O0HA 2VV6A 4TT3D 4V0LA 1S9HA 1NMYA 2JJ2D 1E2PA 1RRFA 5J4KA 1E2DA 3T12A 4YMUA 4M4SA 3U60B 3PHYA 3EWKA 1W5SA 1XEXA 4LRZE 2YWHA 1MH1A 5DNYB 1YZKA 4NMMA 2FZLA 4US0R 2O8DA 3U5ZB 3K70D 2ZRDA 1MO6A 2BBOA 3EZ2A 5FI0B 2IUUA 4TQAA 5IF9A 4JLBA 4IOLA 4QNRA 4EJSC 4HIAA 3PEVA 2VHQA 3H7WA 4PXAA 3EZFA 3K0SA 4IVPA 4P4SA 3SZRA 3A1UA 3P20A 2ODWA 3HYTA 1HQYE 1G3QA 1OB5A 3BWLA 3PVSA 4XSHA 3VR2A 2ONJA 4LPSA 4POAA 4OHXA 1P9WA 4MN6A 4CZ2A 3NC0C 3LIEA 4QKQA 1U94A 1RJ9A 2V0UA 1HE1C 5FTKA 3BFXA 2XGJA 3R8CA 3GEIA 4PO1A 3NH6A 1G41A 4Q01A 2BJVA 2DY1A 5DO9A 1A1VA 1OE0A 2JCSA 3SI7A 4JZKA 4M9SA 3P4YA 5DJTA 2RHDA 3REFA 4AKEA 4B2IA 1U98A 1N9LA 3NHBA 4ON9A 4LJ9A 1RYHA 2IWHA 3TH5A 2XX3A 2OUKA 4FMDB 4F3LA 4KITB 1AS3A 3HP1A 3I8XA 3WYAA 3G6OA 1BS1A 4TMVA 2AFHE 1TF5A 5DN6D 1PUIA 2ZI5A 4B71A 2WM9B 4JL8A 4DC9A 1S1YA 1NVXQ 4ILEA 1KGDA 1VHTA 3EEHA 1T6NA 1Z47A 3AF0A 3W5IA 3WMEA 2BASA 5KPDA 6Q21A 1AGRA 2IS6A 4DRZA 4IOJA 2GCOB 2O0JA 4AD8A 4FD2A 3Q5EA 3CRRA 1S4QA 1G5TA 3EASA 4LHVA 2J45A 2PR5A 4PKYA 1CJTC 1Z63A 1TQ4A 1WXQA 3CM0A 1T4GA 2OBLA 1XJ4A 5H1YA 2XSZD 4P4SB 2MMGA 4EPWA 4DLYA 3EC1A 2K5UA 1E9RA 1DVRA 2PD8A 2BOVA 3CH5A 3KQHA 3OAAA 1KAOA 3FFAA 1JEEA 4NXGA 1J8YF 4KV9A 5DI9A 1DOAA 2KDKA 3LX8A 2IS1A 1RJ9B 2QPOA 2DYKA 1W1WA 3QI2A 4MYTA 3P4XA 2WHXA 2WPDD 2G0NA 4TYPA 3IBYA 2ZJ5A 2OILA 1O87A 1QRAA 1N6PA 2D74A 2GESA 3K0AA 3AF4A 4IFEA 5FTJA 3ZZ0A 3PQCA 1AA9A 4Q7MB 4QRHA 1MO5A 2XB2A 1G19A 3UMSA 1WB9A 1F2TA 5GJBA 2ANBA 2DR3A 3NJAA 1AZTA 2V9PA 2W2XA 3KTAB 1JALA 1D6JA 3F1PB 2WWWA 3CZQA 4DDWA 4EAQA 1XEWY 1LF0A 1R5NA 2DWOA 4CIDA 3FYHA 4RD2A 1EFHA 2JJ1A 5FUYA 3WY9A 3HPQA 3X1ZA 5KHOC 5L3VA 2QA5A 2A78A 3AVVA 4DT1B 1ESNA 2Z5FA 3B1YA 3CLVA 3M1IA 1GL6A 4MKGA 4Q1EA 5CITA 4HATA 2YKHA 1R4AA 2E87A 2DB3A 4KFRA 3EIHA 1R0YA 4UNNA 3QKSA 3UKDA 2IYUA 4DEYA 2VV8A 1YR9A 2CCJA 2IYTA 4HY8A 3EWAA 2IHBA 5FTNA 5IRCD 1RE0A 2VF8A 4C0KA 1TF2A 2W6JD 3U2QA 4DDUA 4DSTA 4DJTA 2XTNA 1JR3E 2CL7X 1SQ5A 2JLRA 3NHQA 1TAGA 1V43A 2GJ3A 2C99A 1VG8A 1T8TA 3BBPA 3VX3A 4YXWD 1XDBA 1H8HD 1MZUA 3DKPA 4ACAA 2BBTA 2LKDA 4UJ5A 2F1RA 4B47A 1XD2A 3RRMA 1IOZA 4DXAA 4RZ2A 1JI0A 1W0KA 1NI3A 1T18A 4JSYA 2YNMA 3CF0A 4EESA 3T06B 3UMFA 1ZM2A 2VP0A 1II8A 4LUCA 2WOJA 2A30A 4F92B 3MWKA 4M1TA 5CM8B 1PUJA 1WA5A 2IYVA 4DDVA 4EUNA 4WZ6A 2RGNC 1XU4A 4CYMA 4NCJA 3K3DA 1E0KA 3EPKA 3CF6R 5F5YA 3K1JA 5FL3A 5J3WA 1FNNA 3RH8B 3EIQA 3NG1A 4EJSA 1ESMA 1G8PA 3V4RA 3AVWA 2OCPA 1N6OA 1F2TB 5BWMA 1TX4B 1P60A 1W0JD 1HH4A 1A7JA 2H92A 3RC3A 2FSGA 4V0ME 3ZGXA 1G6OA 2HEIA 4C30A 1NVVR 4UNRA 2YYZA 4G5OA 2X2EA 4A2PA 4LHWA 3ZQ6A 3B6EA 2F55A 3CPEA 2BEKA 1NP6A 2ZU0C 4MITA 2BJWA 4Q4AA 4M9XA 5AWFC 2JLSA 1XPUA 4YWZA 4ARZB 5G53C 1H8EA 2NQ2C 3ZZUA 5CLLA 3TR5A 1P62B 1E2IA 2QRZA 3CB4A 4JLKA 2GHIA 4HB2A 4ZIRA 1EX7A 3KJIA 1XMJA 2VPPA 4URXR 2XJ4A 4TLAA 1T3SA 3WBJA 3K9HA 1EK0A 5KPJA 1ZAKA 2GA8A 5SZHB 5F2EA 3R20A 2QMEA 3HYRA 3QE0A 3IS2B 1JQLB 3FKQA 3W8RA 1R0WA 1JXMA 1NLZA 2QU8A 1PVOA 4DIDA 1ZRHA 4XIGS 2NZJA 4XJXA 5KSYA 5EP3A 4I81A 4EFLA 1II8B 2WWYA 1U0HC 1G17A 3BRWD 5KYKA 1BO6A 2QL6A 5TBMA 3QXHA 2WJGA 2GNOA 2BDTA 4B74A 4KI0A 4E5UA 1W4CA 4RSGA 3AVQA 3H82B 5GJWC 5FH9A 4BLRA 1E9CA 4UQOA 2YWGA 4HDOB 3QIAA 4Q4LA 2X1VA 1R0ZA 4QGFA 3B82A 3LH5A 4AY2A 4IW3B 2GJ8A 3MWYW 1XB2A 5K8LA 2JLYA 3WMGA 1K6MA 1M7GA 2NO6A 3ZD6A 2CLCX 2WJIA 1KK3A 2PX0A 4FCTA 4GHIA 1BKDR 2CCKA 3PEUA 2R6CA 3LYXA 3WRXC 5SZIA 1D7EA 4GZLA 3RS7A 4GCZA 3FE2A 3G0HA 3AV0B 1EESA 3NEJA 1SKYB 4Q4AB 1KZ7B 1QVAA 3DZ8A 3FFBA 1VG0B 3ZVNA 3LUQA 4NZYA 4IDQA 3HJKA 1UEIA 1SHZA 3K3CA 3UXMA 2YC2C 1AGPA 4ZIRB 4TYWA 1CJMA 2A9KA 2FH5B 5E95A 3GLIB 1Z83A 2QMOA 4EQ6A 1AK2A 4TMZA 1AZSC 4TLDA 1W44A 5JJIA 3QXCA 1YZQA 3MWLA 3H9WA 2RGDA 4KHZA 3GFOA 3NEYA 2J41A 2J59A 2VA8A 4A9AA 3OHMA 5DISB 4HAYA 3WXMA 4FXPA 3OE7D 4WUJA 3TQCA 3I92A 1KDTA 2V3CC 5DJUA 4I99A 4Q4JA 5KO2A 1E98A 1S1CA 5FTLA 2ZSAA 5FBLB 5TARA 4ZDJA 5TBMB 1XXHA 2XITA 4LC0A 4NCKA 2J5XA 4TMKA 4WZBE 3IO3A 3EA5A 1RRPA 3VHLB 5LDDC 3LWNA 1EXMA 4P4TA 1Z07A 5EP2A 4H9GA 3R7WB 3AM1A 2KJQA 2ERYA 2PT7A 2ZVQX 3T1TA 1ZCAA 3ADCA 1EX6A 3CNNA 4MKHA 2VH5R 4MUAA 3H0KA 1Q1QA 1XTIA 2RAPA 1J90A 2GXAA 1E4YA 2O8BA 1VCIA 3OFNA 4Q7LA 4DLUA 3LBHA 5I5LA 1KDPA 2GTPA 1UDWA 2OFXA 3QKUA 2XNSA 5GJVC 1N9OA 2PEYA 3AEZA 1SVOA 5F6AA 2MSEB 3F0TA 5JSZA 3BFKA 4KBGA 4U00A 2XB4A 2P3SA 4HLUC 1MRSA 3H86A 4D0LB 5FPHA 1E2NA 4NKRA 4Q48A 4Q5IA 4PC1A 5AVFA 4TL6A 1J7KA 2ZETA 4V03A 5HE9A 1UAAA 4EQ6B 4EPTA 3B1VA 1S4RA 1U8ZA 4J0QA 4TTPA 3NKVA 4GSYA 1N3BA 2XZPA 4TN1A 4YLGA 4QM7A 4M21A 3U61B 1E2JA 2QTVB 4HAXA 3CAXA 1UWNX 4LBZA 1ZCBA 2QY9A 2QPAA 4LY6A 5HDCA 2V4ZA 2ZANA 4HI4A 1GRQA 4JJZA 4JBYA 3QXSA 1GKYA 2ZRMA 4Q4JB 3TUIC 2QROA 3O8BA 2AR7A 4L4UA 4C0QC 1S9DA 3BD9A 5TMPA 3RHFA 3I4LA 4NXFA 5EUQB 2CHGA 2F1HA 2C8VA 3MR0A 5DE3A 1UF9A 3LW7A 1UKEA 5AUQA 1G4AE 3MJQA 3B1ZA 3VMFA 3A4NA 5JEDA 2M1CA 2BHRA 4CW7A 4OK3A 1TNDA 5JHGB 3SOPA 3FC7A 1Z6XA 4C0HA 1DO2A 1WF3A 5E7IA 1W0KD 3CW2A 3GLGB 5J4YA 4TL9A 2LWIA 2O8BB 3QF4B 1XJ2A 1Q20A 2B92A 4HNBA 1DAMA 1KI9A 1P0ZA 2XXAB 2C03A 4PX9A 4N1AA 1G8YA 3UMDA 4O0MA 4NU0A 2NGRA 1VCNA 3U3MA 1IN6A 4JMPA 4KQDA 3ZS9A 2Q3FA 2JLZA 1OSNA 2Q21A 4OQNA 3ZVLA 1ANKA 4WW0A 3GQBA 3AUXA 3U44A 3VE4A 4FWIB 1YVDA 2XZOA 4M4XA 4KVGA 3I8SA 5AJZA 2J7PA 1CR1A 5HD3A 3ICQB 1AKYA 3BS4A 4FMCF 3RLFA 1G28A 3VAAA 5G4ZA 2F43A 4M22A 4QHYA 4WN5A 5FBRB 1X0OA 4DLSA 4QC2A 1OTBA 1WBDA 1M74A 1H8ED 4P32A 1QDEA 2L4RA 3GJ8A 3A4LA 3AKYA 4HH3A 4L8GA 5A0FA 1S0UA 4S2EA 3RSLA 3RDPA 2YHSA 1CJKC 4PO9A 2L1MA 1IJEA 1EFUA 4IOKA 5G3YA 2D3WA 1Z0AA 1ZIOA 2F1IA 1TPZA 1UBFA 4HZIA 2GXQA 1GSWA 2P2LA 2QMHA 3ONWA 3JVVA 1XWIA 2WJHA 4F91B 4NYMQ 3T5DA 1UWPX 3NHAA 3FGNA 1TS6A 4DDTA 2ZOIA 3L8YA 2RB4A 2P65A 3IHWA 5DKKA 4HH2A 1F6BA 1Q44A 2XOKA 3A36A 3MLEA 3QQ5A 3KJHA 1XZQA 1P2UA 5FUWA 1BMFA 1E6CA 2GJSA 3IPYA 3MJHA 1KNQA 2R6GA 1RZ3A 2ZUDA 2EVWX 2EWWA 5C46F 3U6KA 1DTSA 1P3JA 2D06A 2IUTA 1XNJA 2N1BA 5DI3A 1N6NA 4AURA 2ZYTX 3QKRA 3IGFA 4LDJA 4EW7A 3ZJYA 4L16A 5FOUA 3T1OA 3W6OA 4DEXA 2YOFA 5IT5A 3ZD7A 2PJRA 1UBEA 2QAGB 4D81A 3LD9A 2WKPA 4Y0AA 1XF9A 4MRRA 4TL8A 1R5BA 3MGCA 4DLZA 3KB2A 2FE4A 2CVFA 3FVQA 3U4QA 3MXQA 2ZJZA 3SHWA 3EC2A 2V55B 2JIZA 3RANA 3D72A 4HI0E 1P2TA 3T1VA 3WNCA 1Q22A 2QMUA 4GNKA 4U02A 3VU9A 3B9PA 4AI6A 4KBFA 4OQLA 1OXUA 3K70B 3CIOA 3FPAA 2CL6X 2ZR9A 1KO1A 4YMWA 2QT1A 1E9EA 1T1CA 4RD0A 2VP6A 4E04A 1E9SA 1CJUC 2ECKA 2N46A 3MFYA 4IEEA 4LBYA 3SJZA 4JBWA 2J87A 2XZLA 2ZJAA 2IBMA 1IM2A 4GFDA 3PFIA 1QZXA 2GEUA 3R9XA 4A6XA 2HDNB 2JAQA 4U5XA 1E9AA 4QL3A 4C0AC 4HLUA 4C2UA 5JJLA 4DLWA 1XXHE 5EXPA 4PC3A 5HR5A 3KKQA 3KQNA 4JVLA 2YKGA 3EW9A 3DOFA 1KI1A 4L15A 4FI3C 2R6AA 2EW1A 4PC6A 4KSBA 1NY5A 4X8HA 5KSOA 5FBVB 1DAFA 2GZAA 2O8EA 1NN1A 3HR7A 3DVLA 4BBUA 4XWKA 1GWNA 5JFGA 2HXYA 3EZ7A 4DSOA 2IYWA 1D5CA 1XCPA 2WWHA 2BVNA 4BLPA 2ZJ2A 3QKRB 2YVUA 1JNUA 1ZM9A 1IQPA 2AFIE 2FZ4A 3OFND 4JJKA 4CT5A 1OV4A 1AIPA 4Q9IA 4UNSA 1YZLA 1DAGA 3TLXA 4MRPA 1Q3TA 1YZGA 2A5FA 2E1RA 3A0VA 2O8CB 3PEYA 1Z0DA 2PMKA 1OIWA 3SS8A 1QBKC 2ZI7A 2ZAMA 1E9DA 2R9VA 4GOJA 2GJAA 4DCNA 3MMPA 2ERXA 5EP1A 2WJVA 3KL4A 4IXNA 3V00A 4HQAA 2FFHA 2FOLA 2GEDA 2D02A 2OXRA 1TU3A 5EZ6B 2FPLA 5BQ5A 3MQOA 3FMPB 3VR3A 3SR0A 1J2JA 1UJ2A 4D4JA 4P0TA 1TS7A 4EETB 3D3QA 2ORWA 2HLDA 2QN6A 5L3QA 4JT2A 3NDBB 1UFQA 4A6PA 1U8AA 1XCGB 1KJZA 1DPFA 5EP4A 1KSGA 1Q21A 1E99A 2VYFA 3NBZC 2BCGY 4E03A 1X8JA 4FINA 3AP3A 3SDZA 1JR3A 2ZYVX 1OHHA 2FDCA 1I2DA 2CL0X 5CK4A 1OXXK 4WXPA 2OEPA 5M04A 2CVHA 3L43A 1CJVC 2O8EB 2VTKA 2H7VA 1JPNA 3G5UA 3LIAA 4H1UA 4IDHA 4CT4B 1FFHA 4FCWA 4K08A 5BW8A 1DAEA 1Q0UA 2ZQ5A 4IRUB 3R9WA 4ACBA 4DVGA 5JS8A 2W83A 3W5JA 5HKKA 1X8KA 2F1JA 3HU1A 4LRWA 4C0LA 2QAJA 2LKCA 5GVRA 1NBME 3T15A 1NJGA 2ZREA 4KFTA 2C04A 3I1FA 1SXJA 4DJ2A 3W6NA 5EXSA 3WMFA 1IBRA 2CHVA 2X8AA 3SJCA 4LCBA 1G3IA 4LPZA 1AM4D 1UKYA 1QHHA 5IU1A 5DSZA 4L9GA 4PSVA 1YR7A 2Z4RA 5FFMA 4ZI3A 2OAQ1 2J7PD 4IDNA 4QJ5A 4BFSA 1LY1A 4JBXA 1VKJA 3WNDA 1LW7A 2GAAA 4D80A 2W6IA 4FN5A 3SC3A 1R2QA 4F4IA 2ZR0A 4PHFA 4BFYA 3BH6A 3MJRA 1T1AA 1M6NA 3SEAA 4M0LA 2ZS9A 3CUEF 3IO5A 4PQRA 1P7CA 1GRNA 4AIIA 4A36A 3SE0A 4GW9A 1ZJ6A 2NO7A 3CF2A 2CCGA 5HWTA 4ZCIA 3LW8A 3TVDA 4XT2A 4AG6A 4PSKA 4JYCA 4YMVA 1N5JA 3E1SA 1NVWQ 3L0PA 1WP9A 3OIYA 4Q9LA 2W00A 4G01B 4MKIA 4PPFA 4Q4HA 2V1XA 4BLOA 4R9UC 4JL5A 4R7ZA 5KDLA 4MDEA 4JVMA 2EA9A 2QTHA 2BMEA 1NY6A 3GJ4A 1ODFA 4PZYA 2FFQA 2J9RA 3ZIAA 1Z0IA 1IAQA 1ZP6A 2XOKD 3D31A 1OJ5A 4Q1DA 2IEYA 4R2HA 4A15A 4OJQA 2YC4C 5IK2A 1XFAA 3THXA 3ZDQA 4GPTA 4A2QA 1CIPA 4JLPA 4B3BA 1E79A 1FMJA 2QUZA 4JGPA 1NG1A 1OYYA 1EW0A 2ZRFA 1ZUNB 3K0CC 4NP6A 8OHMA 4B2PA 2RCNA 2VP2A 1KI4A 1ZD9A 4NCIA 4PSAA 3UWOA 2EFEB 4KLZA 4MYHA 3GJ6A 4GRAA 1QHHB 3A4MA 3TUZC 4I39A 1DG1G 2FX3A 1ZMXA 5SZKB 1CR2A 3Q85A 2YWEA 1XPOA 3KX0X 1Z6TA 2JIZD 2ZROA 2J3EA 1SVKA 1XEXB 3LX5A 5G40A 3WNBA 3QY0A 4JT4A 2ANCA 2O8DB 3A1TA 4MGZR 4Q21A 2ZI3A 2OESA 4IVRA 4KU4A 5JECA 4Z8YA 4GS9A 1MOZA 3CRQA 5FR2A 1JPJA 1TQDA 2FSHA 4QFMA 1JBKA 1TADA 4IOMA 4C0SA 2KE5A 2L0WA 1JEDA 2J0UA 3H7WB 3PV0A 1OXTA 2HXSA 3KFXA 5J4HA 1SVMA 3CNOA 2CLSA 2Q9CA 3QKTA 4NH0A 2GILA 1G20E 4JKYA 2AK3A 4B76A 3QEJA 4TL7A 1LFDB 4JLVA 3NOPC 3GJ7A 4PFSA 1OT3A 2ZJ8A 4P3YA 1D9ZA 2D2EA 1GRRA 4Z54A 2DBYA 4B48A 2PCJA 3K9GA 1NSTA 4OI2A 4OK6A 1G8HA 1LTQA 1W4BA 2QGNA 2ZJYA 4F4CA 4HLDA 5A4JA 2QRNA 5LD2C 2PL3A 4AKHA 2I3BA 2FPMA 3EG5A 4PTLA 3MWJA 5A5GA 3ZZTA 1E0AA 3CRW1 3K9NA 4F3LB 2ATXA 4RY2A 2OWHA 3L82B 2FGJA 4Z1MA 3WHLA 3VE3A 4QNMA 3NBXX 4TSFA 5CJPA 4YDSA 3DPUA 4ERNA 2X19A 3K09C 4A92A 3B8HA 4B3XA 4NXEA 4LRXC 5FPKA 3C5CA 3KKPA 2OCAA 1H65A 1DP6A 3B13B 4HSEA 3JVUA 1B23P 3ICYA 4QXAA 4G5QA 3LY5A 3R9IA 3NTUA 4DLVA 4IDPA 2QM8A 1KO8A 3MUFA 2D7CA 1W48A 1GOTA 1P2VA 2ASEA 3I61A 2PDRA 3LIBA 1QHIA 3AGQA 4A1FA 1F2UA 5CDFE 4BBVA 2NO9A 4BFZA 1D2EA 3Q7PA 4LSGA 1GSIA 3ZQJA 2KB0A 3GLFE 1OXSC 2IYRA 2AK2A 2BM1A 2J0UB 2UVQA 3LIDA 3K8YA 2D2FA 3UMEA 3SYKA 2HLDD 1E2QA 1CR0A 1P75A 2WBLC 2BMFA 4G5GA 1KY2A 4MUBA 5LPNA 1R7RA 1CEEA 3NWJA 4WIAA 1TUIA 1HEIA 1GFIA 2FF7A 2YOGA 4HDQB 4PZZA 1OIXA 3V9PA 4LJ4A 5H8WA 4A0RA 1F9IA 4DSNA 1FTNA 1KSHA 3SN6A 3IKJA 4LX0A 3TUJC 4PC2A 1JR3D 1XCMA 1OHHD 1QF9A 3GJXC 4JLJA 2FNAA 2OV2A 1KKMA 2FA9A 2ZRLA 1BIFA 3P1JA 1P9RA 1BOFA 2ZRAA 4TLBA 2RMKA 4LYJA 2NO1A 5JWHA 4KSCA 4MRVA 3CH4B 2FU5C 1FP7A 5P21A 1W4AA 4DWJA 4NXBA 1JAHA 1N5LA 3CWQA 4R71A 5JCZA 2O8FA 1Q12A 3K0AB 3NDPA 4FWTA 3FDIA 1U90A 2GDJA 1KJWA 4BQSA 5GADl 1GP2A 1YZTA 2NOAA 3RRZA 2ONKA 4HAUA 4LHXA 4HEJA 4I1VA 2G1JA 5FBWB 4OHZA 4Q9HA 4ZI2A 1SXJE 1G18A 2VP4A 2J7KA 2RGXA 5HKKD 4Q7KA 1YZNA 3EPJA 4V0OA 3I5YA 5J47A 4PKYG 4EPVA 2QHKA 1GITA 2WWFA 121PA 4QGHA 3VR4A 2VSOA 4NBSA 5DKLA 4XVRA 3UIEA 4D25A 1HURA 2JA1A 4GOKA 4ZCLA 1IXRC 3NXSA 1ZIPA 2WVJA 3QG1A 3QXXA 5FOSA 1KK0A 2VEDA 1HA3A 4C0BA 2QJ5A 1JR6A 3DO6A 5J40A 1Z28A 3C5HA 5FPTA 3QKSB 3CNLA 5FL7A 1T0HB 4HJ6A 1W4RA 2WKRA 2IYLD 2ZE5A 3IIKA 4HJ3A 1DELA 3PUXA 4TYQA 2W6ID 2BIFA 4WXRA 3K0CA 4B43A 3AVUA 5TB5A 2QBYA 5F69A 1VG1A 1X6VA 2R6DA 2Z43A 3C4JA 5L3RA 1OH6A 4RKFA 4MGYR 4ESVA 3B1WA 3OESA 4NCNA 5DIFA 1Z2AA 3QPUA 3CR7A 1DO0A 2H28A 1XD2B 4PAQA 1VHLA 5C2JB 2IXGA 3MCAA 4Q47A 1XMIA 2ZRGA 3RYTC 2JLUA 3ZVRA 1XMVA 4GBMA 2VSFA 1IJFA 1NKTA 2O8FB 1SVLA 3AF3A 3G82C 3B2EA 2ZI4A 4XD7A 3C7KA 3U3JA 1TTTA 2QM7A 5LB2A 3ZIAD 2A3RA 4DHEA 1LSWA 4ITRC 2JGNA 3GD7A 4QM6A 2IYYA 4RFVA 4ZPXA 4EJSB 4QOSA 4QBHA 4FMDF 1Z3IX 2WWIA 4AYTA 5B2ZA 3KUDA 1E79D 4TZ6A 2VLIA 4UKDA 4PZLA 3QF7A 2WZQA 5F9FA 1GUAA 4GL2A 4NYIQ 3U7GA 4TYYA 4P31A 2O52A 1CP2A 1JECA 3THWA 2PMDA 1BYIA 2XAUA 4A0GA 3N5CA 4BFWA 2VHUA 2FSFA 1KI6A 5HWVA 5F68A 2CHQA 2E9SA 2VBCA 3LICA 3WP0A 2G3YA 1ZNZA 2IWRA 1L7VC 4Q1CA 1UGUA 1X86B 3SW1A 3LRPA 5AJXA 3PCRB 4CEHA 2H57A 4W5WA 3KUCA 3AH8A 4NYJQ 5LB4A 1KOUA 2QZ4A 1EWRA 2HCJB 2FN4A 2FV8A 4GMXA 1ZM7A 2IYXA 4QJ4A 3NVAA 3THYA 2KBEA 5CIWA 1YR8A 2BC9A 2QSYA 2VO1A 3FMIA 1RVDA 3K09A 3BE4A 3IBRA 2GF0A 1ZW6A 4LLOB 3RTYA 3PUVA 3K9LA 2G6BA 3HJIA 3FG8A 1C9KA 3UPUA 1LL8A 4BPBA 3OAAD 4DBLC 2H1LA 2A2ZA 3BK7A 3W90A 3WHKA 1XTQA 1LV7A 4KUKA 1W36C 1G7TA 1VMAA 3F5FA 1GZSA 3QJYA 4WA7A 4BASA 3E2IA 4WZAE 1LB1B 3HU3A 1IN5A 2F9MA 3I72A 1XD8A 3A37A 3KKOA 3LV8A 4JIMA 4JYBA 4B3DA 5TXGA 2QGZA 2HJVA 2OSBA 2QT0A 4OI0A 2ZPTX 2AD5A 3SYLA 3FKSA 4GHIB 3DM5A 2EFHB 3EAQA 3VKHA 1G8FA 3CRVA 1R8QA 1Q3HA 3LXXA 5JBQA 3UB8A 4QBFA 4JLMA 1MABA 4HB3A 1VYTA 1YRBA 4URYR 4A0FA 2W27A 3LXRA 4B2LA 3TKLA 3TSOA 4Z1MD 5BYKA 1JJ7A 3KJGA 3WP1B 2PR6A 3BXZA 3ND9A 4TSFD 1W7AA 2REXB 4HB4A 4ZV4A 1S96A 1S66L 1AKEA 1KO7A 2V6JA 3I3SR 4H6JA 2QTFA 3PITA 5JRJA 4Q7JB 4DLTA 2NMVA 1Y63A 1CS4C 1IHUA 2CEAA 2DCUA 4KUOA 2IYZA 5HCIA 4CEHB 2X77A 1UEJA 4XOIA 4OI4A 5LD2B 2QP3A 2JJ1D 2JLQA 1I2MA 3U6BA 1M2OB 1CTQA 5JCPA 3ULFA 4M1OA 5KDOA 3EZ9A 3THYB 1WMSA 1WQ1R 2ATVA 2H17A 3AKCA 3BB3A 4FCVA 4LWZA 4PAMA 4KO8A 4M53A 4O2RA 1JNYA 3PJRA 4BBTA 1X3SA 4CDGA 1FL9A 1PJRA 1IONA 2VP9A 3H2YA 4LHZA 2ZEJA 4EXOA 2F9LA 4DJ3A 4NTZA 4CEJA 1GSVA 5F98A 1XXHB 3IEVA 1WDTA 4HP9A 4B33A 1R8SA 4IJMA 4Q18A 4OHVA 4UNQA 2KI5A 5AVEA 1IN8A 2ZYUX 3FWYA 4US2R 3GJ5A 3NH9A 3AVTA 1G3MA 2Q6TA 4LC1A 4YMSA 1MO4A 5TV2A 3UB9A 3KQLA 1NF3A 1E9BA 4CEIA 3CX8A 4IFBA 5G4YA 1A5TA 3T34A 3UG7A 5GVSA 1ZBDA 4UXHA 2A5YB 1ZNXA 2B8TA 3T1QA 2HT1A 1DP8A 3PG5A 4DZZA 1NMZA 2ZRJA 3AGPA 3IHLA 3UB7A 2IF0A 3NOTC 1HT2E 2Q0HA 4W9MC 1X1RA 1G7CA 3OIWA 1XTKA 1E2HA 1R6BX 4X8OA 5JSZB 1OFUX 4BEJA 4HDCA 1NBMA 2W0SA 2ZU6A 3ZS8A 2ZRIA 2D7DA 2IUSA 3AKDA 4H6JB 2OFWA 3GLHE 2YKFA 2R65A 2YZ2A 3QXJA 1E1QA 2ZRKA 1T91A 1F60A 1GG2A 4G5RA 5CM9C 1II9A 4RQ9A 4D0NA 3LBNA 1V9ZA 1US8A 221PA 3QPVA 4B3CA 3EPLA 4HUQA 1S4SA 2HYIC 2DFLA 4XTCS 4B44A 4DKXA 5CYOA 1CBUA 2NZ8A 2HF8A 4I4LA 3O8CA 4AKGA 3KJEA 5FL7D 1OTIA 4I1UA 3QVUA 5KNBA 1Q57A 1J8MF 3EXAA 2PX3A 2PJZA 4RKEA 4NL4H 1XRJA 3GFPA 2YV5A 1NWZA 4URUR 4QG7A 3A1WA 3M6AA 3ND8A 2YWFA 3LFUA 5DLQC 1ZNWA 3EX7C 5FUVA 4HAWA 4PPGA 4G3XA 4TLCA 1Q1EA 1OXVA 1LNZA 2VF7A 4WBSA 2PHYA 1SXJC 2G83A 1KI2A 2C98A 4TMWA 3GLIE 1Z0JA 5BN5A 1Q1ZA 1RKBA 5KDDA 2IT1A 1U0LA 4M9ZA 3E5HA 2OG2A 1G1MA 4CEIB 2BCJQ 2F7SA 5L3SA 4OHYA 1ZUIA 5FPYA 3DOEA 4EEPA 2W2TA 2NPFA 1KNXA 4XH9B 3CWZA 4B75A 3C2WA 4XD7D 5AUOB 4WL9A 2O5VA 2OHFA 2P67A 1Z8FA 2D01A 1VCMA 4FW9A 4GZMA 4JSTA 3BAFA 2ZSEA 3BB4A 2V0WA 5FI1B 3CR8A 2B7BA 3E70C 4PHGA 4D26A 1HYQA 1G6HA 1GL7A 1P97A 4TTRA 4LPKA 4BZPA 4IDOA 3VTKA 3HDTA 2VV7A 3U44B 4A8JC 1CF4A 3EA0A 2JLVA 1DP9A 1V5WA 3CX6A 4B6EA 1N2CE 4UNPA 3IUYA 5DGXA 3UG6A 2Z83A 3ASZA 2IS4A 2F43B 5CJ2A 2ZRNA 3LNCA 3I62A 4MA4A 2AX4A 5FTMA 2IC5A 1LS1A 4YONB 2IX3A 4GMDA 2VHCA 1GTVA 3ICEA 2OBNA 1AN0A 4G5SA 1O3YA 1KMQA 4BFVA 1P2SA 4LBVA 1AQYA 3BGWA 4R98A 3VR6A 2Z0MA 4EFMA 3VR5A 4DCSA 2VQSA 4PQFA 1OH8A 3ZLJA 2C96A 2KSQA 1OFIA 3KKNA 2TMKA 2IEZA 3LVQE 4PAOA 1RPZA 3MRSA 1OPXA 2C9OA 2ZRBA 5J4VA 1DS6A 4WVFA 1A82A 4LYHA 1J99A 3LLMA 1LT0A 1OIVA 1KYIA 2MSCB 2WICA 1XTSA 3IQWA 4B35A 4OQXA 2NG1A 1LSVA 4OBEA 5KOYA 5EUMA 1MV5A 5HDSA 2RGGA 3T5GA 4I5SA 3U7FB 4LJAA 1RC8A 3E4OA 1U9IC 2I1QA 1N6KA 2JLXA 3QBTA 2VHTA 1TEXA 4B6FA 1NVVQ 4MRNA 4QBGB 1N0VC 3W34A 2GCNA 2DWPA 1U2RA 2QSZA 4PC7A 1BYUA 2R78A 2L0XA 1L8QA 4RCYA 4DCVA 4F7WA 4TTQA 1FW6A 1ELOA 4HHDA 5DI3B 5JS7A 1ZD8A 4GDFA 521PA 3PYPA 4C7OA 3B60A 4I3AA 1SVSA 3FKSD 3OIUA 2FJUA 2FPKA 5E7MA 1KZGB 1P73A 4S35A 3UB6A 5JZVA 3TSWA 3K0EA 4PO8A 4A4DA 3GPLA 3U4QB 2IK8A 2CLDX 2DFTA 3B9QA 4LZZA 4ASUA 1YE8A 3GLGE 1NLYA 1N6LA 2I1VB 2R44A 4G0NA 1ZNYA 4LHYA 4JGRA 3A1SA 1OH5A 1CULC 1M8PA 2B21A 3VU9B 3QENA 3W9YA 1NJFA 2ZTSA 5JEEA 4RD3A 4KLNA 2O0KA 2V7QA 2WAYA 1Z5ZA 2QKPA 2ZRPA 3AVOA 3BH0A 2JASA 1E2LA 5CDFA 3RRNA 3SFZA 1NG9A 4PPQA 2ZS7A 3GLFA 2CXXA 1P5ZB 4C0JA 2CJWA 4P33A 4D6PA 3C14C 2B8WA 1CRPA 5L8VA 2ZSBA 3B5JA 1RFLA 2QNRA 5D3MA 1ZC3A 1FPMA 2C2HA 3KZ1E 5HSQA 1F5NA 3QEOA 2OOLA 3DL0A 4JLAA 2X2FA 4OKSA 5IS1A 2WV9A 2R62A 3AP1A 4BLTA 3LI8A 2EQBA 1F98A 3LQQA 1ZYUA 3VQTA 4BZQA 821PA 2G77B 3WRYC 3P27A 3RS0A 2IF2A 1NN3A 3RAPR 5CB6A 2DWQA 5CIQA 4EPRA 3THOA 2P5TB 2ZUBA 4LOAA 4C9BA 3LI9A 3DKVA 1OKKA 4BZXA 4LBWA 2P0EA 3SJAA 2CE7A 3SJBA 5HPYB 1H8HA 1YJ5A 4LV5B 3L8ZA 4EQ1A 2AKYA 1OB2A 1X1SA 5GJCA 2QWSA 1QG2A 2C9YA 2AXPA 1DRMA 1KJYA 5EFWA 2MMCA 2RGBA 1KI8A 4NYJR 5CLQA 4MDFA 2WKQA 4BEBA 3RS4A 1RIFA 1A2KC 2GXUA 1EFRA 2PEZA 2REOA 4Q00A 3OF5A 5FBQB 2AXNA 3T61A 2WSSA 1NBMD 2GBLC 1KDOA 1P6XA 3D6TB 1TQ6A 3GECA 1E3MA 3QPWA 5FOWA 5EE1A 1EWQA 1F48A 1NLFA 1JB1A 1E1QD 1W5TA 1UM8A 2IXEA 1YQTA 1SGWA 3S1AA 4CVNA 1Z0FA 3GFTA 4NDZA 2IL1A 3SQWA 1DEKA 3PIRA 4P4UA 1ZUHA 1VYUA 5L3QB 1T8UA 3OEEA 3VX4A 5KSZA 1Y3AA 2W0MA 1E96A 4Y0VA 2CJWB 2QJ7A 3TSZA 4A8JA 5JI2E 2GWHA 4MQBA 2OT3B 3K0FA 3OEHA 4MKFA 4MYUA 4D4LA 5D3MB 5C4MA 1XBTA 3AF1A 2INWA 3FB4A 2CMKA 1DE0A 1QG4A 1E32A 2CBZA 5H70A 4K46A 1BH2A 3F8TA 1DADA 3P7NA 1P72A 2V9AA 5C1BA 1XFQA 5J7EA 2GCOA 1KY3A 4LRYC 4BFXA 2ZIAA 3JZMA 2HYDA 4IVQA 4JLNA 1KI3A 4FMBB 4URWR 4BUJA 1VECA 1II0A 3EWSA 4HYYA 1Z6AA 1BMFD 5JLJA 4U7DA 2FEOA 2HUPA 3OIVA 3ADBA 3B7GA 1NN0A 3ZYCA 1I4DD 1D06A 1N9NA 2JATA 3U3RA 2VRWA 5IHPA 2ZSDA 1Y28A 1KAGA 2ZBBA 2ZE7A 2FG5A 3BIFA 3D7MA 2G88A 5CK5A 5EE3A 1SXJB 5JWOA 1HT1E 2WJJA 4URVR 3K53A 3KDSE 2WJYA 4LV8B 1KO4A 1IN7A 2B6HA 1D2NA 4AC9A 1G9XA 3LQRA 1G291 4KYIB 1PLLA 3ETLA 2AKAB 1U9IA 2QPTA 4KCGA 4OJKA 3RABA 3SBEA 2OXCA 1D2MA 1N0UA 4TLEA 3S1AB 2ORIA 4LYFA 4Q03A 3FMFA 4ZDIA 421PA 1W36D 4Z51A 2OLJA 2IXFA 3CZPA 2C95A 4F93B 4HAZA 2A5JA 4B9OA 1G21E 3QUSA 3IIJA 2WAXA 1OT6A 1M7HA 4X8MA 2JLWA 2UKDA 3SNHA 3ZH9B 4BWYA 4A8JB 1UPTA 5DHAA 3K0FB 3BY9A 4LK2A 1HQCA 4AYXA 4XT2B 4OHWA 5TY0A 1XPRA 2ZYWX 3KTAA 1AS0A 1DAKA 4URZR 3AVXA 4JVNA 2NO0A 3F1PA 1HUQA 1Z6YA 3BWDD 4NPHA 4Q4HB 5JMTA 1QHGA 2HCBA 4Q66C 3BB1A 4M8NE 2ZM5A 2GAOA 3O47A 2VEAA 5LBIA 4DT1A 4MRSA 3UANA 2GK7A 1QHXA 2ZRHA 5BYJA 3THXB 1G3UA 1QHNA 5KU1A 2GZDA 3GEHA 1NSFA 1Z6GA 4E09A 1K8RA 3OE7A 3LAWA 1XD9A 2BEJA 2PZFA 2AN9A 3NBYC 3PUWA 2RGEA 3TRFA 3N70A 3QNUA 3KB1A 3RNLA 4BFTA 621PA 4WAUA 3B85A 5TVKA 5BXQC 4L9SA 1TMKA 3REGA 4ABYA 2QQEA 3J81k 2NIPA 1ONBA 3SHFA 1L4YA 1TQ2A 2ZE6A 1PV4A 1KTVA 1EFCA 4DUGA 2J1LA 5KUTA 1M7BA 2WWXA 1Z06A 4ASUD 4EIWA 3KXLA 2W2VA 2F3RA 2GCPA 4XTRA 1XTJA 1FTSA 1T19A 2P5SA 2P6RA 3TAUA 4L9WA 1OTAA 4NYMR 3KQUA 4JLDA 3DZDA 5AUPB 4GS9B 5FOXA 3WYFA 2FSIA 1ZC4A 1XMSA 2AD1A 2PLFA 2V6IA 1G5PA 2V7QD 4K8OA 3RRYA 3QOFA 4RZUA 4LGMA 1ZVQA 2RKOA 2R8RA 2P7JA 4IEIA 2PD7A 2GETA 1I4LD 1KDRA 2ORVA 1W46A 4ZCMA 3Q8XB 1MT0A 1N6RA 2GBLA 2UZIR 1N25A 2ZI6A 1JAIA 1S1MA 3PXGA 1KIMA 3FTQA 3O8DA 2GVDC 2PBRA 2DPXA 2V8OA 4ARZA 3L0OA 4B34A 5F9HA 2OE2A 4M1WA 4W5JA 2FFBA 3CPHA 3P26A 4Q1BA 2A5DA 1G3RA 4HZUA 1YHNA 2QE7A 3A0SA 1FMLA 5D3QA 3A8TA 5FOTA 2JDIA 2ZS8A 2OZEA 1CLUA 1KSJA 1NN5A 3TK1A 1SKQA 4MYCA 5FOVA 1OKKD 3CO5A 3IS2A 2WMNB 1IXZA 3ADKA 1N5IA 5C4GB 3R8FA 1S3SA 4XSGA 3H84A 2XTZA 5EE5B 721PA 1G7RA 4EDHA 1YR6A 4TMXA 2AHOA 2PYRA 3TIFA 1CU1A 2ZJOA 4N3NA 2ZE8A 3P32A 5B30A 1SXJD 3B78A 1EFRD 2V1UA 1R5OA 3LIFA 3RS3A 3TJZA 2W0NA 1D8TA 1E2MA 1EG7A 1GAJA 2I4IA 2WSSD 3F1OA 4QHTA 3QG5A 4XWAA 3GLHA 3H82A 4IXMA 4HUTA 2GVZC 2VP5A 4II7A 4QHSA 4AYWA 1VPLA 2C9CA 3KFVA 1GM5A 3HR8A 4OK5A 1E1RA 3EZ6A 1F2UB 2QP9X 2ZUCA 1WBBA 2PZEA 1OFHA 3SYNA 1OTDA 5K8TA 5AK0A 1HE8B 1RYFA 1XJQA 3GDIA 3L2OB 1XFNA 1SHKA 1UKZA 3OEED 3HU2A 4LJ8A 3TNFA 5HZKA 4M1MA 3TVTA 4M9QA 5CB8A 3BH7A 3VHXA 2CMNA 1WCV1 3U7HB 3Q3JB 3LVRE 5F3WB 1M34E 1COWA 4HP4A 3PR1A 2FEMA 5JI3E 2F3TA 3OEHD 4LI0A 5EZ5A 3X1WA 2R6FA 4B3FX 1IY2A 3B1XA 4L9FA 4RFSA 4LJ5A 4D0GA 1UDXA 1IY1A 1Z0KA 4HAVA 3BERA 4M1YA 5DYGA 1WE2A 1E94E 2KBFA 3IILA 3JZAA 4HZUB 3RS5A 5B57C 2REBA 4FMCB 4K81B 4V0NA 1VYVA 3GLIA 2WOOA 3V4FA 1ZU4A 1LF5A 1GKIA 2WIBA 5EJEA 2AWOA 1GNQA 4Z8XA 3TGPA 1JXOA 3NBFA 1NVUQ 1XP8A 3LBIA 3QVVA 3AB3A 1R0XA 5DYIA 2ZOHA 4TZ0A 2VSXA 1YU9A 5EE9A 5IK2D 4B3GA 2P6NA 3C41J 5TDHA 2QENA 2BBSA 2PLRA 1T3HA 2QG6A 3MSXA 3NC1C 2ODEA 4LYAA 4KXFB 2ZVPX 5E4FA 2DFNA 4ZDKA 4TQUS 3SU8A 4N0DA 1G5RA 1FQJA 2QAGC 4D2IA 4R6LA 2QORA 2BKUA 3DM9B 2C77A 2GXSA 4M2LA 2PYPA 3L0SA 1SVIA 5AR1A 3F1OB 4GT1A 2OWJA 3GLHB 4M1SA 3MFXA 5HZHA 1L4UA 2OCBA 1XJ3A 3R7WA 3TW8B 2J46A 1AQUA 3MD0A 2SHKA 4RD4A 4I1OA 1FUKA 5UKDA 3QBVA 4PHTA 1RRGA 1HTWA 5B58C 1E69A 2BBWA 3UK6A 2J0VA 2OAP1 3K70C 1WA9A 3EARA 3LLUA 5J4EA 5IDVA 1PLJA 2CNWA 4Q02A 4W5HA 1ZM4A 1B0UA 3OZXA 5KNCA 2QBYB 3A0RA 1E2KA 2FGKA 3C15C 3H4MA 2XNDA 4EFNA 1S2MA 4KYUA 1IN4A
chains in the Genus database with same CATH superfamily
1A4RA 4G09A 3G79A 2NUTC 3EEIA 5TGZA 1EFTA 4KWHA 4H1VA 2W2KB 4TWZA 3SJ7A 1YKSA 3M3HA 4BB9A 1GPUA 2PZJA 3W8NA 5IFLA 1ZS9A 5J5AA 3C4PA 1KPGA 1KI6B 4JCCA 3NTLA 2RH4A 4P4GA 4PM4A 2Z1DA 4CBVA 3RTDA 1PJ3A 2B7CA 3CKYA 4KH1A 3UPDA 4ANFA 3RVDA 4MHSA 2FN8A 4HH0A 5BN3B 1RJEA 4CLOB 4X1IB 3IBCA 3DZBA 3BE8A 3IPCA 2EBHX 3VNUA 2WAOA 2Z2LB 2ZSFA 3ZXIA 4FYWA 2CXOA 4MS4A 4A2WA 3PE6A 3MT7A 3FR7A 2OLEA 1XZHA 2EFDB 1U0JA 4YAEA 3LP5A 4QBIA 1W8QA 3H97A 1NBHA 1YT4A 3ZTTA 1PZNA 1NRWA 2VAXA 3INNA 1I3NA 1VMEA 4M9CA 5BRJA 5H7XA 4KENB 2BGNA 2R7AA 2IP1A 2XTMA 5KYUA 3CMZA 2VNAA 1TQHA 3EFOA 4Y0TA 1EP9A 2XA1A 2EW2A 1L7RA 1TK9A 3O8QB 2Q5LA 1I1OA 1ZOOA 4QYWA 1MENA 4C01A 2PU7A 1GTMA 3MKFA 2FUCA 4LZWA 4CF7A 2X5XA 3D4BA 5DM2A 4I55F 4B17A 4LAFA 1T1SA 2AOTB 5DN6A 2XUHA 2XNDD 3E2KA 3KX2A 2FOXA 3VPAA 4LJKA 1UBCA 1GUFA 4OI1A 1EWYA 2HRZA 1VB6A 4NHOA 3QEKA 5EHNA 1VSBA 1NONA 1TZCA 2XOXA 1A7AA 1N77A 3EXEA 1GL9B 1KH2A 2O2YA 5IZCA 5TRTA 4TMTA 4MTLA 5AM3A 1EUDA 1OTEA 1NC3A 2NV6A 3EOBI 4RTNA 4X6XA 4TT8A 1IH8A 4DSUA 1IY0A 2KX6A 2R6HA 1KMHA 3COWA 3AHEA 4YC7A 9ATCA 1FQKA 1T4CA 4J3NA 5G1NA 2V1AA 3CLOA 1D4OA 4AO8A 1XVAA 3MF0A 1OWMA 1TW3A 3ASYA 5IAEA 4Q9DA 2ZJFA 3GLQA 4UDYX 1G60A 3RSOA 3S7OA 4GPEA 3FHOA 4UMEA 4EDFA 4ZTBA 2VDMB 2WAEA 3BK2A 3T3GA 2ZBFA 5A7FA 1BN7A 4C6YA 2LDXA 2R1VB 3PBSA 4P6BA 4PBSA 4TT3D 1NJ2A 1E2DA 3T12A 4QTZA 1C8VB 2WKIA 3FAZA 3EZ2A 3OX4A 4ARAA 5U9CA 3CFYA 4P4SA 2K31A 3D2BA 3URKA 4FYJA 2ZC3B 1YJBA 3RK0A 3CY6A 2ZJ9A 4MN6A 3HVHA 4BB6A 4KXLA 2Z2MB 4KQEA 1S7GA 2J30A 5BOSA 3H8JA 4M9SA 3WTBA 3HP1A 1U7ZA 4QBKA 3WGUA 3IHBA 3BFCA 1KS2A 2AEJA 1GA9A 2JD1A 4R68A 1TECE 1IG3A 4MW9A 2H51A 5F35A 1FXUA 3O2QB 1VJ5A 1WXQA 4RKWA 2XSZD 4ZA2A 2INGX 2BOVA 1NYYA 1DRWA 1V0JA 3AOGA 3MMZA 2R97A 3D59A 1HTTA 2AF4C 1L5WA 5BT9A 3ZU4A 5AVWA 4PXYA 4CI9A 2GESA 2XDMA 1BQ4A 2GFIA 3UYLA 4E5PA 3U13A 1LF0A 4UM8B 3ZXXA 2L17A 2JJ1A 5K51A 4P80A 2VUHB 4YUYA 4HXFB 1T3ZA 3P52A 2B4RO 1XRRA 2E87A 5K3EA 2VV8A 4E1VA 1ZVMA 4IINA 5HF6A 2ZKLA 2ADMA 2GJ3A 4BTVA 2Q6VA 3D3OA 2PMCA 3N58A 2PV0A 5DNWA 1T18A 2Y0DA 4M1TA 4YCMA 3OQ6A 5KWVA 1XCLA 1BH6A 5DP2A 2G82A 2ZTHA 2RC5A 1ZMRA 4LVUA 3CW9A 1T9BA 1F2TB 3O87A 4P0QB 1UP6A 3A6EA 5HQ3A 1XPBA 3UN1A 2PRKA 1H2BA 1OYOA 3J7TA 2Q2OA 3EISA 4YMLA 2XJ4A 3X1JA 2Z3WA 3ELWA 4HDMB 4OHKA 5B1HA 2QU8A 5LYJB 1PVOA 5AI6A 1ZRHA 5JALA 4P3XA 2JVKA 3BRWD 2BDTA 4R1QA 3UNWA 3QIAA 1M67A 4QGFA 2P9FA 3KYQA 3E5RA 4IW3B 5K8LA 4I1YA 3R5JA 3ZG7B 5C81A 5DTKA 4C2AA 1VETB 1TRHA 2CCKA 4R1GA 2E4ZA 4FOSA 4FCFA 1R6VA 3FE2A 1G4HA 3FFBA 1PW7A 4ENRA 1QLWA 1INLA 4FMPA 3BAZA 5E95A 2J5BA 2V5AA 1EJ2A 4LWQA 4PX2A 4WLNA 3JVIA 1YAHA 1IATA 4RZHA 2YCBA 4A9AA 5JV5A 4BJ1A 3CH6A 1RZRA 4R8KA 4LC9A 4TKUB 3F98A 2RARA 4S1VA 1SQ0A 1IG0A 1P0FA 3TNLA 3CLSC 3DTEA 3IDOA 4JC5A 3MLBA 1I14A 1L5FA 1BKSB 2COKA 1N9OA 5H82A 1ZUD1 4WFKA 4P5DA 3F4KA 3W5VA 3H5AA 4WKOA 4H3SA 2JGRA 1S4RA 4TXLA 2ZR8A 3TPFA 1WCIA 1N3BA 3A7EA 3U61B 1E2JA 1F8UA 2V20A 1UWNX 7MHTA 4JBYA 4DV1B 5JCJD 3HB5X 1UKEA 4M0EA 3S29A 5JHGB 4TRJA 2PUEA 2YNMD 4DRXA 4M9RA 1AMUA 1EHYA 3CZAA 3LCCA 1UBSB 5JE8A 2O7SA 4A5OA 1FU7A 1P0ZA 4CQJA 4G0MA 6ADHA 2YVLA 2F3SA 1H9BA 3PPYA 2HDHA 1MOQA 4IDFA 4AJ4A 1AKYA 4V0RA 1K8XB 3W2EA 4CLDA 1AXGA 3C70A 3ZGAB 2Y1LA 1GG9A 2A9RA 5JMOA 3DD1A 5EZYF 1XWIA 1GCIA 3T5DA 2H0RA 2I3GA 3MWEB 2ZOIA 1HDEA 1NU6A 4F94A 2PSHA 4ER5A 3MJHA 2XYGA 3U31A 3D5EA 1EVKA 3LX6A 2QLLA 2PIAA 3QKRA 4I0WB 3W6OA 5IT5A 2PJRA 2JAXA 1IM8A 2C94A 2WKPA 1GTG1 4EARA 4MRRA 3NQ41 5ALIA 5HJ7A 2ZJZA 2WUQA 4I4TB 1J6UA 1P2TA 5BN1A 1RJFA 1D2HA 3FPAA 4YMWA 2O8NA 4X1YB 4KXWA 3PQFA 4E04A 2N46A 5BUSA 4P0PB 3PFIA 4U5XA 4K87A 4DLWA 4JI4B 2X0DA 3A3IA 4L15A 1G20A 2HH9A 3NTRA 2NYAA 4CR8A 1NY5A 1UOEA 3GHYA 5INTA 3I6BA 2IBTA 1TT5A 2YN2A 5KTKA 5CFNA 2BHLA 5A71A 4O5AA 3BFJA 4MCJA 3HGQA 1IQPA 2MWMA 4CT5A 1RIIA 1UK6A 4E5YA 4J4HA 3RVJA 4C4RA 1X3LA 3TX6A 1O7JA 3R5KA 3WG9A 2Q50A 3I9V6 2I34A 4GJ4A 3TG9A 3C3JA 1GPNA 2BGMA 5IM5A 1DX6A 2P1DA 5L3QA 5L6MB 2QRHA 4RVHA 2EBFX 1SCUB 4RK5A 5FWDA 3MGGA 3S8EA 3PNVA 1JPNA 5FT9A 3KLOA 2UUCB 1PWZA 4FQ8A 2F17A 3U7JA 3NXKA 1XA7A 3IRUA 1ZUNA 1IBRA 4OP2A 4LCBA 3AR5A 4Y6QA 2PMWB 1QHHA 4EGJA 4PSVA 4H3VA 4IQFA 3IULA 3IUBA 1GO2A 3DXFA 4ZI5A 4KPGA 4BFYA 1ZESA 2DR2A 4M0LA 3IO5A 3K3PA 5D6OA 1GRNA 1UP7A 1MV8A 1BCSB 3A3NA 1W88A 5A4KA 1RWVA 4LRUA 2C0QA 1WLYA 3VNBA 1NY6A 3VO9A 1V6CA 3LKVA 3F7NA 3ZIAA 4EGCB 4A15A 4OJQA 3ZGYA 3L6DA 1BFDA 3JWPA 4EKYA 3G9QA 3ZDQA 1E66A 4A2QA 5F2KA 5DX1A 2ZRFA 1DQSA 3SH7A 4KO3S 2JCHA 4KLZA 3N74A 2QUHA 5KAPA 3L9KA 1SVKA 3DBIA 3SHQA 3PSHA 1KDZA 1QWOA 1NBEA 5CA1B 4JUBA 3TR6A 3EVTA 3PV0A 1EXDA 2ZTVA 5EINA 2AJTA 1GRRA 2DBYA 2ZYAA 3K9GA 1BX3A 3HJBA 1W4BA 4MPDA 5JVDB 1H1LA 5KYVA 4NV3A 1VRCA 4D0RA 4GMFA 3VE3A 1QRDA 4B3XA 3KXDA 3UMMA 2HBYA 4GMHA 1I3LA 3JZDA 3G1UA 4QXAA 4OMUA 4S24A 3D6JA 1W48A 5JSQA 1PFKA 3I2IA 1GSIA 4WCVA 1HC7A 1OX6A 2UVQA 3TW0A 4YUZA 5D51S 4FGWA 2ODPA 2FF7A 2AJLI 1TC2A 4J90A 1GCEA 1YQEA 5CIYA 3C5AA 5CHJA 1Z5OA 3ES9A 1R15A 3CWQA 4E5DA 4FWTA 1NJ6A 3FDIA 4N54A 1EM8B 1YGYA 1YQGA 3MTJA 4QUJA 2WM3A 1EJ6A 1M54A 2QLNA 3W77A 1B0AA 2JK0A 2NUPB 1ID1A 3MJVA 3CNLA 5EIFA 5FL7A 1W4RA 2IYLD 5T64A 1DELA 2VSYA 4AMGA 3MAGA 4A0SA 4F6RA 5DIFA 3CR7A 3NZEA 4DLAA 2PG3A 2UYYA 3HUUA 3SZOA 1JMKC 4OOLA 4NHEA 2VF5X 5LP6C 4XD7A 1T2UA 2V4MA 4RIIA 1FFCA 3UE1A 3G1TA 2FSFA 3HU5A 3FJ1A 2QS9A 3ADOA 4L5CA 2CC2A 3TOSA 4NR0A 1L4HA 3BQAA 5DM4A 1M5TA 3EGXA 4MO2A 5CT4A 1XQ6A 2HCJB 1YCDA 1LJLA 2BC9A 2DHDA 5M34A 2HK6A 4LRXA 4IBRA 1NI4B 3ENNA 2H48A 1HYGA 5AKYA 3NBLA 4DBLC 2DPYA 4H6VA 2A2ZA 1VE1A 4WUTA 1W36C 1VMAA 1GZSA 4B3DA 2QDKA 1NNI1 2PS3A 2XR0A 4QBFA 3L5KA 1X1TA 1PZHA 3WP1B 2RK6A 2SNIE 2REXB 5EJAA 1S96A 1D6NA 1DIHA 4CEHB 1PX0A 3VUFA 3DDUA 4PN7A 2DLCX 4EVIA 3AKCA 4ZAXA 1A8PA 3UUEA 3TEJA 4ZK6A 3UXYA 4U1RA 4QPRA 2B5RA 5FDFA 4KK3A 4P5PA 3F1KA 3AJ8A 2CMHA 1W8DA 4X6TA 2PL5A 4RVOA 3VDMA 1N9KA 1MO4A 3BWEA 4UXHA 3WQQA 2HT1A 5H4HA 3PG5A 3FCYA 2ZRJA 4POOA 2B95A 1G7CA 3BMNB 4W8OA 1R6BX 3QP5A 4EG0A 4BJHB 4KMMA 2YZ2A 4RQ9A 1NRJA 1SXIA 2NYVA 1GGJA 3WQSB 4OQGA 1ORIA 4NNJA 4C4XA 3IP3A 4GM0A 5EFZA 1QAOA 1QANA 3LFUA 1ZNWA 5FUVA 2Q1WA 2ENWA 1BULA 1KPIA 1LI7A 1LLQA 2G83A 4RV4A 2BFEA 2WKSA 5EQJB 5KDDA 5FPYA 1U1DA 1PR6A 4EG4A 1W1IA 3BICA 4U7FA 4IDAA 1JIVA 3FWPA 3OZWA 3PXEA 4XR4A 4BZPA 2FG7C 1JYSA 1ADJA 2HF7A 1T10A 2KYRA 4DNPA 3GSGA 1N1GA 2B9VA 4KAFA 1A9SA 2ZRNA 1P0PA 5A4DA 4M87A 1GA6A 1K6XA 1OC2A 2ZIXB 4QEKA 2Z0MA 1Y7IA 4DCSA 1D0VA 1OPXA 1DS6A 2G40A 3UEOA 5KMGA 1Y4OA 1XK7A 2Y6UA 1MV5A 1EKXA 2G1AA 1ONGA 4I5SA 4A3SA 4WACA 1SUWA 2VJDA 1QMEA 1D8AA 1EP2B 2BFOA 2GCNA 5CDYA 1FW6A 5CEJA 1GQOA 3HYLA 1BVHA 3SJUA 3OCZA 3RFCA 3UH0A 1L5RA 3STUA 1V5FA 4M8KA 1QZUA 2BM8A 4H6WA 2C1XA 1U9ZA 1PNTA 1ZIDA 4ZVNA 5LLSA 1DNPA 1SD1A 1OZAA 2O4CA 1JU4A 5KYXA 2JASA 3GLFA 3PYLA 4E3NA 5IASA 4P35A 2PUDA 2EQBA 4MVJE 3RS0A 3MPOA 1B74A 1IUNA 4EKIA 4GI3A 2XA7M 3LI9A 2PSJA 4S0ZA 1J5PA 4BJ3A 3AEUB 1QMPA 3H5LA 4KGXA 2AXPA 1DKRA 3ZZNA 2WHYA 5AQ9A 1EFRA 3DCYA 4HXGA 4KJXA 1GGFA 1E3MA 1BJTA 2C61A 4UZFA 1C1XB 2LE0A 1DEKA 3B7PA 3T9EA 3QITA 4Z9FA 4BN0A 4XFDA 3UJ3X 2X6RA 4OUDB 5KYNA 5D3MB 1NYTA 1PAUA 4ZT2A 4LMBA 3ZKAA 4BO4A 4LRYC 3H05A 4EA6A 2Y66A 2YDXA 1E1YA 1G6KA 2E0IA 1EX9A 1K6SA 4A26A 1IN7A 3G35A 2GYYA 3L18A 4O4IA 4Z9BA 4X65B 2OXCA 3LKBA 2GZ1A 2GBCA 3P45A 4D9GA 4RK4A 2P68A 1UPTA 4CQMB 5IN4A 1ZVKA 3ZQUA 3EEBA 3DTVD 1JSZA 1Y6QA 3T7SA 2HTFA 4JT8A 3BE5A 4J49A 1NZOA 3D7RA 3O47A 1PSZA 1NQWA 3L7CA 1FUEA 4ENVA 1FW8A 5LQDA 5FAXA 1QP4A 3AF6A 1EDEA 4RIHA 1JU3A 3INTA 2N3ZA 2I7CA 3J81k 4CKCA 2F67A 5AHRA 4OSEA 1S6RA 4MWBA 2YW2A 2AUTA 1X13A 2A14A 2DHCA 3A1DA 3QOFA 1JHDA 4W1PA 1ZVQA 4FCCA 1OI3A 2GETA 5DM0A 3W04A 1COZA 2Y2MA 3TQIA 2JFXA 5A62A 3MCTA 4FKMA 3HCBA 5D3QA 4IZHA 3SDSA 4NE9A 3ZE0B 1G55A 2POQX 6REQA 2FW0A 2I7TA 3CO5A 1YSPA 3BWCA 3RIMA 5L09A 4N3NA 2WSSD 3Q7ZA 4HUTA 1TA0A 2OECA 3THSA 1O7EA 4CFSA 2FUKA 1XFNA 3HU2A 2A4KA 2GBFA 2D3TA 4D0GA 4JLUA 2CNOA 2LVBA 4PN3A 3GLIA 3QYAA 3RTEA 5CRIA 4F3YA 1GQ2A 3QVSA 5EE9A 1JFRA 1ZZGA 2P6NA 3NHKA 3NC1C 3R3JA 3DM9B 2PYPA 4COOA 1BXGA 3AR9A 2NV2B 4UVGA 2BJHA 5L95A 3GWZA 2P5YA 2YS6A 3OZVA 4XUDA 2NVWA 3ICPA 2O1WA 1JS1X 1L3IA 1PIWA 4R70A 3IIMA 1FX0A 1PZGA 4M1KA 2ZUWA 4LTMA 4Q0HA 4MUIA 1ZTUA 1DRKA 3QJ5A 3OA0A 3U7EB 5TIIA 3A6PC 1WO8A 1NIPA 4GAEA 1L7QA 2BMWA 1KHTA 1XJCA 2W4IA 4TYNA 5LL6P 1NWCA 1VJCA 2BM0A 1MVLA 2RFLA 4DR1B 4FJ2A 2PSFA 1M2NA 4RZXA 2TSYB 2BMJA 4EYSA 2EYUA 4Y2YA 1Z09A 2EJVA 3GEEA 3GJ3A 2WF8A 3LS2A 2A35A 1WF6A 1CB0A 5F83A 3UHFA 5IZCC 4PS0A 4C2TA 1FF9A 1S67L 1ZHHA 2W11A 3FMOB 4R8VA 1EVZA 5T6MA 5TMEA 1ZK3A 1V8DA 3GP8A 1XZPA 1WZIA 4M1EA 1DBSA 5DHSA 5F1KA 2NT3A 2FFAA 1X7WA 2OXEA 3BSSA 2O2IA 4R23A 4FONA 2QY6A 3HHPA 5JR3A 4AWXA 3AFOA 3WGHA 1QE5A 2DPHA 3OX2A 4R3JA 5HZGA 2ZJBA 2PRZA 2WSMA 3RC8A 3X2SA 1Z6QA 4KLRA 5B6PA 1EFKA 4NCHA 1T1GA 1MGOA 3DOJA 1HBJA 1H22A 4DWOA 2R86A 1Z75A 3DE2X 4IJKA 4CM9D 1EM6A 1I2CA 2CHFA 3ZCZA 4OXXA 2J5KA 3ABQB 5AOBA 3BSFA 2QWXA 3UJAA 1B42A 5ADVA 2GK6A 1JJVA 1K6JA 2VLBA 3AR4A 3UWKA 2QNBA 4D02A 4NZNA 2BHNA 3MTQA 4M0CA 2VWGA 2G25A 1QGUA 1ZU5A 1GGKA 3X1XA 5BN5B 5BRAA 5KIZA 2XKKA 4M7PA 2QMIA 1LS6A 4C7MA 3M4YA 5FA5A 3FYCA 3HO1A 3DAOA 4D1YA 4UU7A 5JQGF 4K0XA 4PYLA 4LFBB 3IAM6 1AF4A 5F1YA 2IYFA 4JLFA 4NOJA 3A9UA 4X84A 3WWZA 5LWHA 4I3GA 1NXOA 3AVYA 3VPDA 5EXTA 5JJKA 1FDWA 1ISHA 1NNEA 3TJMA 1GLGA 2VZ0A 4NS4A 3HZHA 3K5IA 5A6SB 3FI9A 2HT6A 3L6UA 1XLUA 1J9ZA 4K6HA 3OMXA 3HWSA 2NSYA 2Y0BA 2GJKA 3VOSA 2ZYIA 4F4JA 1DAIA 4K6CA 1VB3A 4IDEA 4KPUA 1T5IA 3IUMA 2BFAA 1KVLA 4KAXA 4C7VA 3K71B 5B7GA 2JEOA 2YJ6A 3V1LA 2FW1A 4LJ7A 3FSEA 5CEDA 3PHBE 3OLCX 1X7ZA 1KHHA 3BHMA 1D2AA 3CUVA 3CZCA 4F4DA 3NOQA 2R6JA 2H9AA 1FRQA 5DNYB 1YZKA 1WZEA 3HCAA 1Y5IA 2ZRDA 3JSXA 1OU4A 5GPBA 2HGVA 4JHLA 1GG8A 4PYMA 2QLMA 4JQOA 3PHJA 3PVSA 1L5GB 1C41A 4OHXA 1ZVVA 4EVSA 4ILKA 4P3OA 1U94A 5G4LA 2FP4B 2XGJA 3WGGA 4JZKA 3P4YA 3G8DA 3VR6D 3IEIA 1XRSB 4EB0A 4TMVA 5HKBA 3UHJA 2DX7A 3PHCA 2WB2A 2BASA 2P4SA 4C2BA 4DRZA 4H1TA 1G5TA 3TZBA 4Y30A 2AMLA 5IWAB 2CZCA 2OBLA 4I2NA 4I46A 1JG1A 5C1IA 2GB4A 4OP1A 4F9TA 3NGXA 1GA1A 1E4EB 4CJXA 1JG7A 3SWWA 1PG2A 2YYAA 4CL0A 3BGDA 2Y2IA 1ZGGA 3NHMA 3I04M 2RKBA 1ZJ4A 3MCUA 4GIBA 3NOVA 2PFSA 4RPJA 4XIIA 2V9PA 2P2ZA 2VCYA 2YHAA 4ZZ0A 3HPQA 4RYLA 5KHOC 1ESNA 2Z5FA 1UXKA 5ECDA 1ZKMA 2F1OA 3DGFC 1XVLA 4B4DA 4INZA 1CDOA 5KQLA 3OPYB 4UJ5A 4U2DA 1W0KA 4BO8A 1ZOLA 5CVCA 1II8A 4B82A 4UFNA 4ZHQF 1JPUA 2O2JA 3WRWA 1EE1A 4CYMA 5JYBA 3B6MA 4KEAA 3ZHBA 5CHYA 1A7JA 3ZGXA 5LSAA 2NADA 1K7SN 2PX6A 3TTYA 2CFCA 2GHIA 4IYRA 4ZIRA 3K9HA 1M6YA 2XNJA 3HKCB 5SZHB 5DFAA 4ZRNA 3KZVA 3IS2B 5ALKA 3OTOB 1U4SA 2OG1A 3IX4A 4EBNA 3NEAA 4F8JA 4ZYZA 3KJXA 4G9GA 4F46A 2DVMA 5FNVA 1NULA 1N3YA 4UQOA 2W1TA 2X1VA 4GOLD 1KK3A 3ETNA 2H4HA 5FLKA 3DNPA 3UXMA 4PNHA 2OLUA 3GV9A 2BEVB 4E5SA 1XXMA 1L0GA 3ZUPA 2J59A 1UPXA 5EPUA 4RF2A 4HX2A 2V3CC 1RXSA 2YXDA 4LXTA 3GVCA 4PIVA 4OKIA 2WYOA 4GB7A 3CZ9A 5EP2A 4MKHA 4MUAA 3V7YA 2VWPA 3C8MA 3HV0A 2Y1GA 2GTPA 4PYJA 3TF5A 4CM7A 4DC0A 3KWMA 1IJKA 3H86A 1EEHA 1MAUA 1ZD5A 3SYRA 5CLHA 1EFPB 4GSYA 4KOAA 4LKOA 1ZCBA 2QY9A 2QPAA 2ZANA 5ULLA 3TUIC 3JPUA 1RHMA 4YXFA 1UANA 1G4AE 3A4NA 4QDXA 1A8HA 4F11A 1P5HA 4X91A 2G4CA 5JD3A 4O4LF 2HD4A 5IXYA 3UGJA 3AU9A 1QUFA 4F72A 1SEPA 2X5KO 3UM9A 1ZN9A 4K2AA 3I7JA 1Q7TA 4M4XA 1P2BA 1NBWB 1V8OA 1DJCA 4FMCF 4E3WA 3P2JA 4NICA 4M22A 1WBDA 4OBBA 4QC2A 3DGEC 3EJWA 1E1DA 2J08A 3T1NA 3VI4B 3PNQA 2C7RA 4GNUA 1XP5A 1EFUA 3A10A 4QXMA 1JDVA 1AGNA 4WOJA 4HZIA 3TL6A 2ECOA 5C52B 1R6TA 1GGVA 3NHAA 3V46A 1LK0A 1D5WA 3MLEA 1C30A 6NULA 3CI6A 1DTSA 1P3JA 1VRWA 3AERB 2QAGB 2GZRA 4L22A 2FR0A 3U4QA 3MXQA 2QX8A 2JIZA 4HI0E 4U02A 1VDMA 2CXPA 2P4EA 3MQ2A 3K70B 2C92A 3CIOA 5KTNA 2J87A 3EBLA 3A70A 3U1VA 5JZMA 1N2SA 2HDNB 3C24A 4HLUA 1FFAA 3GA5A 3SZUA 4NZMA 2VYVD 3OMLA 4OGKA 5T4EA 4NBWA 2Z1MA 4CWAA 1D5CA 5D5QA 4OJMX 3ZG0A 4BLWA 3NIDB 1FMTA 3WWEA 5ALHA 4X1KA 3OFND 4M8SA 2ID9A 4UNSA 3CG0A 4KQRA 5KYYA 1XVTA 2FRDA 3TG8A 2CLHB 1G98A 2D02A 4FU0A 1PVDA 3P2MA 4YPVA 3GH1A 1QP0A 3ETDA 4I9FA 5DT9A 5CK4A 3PWSA 3R0JA 3L84A 5K3AA 2XBMA 3LIAA 2I2DA 1FFHA 3EXHB 3Q11A 2C9BA 1PFWA 3HLBA 4ACBA 3UMGA 3BXFA 3HKEA 2QAJA 1NBME 1DCTA 3HNOA 3FTNA 3WMFA 4QUBA 1FBTA 1Y6RA 4MQFA 3N2GB 1FXWF 5JSUA 2I7DA 2Z4RA 4O2AA 2GAAA 3JX9A 1OLSB 4PHFA 4JUDX 2JRCA 4Q3OA 1A27A 3HNPA 4FYXA 3O1JC 4EEZA 1RQ2A 3E1SA 3PDIA 2HM7A 4MDEA 3SEFA 3ZWCA 3LCUA 5K1ZA 4EFDA 3S40A 1FMJA 3KV1A 4PLYA 8OHMA 4Y9TA 2WYUA 1FUIA 3T7CA 3E3LA 4Y6RA 3CU5A 4QDTA 1ECCA 3L8HA 4MIYA 2K2WA 4DTIA 4YV7A 3P5SA 4B7ZA 5E2AA 4IOMA 2C82A 3K6SB 2IU4A 4XUGB 2AK3A 4TL7A 3GJ7A 5DKFA 2YQ5A 3KBOA 1Z26A 2PCJA 5HAIA 1VCHA 4QDUA 4F4CA 1H2FA 4GLOA 2QLBA 3LOPA 1KQPA 3EGXC 3O31A 4EV4A 3MWJA 3OI7A 4II2A 4EX7A 5I48A 3RSCA 1QIKA 4LRXC 3C5CA 1NQVA 4QA9A 2ZWAA 4X55A 2Y76A 3AU8A 5B3AA 1ZI9A 3NATA 1E3EA 1RCTE 2H2IA 3VFHA 4UHBA 4S12A 1NF2A 2FFJA 4EYEA 2BM1A 2A1TS 4B4UA 2HLDD 3V9PA 5ALSA 3VOAA 2QQ5A 1ML3A 5LBTA 3ED5A 1F4VA 3IKJA 4LX0A 4XB6B 1QF9A 4Z4QA 2ZRAA 2OQVA 4H27A 1JRLA 2JFHA 1L4MA 3EQ2A 3Q1KA 5JWHA 1NOKA 4R71A 1Q12A 3K0AB 4ARSA 3C7VA 4IUYA 1K9SA 2V0NA 5AJTA 5DX8A 1L6IA 2X2OA 2QHKA 2VSOA 3KOYA 3RBVA 4C3QA 2AZ4A 1Z28A 2NVOA 1T0HB 4HJ6A 4G36A 2PKXA 3M6FA 1I1QB 5E4YA 4ESVA 1XMIA 4AWAA 2PBLA 4BRSA 3CEJA 1UBKS 4RTJA 4PRYA 2QM7A 3FTPA 3F5QA 4KZPA 4NS1A 4ITRC 5A4AA 3L1VA 4RFVA 2A7XA 4FE3A 3HDGA 1IBSA 3K1TA 5JNLA 2WZQA 3L92A 1TCVA 3V4VB 5JQGA 1BC5A 1KJNA 5HWVA 2W48A 2WVHA 3TO5A 1P81A 1UGUA 3PCRB 1P7YA 1L4FA 4X92A 4QY6A 2FN4A 3IMCA 3THYA 3A6FA 4OXIA 5CIWA 2UUAB 4F21A 2DERA 2D8MA 4IIDA 2DUUA 3PUVA 1LTHR 2A86A 5AKKA 2SKEA 4AMZA 4FDUA 2AUMA 3HU3A 2G71A 3MXRA 3A37A 3M6UA 4JYBA 3M6IA 2NU7B 3SYLA 3IWQA 3EAQA 5GIPE 5I7RA 3O1HB 4Y2HA 1YGPA 3ZFZA 4Q3EA 3GVIA 1IHUA 4ZVMA 5G0UA 4N3CA 2WPNA 1M2OB 3U6BA 3GGCA 1RM5A 5JW6A 3H2YA 3QU2A 3LXUX 1EVJA 5LDGA 5KZMB 2EG9A 3D4IA 3R24A 3CWCA 1J20A 1R8SA 4EY6A 5K8VA 4BEWA 3CSUA 2Q6TA 3JAWB 3KQLA 3CE6A 3WSVA 4IFBA 1VL6A 3Q9UA 1ZBDA 2HZ5A 1MRZA 4XGNA 3LHFA 4XJSA 3IHLA 3W4IA 4N7JA 3V2IA 2CLFB 4X8OA 4XQCA 2ZRKA 3H83A 2OPHA 1IRIA 5LOVA 2DFLA 2C4TA 3LA8A 4S2OA 2WIKA 4UAGA 4I1UA 1UOQA 1Q57A 2PJZA 1PZXA 1OWLA 2YV5A 4QG7A 5CH8A 4IY1A 4NULA 4G3XA 4ENWA 4OOFA 2VUSA 2O2ZA 3SR3A 4CEIB 2NTEA 5ITSA 2W2TA 4H0CA 4B75A 2BT4A 2RBGA 4N3BA 2P2CA 3WL6A 4JSTA 4E51A 3OC6A 4B6RA 1QJ4A 3S2EA 4IDOA 4FR5A 4RBNA 1E9VA 2I33A 1VJTA 3H4IA 3ETJA 3B3AA 5JH7B 4XVCA 4UUOA 5DLEA 2EJUA 1KFEB 4S1TA 3HCWA 4YGYA 1OH8A 4JZYA 1FCNA 3KKNA 1V47A 3ZNOA 1HD8A 4MR9B 1KMMA 2AR0A 4CIWA 2VUIB 1ZG3A 5KOYA 5HDSA 5C5KA 3IA2A 5C37A 2DWPA 1U2RA 1BRTA 3RTCA 3D4FA 4P3NA 4IYJA 2JIOA 5M7EA 4OP3A 4AQDA 3DV9A 4ASUA 2XRFA 4LZZA 4F3NA 3EQ7A 3VU9B 3ZDFA 1C9YA 3I39X 1T26A 4GZ6A 2D2XA 1U1FA 3DDWA 1LDEA 1IHXA 2I4MA 3IOEA 2AN4A 1V3UA 3DUWA 1IB6A 3KZ1E 2VDUE 3AP1A 821PA 1R0CA 2G77B 1KP2A 4K9RA 1DEHA 3F47A 3PNSA 1MA0A 5DEOA 4FR0A 4ZVOA 1AKMA 2RGBA 3TW6A 4FYVA 3DLCA 4K9SA 2J07A 4BEBA 2IX9A 2ZBGA 4OYYA 3C97A 3P9KA 4N01A 4FDVA 3TOIA 1E1QD 1EFVA 3L6BA 1K8QA 2KM1A 3CCFA 2PNFA 1KYXA 1LLCA 4XDZA 3H1BA 1UXJA 3JD4A 3D8HA 4GPAA 4X94A 4K9MA 1RI4A 2EJWA 3L05A 2PAVP 3JZMA 4XD2A 4UTRA 1K66A 4Y1EA 1I4DD 2OZKA 2VRWA 5SICE 3BIFA 3EQZA 2DCFA 4DBLE 3F2VA 2BKLA 3K53A 4KI7A 2B6HA 2J4DA 1TVMA 2P30A 2RHWA 1YI8A 4OPZA 4TVOA 2JGLA 4E88A 2VP3A 5COQA 4XGIA 1ZC2A 4HPWA 3UPTA 3L1IA 3RJUA 3O4VA 3F2IA 2WY2D 4PV7A 2D7JA 5FEGA 2FF5A 3R3YA 2VEAA 2XLBA 3BQMB 5KU1A 3MCWA 2VOEA 4E14A 2H5LA 5B4VA 4BENA 1NBAA 4KQMA 3TRFA 621PA 4BFTA 1Z2OX 5BXQC 4MLLA 1KXZA 3VKUA 4B3MB 3IOYA 3REGA 3KJQA 4BIIA 5KUTA 2WWXA 2X9VA 4HZGA 2W2VA 3PNPA 2B37A 3LIPA 3WYFA 2PLFA 3B9BA 3Q87B 2FKAA 3NP7A 2R8RA 2VTBA 4KC0A 3ZZ1A 1RYYA 2Q1SA 2GBLA 3ZXYA 1NXWA 2PGAA 4BQFA 2V8OA 4B34A 1L5HA 1PYDA 1FMLA 1CC1S 1KEWA 1BSVA 1KSJA 1YVRA 2QF7A 1P0CA 1PJZA 3R8FA 5I9NA 4EDHA 1MQSA 3BX1A 3B78A 3Q2KA 1G1AA 2Z09A 3TVYA 1KJ8A 3LUBA 2V1UA 2EFYA 4Y1FA 2C9CA 2W2LD 4F2DA 1F2UB 4OHUA 4OUKX 4OXYA 3GA0A 1RR6A 5CB8A