2WKQA

Structure of a photoactivatable rac1 containing the lov2 c450a mutant
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
317
structure length
317
Chain Sequence
b'ATTLERIEKNFVITDPRLPDNPIIFASDSFLQLTEYSREEILGRNARFLQGPETDRATVRKIRDAIDNQTEVTVQLINYTKSGKKFWNLFHLQPMRDQKGDVQYFIGVQLDGTEHVRDAAEREGVMLIKKTAENIDEAAKELIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGLEDYDRLRPLSYPQTDVFLICFSLVSPASFHHVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NPH1-1, RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 1
publication title A Genetically Encoded Photoactivatable Rac Controls the Motility of Living Cells.
pubmed doi rcsb
source organism Avena sativa
molecule tags Transferase, cell adhesion
total genus 108
structure length 317
sequence length 317
ec nomenclature
pdb deposition date 2009-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2wkqA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2wkqA02
4BBVA 1T18A 2WWFA 1DP8A 1W2GA 4EPVA 3P32A 4PC1A 5JECA 3LIAA 2MSCB 1WBDA 1SGWA 4WXRA 3HU1A 4P4SB 1WA5A 2QQ0A 1ZC4A 3IUYA 3D72A 1AM4D 3EWSA 2AX4A 3W3AA 3OLOA 5FPKA 4B3GA 1W47A 1NP6A 4H1UA 2GCPA 2ONJA 1VTKA 4Q4AA 1AS3A 4E5UA 3AF4A 3IQXA 1NJFA 3SU8A 5A5GA 2O8DA 4MKGA 3QG5A 1W0JA 3R9XA 3ZYCA 3DM9B 3SDZA 2IS6A 4AWXA 3FVQA 4QJ4A 1Y3AA 4NZYA 3H9WA 2OM2A 2QGNA 2XJ9A 2J0VA 3AUYA 2FF7A 4OHVA 1U9IC 3GLFE 2AHOA 2ODBA 4DCNA 4GL2A 3CH4B 4RVCA 4ARZB 3HJIA 2Q6TA 4TQ9A 1E3MA 4PSKA 3QG1A 1KY3A 2WIAA 3H7WB 3QKRA 4A6PA 1E0AA 4S2EA 2QHKA 2QP9X 1RPZA 3CLOA 4MN5A 2Z43A 1FUUA 2EU8A 3V4RA 1XMSA 1CU1A 3LLUA 4M1KA 2PL3A 4ZKEA 4X8MA 1Q20A 1AK2A 2GKSA 2JLSA 2PEYA 1II8A 4KBFA 5DHFA 2ZR9A 1XTRA 4EPYA 5DN6D 2VHTA 3PIRA 2WJJA 2NO0A 4LHWA 3T06B 1UADA 3X2SA 2XX3A 3LX5A 4LJ7A 1BYWA 3ICQB 2GEDA 3F5FA 1JQLB 2DWPA 4TMZA 3UATA 2GJAA 3C8UA 3H2YA 1WXQA 4TQUS 4Q7KA 1IOZA 3U3OA 1BMFA 4LGMA 2I4IA 1OLOA 1Q22A 1QZXA 1Z6AA 2Q3FA 2RGCA 5E7MA 5LPNA 2KDKA 4JT4A 1TX4B 3K9GA 1ZP6A 4D26A 1G19A 2DPXA 5SZIA 4HP9A 4BZPA 3KTAA 1DARA 2IEZA 1SVLA 3K0CA 3L0IB 1P2VA 1VB6A 4NTZA 4A8JC 2KBEA 2PZGA 1RIFA 3AH8A 4JBWA 5CJPA 721PA 1EX7A 1ONBA 3ZQJA 5ANRB 4A6XA 1RJ9A 2W6JA 4ABYA 2VHCA 2CL6X 2B92A 1AQYA 1VG8A 2WWGA 4LWZA 3BY9A 4NH0A 4Q48A 3PCRB 2PD7A 4C2UA 2ZSEA 1GNRA 3VAAA 3BH0A 2F9MA 4DCSA 4EPTA 3A37A 1DOAA 2ZRNA 5F68A 4KJZA 2HT1A 5HWTA 4Q1DA 3LIEA 1E69A 3CR8A 3IQWA 4C2TA 2BMFA 4V02A 3CRVA 3G0HA 1KSHA 5JJIA 1X8JA 2JLQA 5KDDA 3ADBA 4L16A 3UMSA 4NCJA 2OBMA 4B3BA 5JBQA 3DOEA 1E94E 3FOZA 1KO5A 4EEUA 1EX6A 4K46A 1KKMA 4N3NA 1MV5A 4JLVA 3T34A 4Q4JB 3TQFA 4P31A 1BYUA 3CZPA 3BD9A 1SKQA 5JRZA 1N5KA 3O8CA 2XOKD 3BE4A 2AXPA 5IK2D 2CNWD 3N5CA 1KSFX 1QHHA 1U90A 2EWWA 5BYKA 1XZQA 2AK3A 1EWRA 4YMUA 4ASUA 3SC3A 4WUJA 1G20E 1Z28A 2QI9C 2RGNC 2WAYA 1UDWA 3DZ8A 1PLKA 5JWHA 1IN8A 2IYZA 5TBMA 3MXQA 3IEVA 1P4SA 1IM2A 1DRMA 2GBLA 4O3MA 5FTNA 3SOPA 1LT0A 4G5GA 3RS3A 4HLDA 1XD9A 4M9SA 1E9FA 5FI0B 2JAQA 2W00A 5CB6A 1YR7A 1G3RA 1DG3A 4HAYA 3I4LA 4BLTA 5HDCA 3AF1A 4S35A 1OTIA 1I4DD 1N0VC 2ZYWX 4BLSA 1OH8A 1KTVA 3EPHA 3CB4A 3EZ6A 1GSWA 1Z2CA 2GEVA 2ZYVX 1D7EA 4V0OA 4DEXA 3SQWA 3U44B 1IXRC 5E3HA 3KB1A 2OT3B 1HURA 3D31A 4DT1A 1KK3A 1E2JA 3HR7A 2D7CA 4ZDKA 3ZS9A 2OCAA 3GEEA 4BGDA 4LC0A 1E32A 3KL4A 4YMSA 3ZZUA 1LB1B 4AG5A 3PJRA 2FNAA 5F69A 1KDTA 4GHIA 2BEKA 1CEEA 4A0FA 2J7PA 1TS6A 1SVSA 3CNNA 2BBSA 4G5OA 3UE6A 1ETUA 2IXEA 5KTYA 1PLLA 5J4KA 4IVPA 5CK4A 3K09C 4A0HA 5L3QA 2X8AA 1G64A 1QHNA 2BIFA 3ZGXA 1OFIA 4JL6A 5LB2A 1UKVY 2YNMA 4Q1FA 2DWOA 3L0OA 1NMXA 3MWJA 2ZVPX 2VO1A 4C9BA 2WJHA 4LBYA 3ZVNA 2BM0A 3UIEA 1Q3TA 4QRHA 3F1PA 3ZLJA 1X3SA 1W0KA 1ZC3A 2B7CA 3GECA 3J81k 4JLNA 3SBEA 2VH5R 2RGEA 3BB3A 2GEUA 3TAUA 1KI1A 3LNCA 5DI3A 2NTYC 1KI3A 2OV2A 2PJZA 2IXFA 1VG0B 2I3BA 1MZUA 3NHAA 4KHZA 4QJ3A 3H82A 1G5TA 1IN7A 5DHAA 3MR0A 4DCVA 1NI3A 1JXMA 3NBXX 5EZ6B 1ZNWA 4F3LB 1G3MA 1NBMA 3UMRA 4BQSA 1E9CA 2WJIA 2REXB 1N2CE 3FC7A 3CRRA 4AURA 1J99A 2WWWA 3AP3A 4QBIA 3P1JA 4HI0E 4PC6A 3TLXA 1FOEB 3SHWA 5GADl 1ZMXA 1XMIA 1JAHA 3FMFA 2QY9A 3FKSA 4GOXA 1F9IA 3VR4A 3BK7A 3RDPA 4BFVA 5GVSA 3B1ZA 5BYJA 3EARA 4M1TA 4UXHA 3UG7A 2ZRIA 2FX3A 3KX2A 3M6AA 2FPKA 4O2RA 3TE6A 4PZYA 3BS4A 4HH3A 2IWHA 1WP9A 2QQEA 2XTZA 5L3SB 1NVWQ 2G83A 1SHKA 4US1R 1RKBA 4JVMA 2WKQA 3GLHE 2G1KA 4HAZA 1Z63A 2IHBA 1COWA 2W6JD 4CVNA 1S2MA 3BJIC 2FJUA 2JGNA 4JLAA 1KO1A 3TQCA 1XTQA 2FZ4A 2VP4A 4OJKA 3DKPA 4TYQA 3EA5A 4RCYA 5J4YA 2EYUA 1S66L 3ZVLA 3SE0A 4DLVA 3C16C 2V0UA 3RTYA 5J7EA 1IONA 1E2PA 1KDOA 1SVKA 3TK1A 4TLEA 3O8BA 1T3HA 2DHRA 2ZI4A 3VKHA 4D0NA 3P4XA 4OI1A 4JLDA 1E2GA 3A1VA 3RS0A 4AI6A 3SYKA 4MYCA 1HQYE 5DLQC 2XNSA 2WM9B 2F3RA 3MD0A 1XPRA 2OFXA 4WLAA 1Z0FA 5E7IA 4OHYA 2VP0A 3GFTA 2NO9A 1CF4A 1XJ2A 3WMFA 2OAQ1 2ZUDA 3BXZA 2X2EA 5FUWA 4GW9A 5EUMA 2OBNA 3AGPA 1Q1QA 2PLFA 4HEJA 4ASUD 4AC9A 5JMTA 2GF0A 2DFKB 2IW3A 2YC4C 2GXAA 2YKGA 4TWZA 4TL7A 2OCBA 4Q1EA 5AUQA 4ZCIA 1KOUA 1OXSC 4LHVA 3QXSA 4K8OA 2PX0A 4MYTA 3GJ8A 4H9GA 5CDFE 5B2ZA 3F1OA 3B8HA 1DO2A 3CRQA 4BFZA 1U8AA 5GJWC 5AUPB 4LV8B 4AKGA 3ECCA 2CEAA 5FBLB 1D5CA 4F38A 1N9LA 1PVOA 3LVQE 3P7NA 4JIMA 1XBTA 3I8SA 3BGWA 1W4AA 1TF5A 3EA0A 4WA7A 4OK6A 1Q1EA 2AR7A 2OILA 5B58C 2OE2A 3H4MA 2QRNA 3TW4A 4G5SA 3BY8A 3IS2A 5J4LA 2PT5A 3AGQA 2ZI5A 2OFWA 2P65A 2VPPA 5FR2A 3ND9A 2B8TA 4ON9A 4PSVA 2CHVA 3THYA 1T0HB 4JLJA 4M1YA 3B33A 1FFHA 4KVAA 3UMFA 4RSGA 1XEXA 2HV8A 2HXYA 1YQTA 4NYMQ 5A8BA 1A7JA 3B60A 2J7PD 3B1XA 2JATA 4L9SA 5GVRA 4HDCA 4GSYA 4QGAA 3VHLB 1FNMA 2JLXA 1G8YA 2KWIA 5CLQA 4D0LB 3SYLA 2ZXUA 2WJYA 2L0WA 2Z6CA 3A0SA 3GJ5A 3AKYA 4JLPA 1ZM3A 4OYHA 4EEPA 4XH9B 3V00A 1W4BA 3PQCA 3LQQA 4EIWA 3LO5A 2OO7A 3VU9A 1MO4A 3CIOA 3HPQA 2ZETA 5C4GB 3FTQA 2I9VA 5JEDA 2O8CA 4NBSA 4ZCLA 5DE3A 3WNDA 3GDIA 1QVRA 1VHTA 2YYZA 1A4RA 4JMPA 1G7RA 1AKYA 3GJ0A 1T8TA 1NVUQ 1R4AA 3QKUA 2V7QD 1P9NA 3HP1A 3NBYC 1W0KD 1EFHA 4LDJA 4V0NA 4NYIR 5DKKA 2VF7A 2ZSDA 4AY2A 2VLGA 2XXAB 1OYYA 4BUJA 2UVQA 4P4UA 3TRFA 2WWYA 2C2HA 4G01B 4XD7A 4OQNA 4V03A 4CT5A 1EFTA 3OIUA 2P6RA 1IY1A 5FOWA 1CR1A 4LZZA 3VE4A 4A0RA 4A36A 3Q5DA 2WKPA 1NSTA 4NCHA 3U3KA 4BFWA 3PUYA 1E98A 3DDCA 3MJRA 4LYJA 4FWTA 3PHYA 1C1YA 1R8QA 1SXJB 5AJYA 2J1LA 1US8B 3RRMA 5FBVB 3ZD6A 2WJGA 2OWJA 3CRMA 4P4TA 1S4RA 5B64A 1OB2A 2BBWA 1PLJA 2X1VA 3GLGB 2ZM5A 2ZRCA 4M4SA 4LRWA 1Z06A 1TS8A 2WOJA 3ZZTA 3WMEA 2QG6A 3IIJA 3BB1A 4B44A 1CR4A 1XPUA 2DBYA 5FR1A 2D06A 3RAPR 4LPSA 2JLVA 1JPJA 3PFIA 1JEDA 4KU4A 4LJAA 2IA5A 1Z8FA 3R7WB 3UWOA 3MWKA 2KX6A 1CJMA 1MT0A 2J0UB 1XFQA 1OXXK 4EJSC 2HF9A 4PHHA 1VIAA 4PO1A 4LRZE 4DZZA 1COWD 1I2MA 1ZU4A 4I4LA 4NU0A 2W0SA 4BE7B 4DSOA 2G0TA 2IS1A 4TTQA 4EFMA 4KSCA 2QMHA 5EP3A 421PA 1R0XA 2RAPA 3MWLA 3RRZA 4EQ6A 2CDNA 1T5LA 1B0UA 2IF0A 2O52A 1XNJA 4ILEA 1N5IA 4PC3A 3VFDA 4HJ4A 1ZYUA 4LV6A 4AYWA 3WP0A 4G5RA 4NXEA 4GOJA 1HQCA 4A9AA 4WF0A 2E87A 2IBMA 5D3MA 4DDTA 1TF2A 4MH0R 2PT7A 3OF5A 1Z08A 4BFXA 4TLAA 4TMWA 3O8RA 1XJCA 3ZS8A 5JCPA 3KFXA 4BRUA 5J47A 4PXAA 4GCZA 4QOSA 4NP6A 4QGGA 3E4OA 1YZQA 5AJWA 4EPXA 2INWA 3TUJC 1YZKA 5F2EA 2YV5A 2ZS8A 2JHEA 5IS1A 4B3FX 3LI8A 2KI5A 2PD8A 1RC8A 3TR0A 1F98A 3SFVA 1LF0A 2QM7A 2BCJQ 5HDDA 5JHHB 5KSPA 2O8EA 3NDBB 1P61B 4C7OA 1KI4A 1NN1A 4UNQA 4QG7A 1YJ5A 1C9KA 1L8QA 3OEHA 4CEHA 1R6BX 2CCJA 2WMOB 2FMXA 1G7TA 1GSIA 1NLFA 2LKCA 3OIWA 4GP7A 4RD4A 1Z22A 3RS5A 5KO2A 521PA 2ZJ2A 2H1LA 4FMDB 3CR7A 1CJUC 4DB2A 3KXLA 1UM8A 1P9WA 3TMKA 3W9YA 3AVOA 2GAOA 3M0EA 1S1CA 3RANA 2B21A 4BFSA 1NG9A 1OH6A 4IXNA 1VYVA 3JVVA 3LV8A 1LSWA 1L4YA 3NOPC 2KB0A 1HE1C 2AK2A 4E07A 1M6NA 1KO4A 2FFHA 4POAA 1AGPA 4I3IA 1N0WA 2EWVA 1Z5ZA 3BH6A 5DN6A 2V6IA 4ZKDA 5KNDA 3I62A 2J7KA 1KDPA 1JR3E 5E7JA 3UWKA 1SHZA 1G7SA 3O47A 2IYUA 4A0GA 2YKFA 4I1VA 2AKAB 1KGDA 3CBQA 3VTKA 3QQ5A 5L3VA 3P4YA 4HATA 1E0KA 1JNUA 1MO3A 1KI7A 2BKUA 4HB4A 3P20A 4MRPA 3QBTA 3GPLA 3THWB 1H8ED 3UG6A 1T6NA 1IAQA 4Z51A 2GESA 3MLEA 2BV3A 3WNCA 1KZ7B 4KFSA 1E99A 1Q1BA 4HZIA 4PAQA 4H1VA 2QE7D 2VF8A 3C5CA 5G41A 5F9FA 3VKGA 1VCMA 2SHKA 1IQPA 2Q9BA 2F55A 1T5IA 2FA9A 5JSZA 3LUQA 1UBCA 5K8LA 1CR0A 3NHBA 4A2PA 4TYPA 3EPKA 2CMNA 3WBJA 2XZOA 4DUGA 4NYJR 1W5SA 5CLLA 3AVQA 1NNEA 4M0LA 4F92B 1OSNA 1F48A 4BLRA 2QT0A 5DISB 4HLUC 3UANA 4GMXA 2PHYA 1YR8A 2ZRDA 2IX3A 2OESA 4ZCMA 4B73A 3NJAA 3CPEA 4LPZA 1ZM2A 5EUQB 3M4YA 2NQ2C 3IBRA 3I3SR 1WDTA 4FN5A 4G1UC 1QHIA 4U02A 1DS6A 1CXZA 1PUIA 2ZS9A 3E5HA 2VYFA 4GMDA 1FTNA 3VR5A 2WPDA 5J4HA 2XNDD 1M2OB 2V1UA 3WYFA 1CIPA 2VV7A 4MUBA 2XOKA 3TSWA 3AQ4A 2QU8A 1T4GA 2OXRA 4MKHA 1ZW6A 4TMTA 4WOPA 1TU4A 2AL7A 1Z83A 2IL1A 3EC2A 3GLIA 2B8WA 3QXHA 1U8ZA 2CLSA 4JJZA 3W3ZB 1XP8A 4C0QC 2BWJA 1CS4C 2R6FA 4MKIA 3ZD7A 2PCJA 1DAGA 4Z1MD 4Q4AB 4JLMA 2V9PA 3HYTA 3NC0C 4V0MA 4OK5A 3Q8XB 1G8HA 2QENA 3VQTA 2R8RA 2O8DB 4EW7A 3RC3A 3AVPA 1U99A 1E9BA 1CJKC 2C95A 4XVRA 2JEOA 4MDEA 3KKOA 1JALA 1YZUA 3KJEA 4FCTA 4QNRA 3D7MA 5L3RA 1GRRA 1DAIA 2D2EA 2E1RA 1KKLA 1TNDA 2WIBA 2WZQA 2XAUA 5EE1A 1IY0A 2D02A 3U3RA 3LY5A 1EWQA 3ZVRA 2G88A 3ASYA 2C9YA 3Q7PA 1SXJC 3RWMB 1P9RA 4QL3A 5K8TA 2BHRA 2ZR0A 4B3CA 1HT2E 2HF8A 3UB6A 3QPWA 5C18A 4YC7A 2QP3A 3QKRB 1FX0A 2EFDB 2V9AA 1TS0A 1T3LA 4IDOA 3AVWA 1ZU5A 2WSMA 5JS8A 4GS9A 4IFEA 3CAXA 4UQOA 4QM7A 1UEJA 4I5SA 5KNBA 4FMDF 1GAJA 2V8OA 3FFBA 3HWSA 5F5YA 1II8B 1N6IA 1XXHA 1ZCAA 1AS0A 1YZLA 4D82A 2QA5A 2QNRA 2R65A 1RRPA 3TIFA 2O8BA 4B2PA 1DTSA 1NRJB 3FMPB 2PZEA 2RGNA 3EIQA 1W4RA 2HJVA 4HY8A 4V0LA 1S1MA 2IUTA 2F43A 3MAAC 3QVVA 3V9PA 2ERXA 5DKLA 4KQDA 1TQDA 5HKKD 3M1IA 1KK2A 1PZNA 4XJXA 5JWRA 1LW7A 4WVFA 4QHSA 1AJEA 3NXSA 5DJUA 3KTAB 3KXKA 4FINA 2F1IA 4Q4HA 2AN9A 3OEHD 1AN0A 1CTQA 3BAFA 3BIFA 3NBZC 4FMCB 3W5IA 5H8WA 2G0NA 2QORA 3THXA 3FHCB 2AD1A 4HUQA 2PMKA 1IN5A 1ZAKA 1RJ9B 3F8TA 5J5CA 5IF9A 2BM1A 1SVOA 2XEXA 1V9YA 3FKQA 4RD6A 4C30A 1F3OA 2FEMA 3T5DA 2ZE5A 1GWNA 3O8DA 4YONB 3LYXA 2FH5B 2A9KA 3QKSA 4XVQA 1G8FA 2CL0X 3KX0X 3C7KA 2H16A 1JB1A 3KKQA 2ZYTX 2H28A 5DO9A 5JI3E 3PEVA 2M1CA 3F3YA 4PC7A 1EW0A 1N5LA 1DO0A 4URUR 3AVXA 4NXFA 3W34A 3FGNA 1F2TA 3GQBA 4UNPA 5C2JB 4URVR 1MABA 1YR6A 1YZTA 2IYYA 2ZI3A 1XJ4A 5FOUA 3NC1C 3DZDA 2OLJA 4HI4A 4ACAA 4RD2A 3SYNA 1S4SA 1T91A 2IUSA 1OJGA 3PEWA 1QHHB 2B6HA 2ODEA 4KSBA 3QXJA 1BS1A 5HD3A 2ZREA 3B2EA 1F6BA 2BDTA 5TBMB 1XJQA 3X1ZA 2WMNB 4GPTA 3SJBA 1PJRA 5FPHA 2YWGA 3B9PA 4ERNA 4LJ4A 1P97A 2EFEB 2CBZA 3ICYA 4EERA 4QKQA 4DUGD 2PCLA 1FL9A 3OE7A 3I92A 1WBBA 2EW1A 1Q44A 2JJ8A 2X77A 5GJBA 3LA6A 1P2TA 3CWQA 4TSFD 2ODWA 1SXJE 4IOLA 3A6PC 4HZUA 1Z6TA 3NDPA 4PHTA 3TJZA 3KUDA 1GZSA 4YMTA 2Q21A 2ZRAA 1XJ6A 1VYUA 4ARZA 3AP1A 4D4KA 3Q5EA 4F4CA 4DT1B 3SHFA 3GLGE 1GP2A 3RRYA 1EXMA 1VCIA 1G16A 2NIPA 4AKIA 1N6HA 4JLOA 2ORWA 2YHSA 4X8LA 2QPTA 4ZIRA 1X0OA 5AWFC 4JVLA 2IC5A 2WPDD 2ZJBA 4GHIB 2IHYA 2R6CA 3R9IA 2R44A 4OKSA 2G9NA 1XZPA 3OHMA 2Q3HA 2GF9A 4GT1A 4LI0A 2VSOA 5E4FA 2EYQA 4D4JA 3WP1B 1G3UA 1XF9A 2ZSFA 1JEEA 5L3QB 4JS0A 2C5LA 4K08A 1N6KA 3ADDA 2FWRA 2GXQA 3DMDA 3VKWA 2IUUA 2DFLA 1QF9A 2J59A 4KFUA 1GRQA 4DSTA 2R6GA 3GJXC 3FB4A 2VP6A 4XIGS 1J8YF 4DDVA 4BBUA 3I1FA 4QNMA 8OHMA 2W2VA 1TEXA 3LD9A 3F1PB 2G77B 4YMWA 2O0HA 2ZANA 2GK7A 3MQQA 221PA 3Q9LA 5GJCA 1T3SA 4M4XA 5HWVA 3PUVA 2JLYA 1HA3A 4BFUA 4E22A 2J0QA 4XT2A 4B6FA 1YZNA 2ZJZA 3Q72A 1O87A 4RFSA 3IKJA 1XEWX 3GFOA 5DI3B 2V0WA 1XU4A 4FMCF 4OK3A 3GCGA 2ZRFA 3IBGA 2HYDA 2CJWA 4JYCA 5DH9A 4DC9A 3I32A 3PITA 3H82B 4R2HA 1BIFA 1SQ5A 3K70C 3U5ZB 4DB4A 1JQJC 3CLVA 3U4QA 4XSGA 2W83A 1JPNA 5LDDC 1MR3F 3KJGA 3R20A 1W36B 3EAQA 3VR6A 2LCFA 1CRQA 4URYR 3B85A 1KI8A 1DAMA 1Z07A 2ZE6A 4EFNA 1YE8A 1RRFA 2J45A 4BBTA 1CULC 1NVVR 1E2DA 1A82A 4PFSA 4MN6A 1ZINA 1CRPA 4NMMA 5FI1B 4Q21A 3U60B 3MFYA 3PYPA 2GJ9A 4LYFA 1QHSA 4IKEA 3MJQA 2GILA 2H18A 2R62A 4JKYA 4N0EA 2V7QA 5DI9A 1E2KA 3GEIA 2ZE7A 1G9XA 2B02A 4QXAA 2QZ4A 4XWAA 4LCBA 4MKFA 4U7DA 2GJ3A 1NSFA 2RGGA 4KXFB 4TT3A 2FSGA 4OQXA 3K0FA 2F1JA 4HHDA 3A1TA 2P5SA 2IYWA 3B82A 4JBXA 5B30A 1MRSA 4GRAA 4EXOA 2YINC 2NG1A 4TL8A 4RZXA 3WRYC 4KBGA 4A92A 3K3DA 3F1NA 4HLCA 4QJ5A 2HDNB 2YWFA 1GM5A 2QRZA 1RZ3A 1CR2A 3NH6A 1DE0A 4HLQB 2FV8A 2J41A 1OXVA 3PEYA 1LF5A 1R2QA 3DOFA 1ELOA 2EA9A 2ZR7A 2QMEA 5JJKA 2GRJA 2ZRKA 1Z29A 5AUOB 4XTCS 3ADKA 3NEJA 4LBZA 3C14C 4DLZA 1G28A 1PV4A 4YMVA 3U6KA 1L7VC 1S9DA 1A2KC 3AKCA 4MGYR 4MRRA 4LLOB 3OIVA 1ZM9A 1FQKA 2C9CA 4CEIA 4HAVA 1R5NA 4Q7JB 2OEPA 3AUXA 4PPQA 1WB9A 4GP6A 3TVTA 2PDRA 3LICA 1RYHA 2EQBA 3IO5A 5AJVB 2L1MA 5FOSA 2IYSA 3BORA 1S8FA 3RABA 1Q21A 3AV0B 1T8UA 2J46A 5GJVC 2W0MA 3T1TA 4YWZA 3LVRE 3LXRA 2QPOA 2G3YA 1WCV1 3F1OB 3MQOA 1UEIA 4OBEA 2QTFA 4DLWA 3IGFA 3BFKA 2C77A 2WSSA 3OE7D 2QROA 5JRJA 4I38A 1G6HA 3UB9A 5CYPA 5AR1A 3K53A 3IS2B 5CYOA 1ZIPA 1Z2AA 5SZJA 2VA8A 2BMDA 1DEKA 1G7CA 3K0AA 4JL8A 3EXAA 3MJHA 2AFHE 4B43A 2GXUA 3RWOA 3THYB 4HJ6A 3OAAA 1Y28A 2QKPA 1A2BA 1NL3A 2GJ8A 1XEXB 4F4JA 4TLDA 2X2FA 3HPRA 1L4UA 4DJTA 2OXCA 3BH7A 3FMOB 2WWXA 5FH9A 2P67A 3R8FA 4Q1BA 5EE5B 1CP2A 2JN7A 1II0A 1ODFA 3EG5A 3P26A 5DYIA 3W6PA 1ZM4A 1N9NA 1XJ3A 1G41A 2ZJAA 3DHWC 4EJSA 3TKLA 4PAOA 1M74A 4V0KA 5TXGA 1LNZA 2QTVB 3CONA 2OFOA 3U6BA 1FW6A 4MGKR 2QPAA 2NPIA 2VP5A 2W27A 3CZQA 5KHOC 2D74A 1RRCA 2RGXA 1IXZA 1NMYA 3GP8A 4B3XA 3NOTC 3FMIA 3KKNA 5F9HA 2O0KA 2N1BA 2BEJA 1S1ZA 2J5XA 4B3DA 2QAGA 1FTSA 1N6PA 1VCNA 1XCGB 4NKRA 3BC1A 3TUIC 5A4JA 5KOYA 2J0SA 4HB3A 2OWHA 3W6OA 1XTIA 5HD5A 2GXSA 4TQAA 4JBYA 1J70A 2JIZA 2JCSA 3HU3A 4HIAA 1XCPA 1XD2A 2C03A 1X1RA 4YXWD 4DJ2A 1GSXA 3MMPA 2B7BA 1ZNXA 3B9QA 5HCIA 5CIQA 4JJKA 1U94A 1MO5A 3B5JA 2ZEJA 5KNCA 3K9LA 3T1QA 4QFMA 1FQJA 5FL3A 4ACBA 3QF4A 4DLXA 4IEIA 3U7FB 3A0VA 4Q9KA 5TVKA 3G6OA 1VMAA 2QAJA 2VEAA 3EIHA 5LBIA 5TMPA 4I1UA 3FDIA 1G4UR 3SJAA 3EPJA 4NXGA 5KU1A 3EZ7A 1TUEA 1ZNZA 3S1AA 5UKDA 1H8EA 1Q1ZA 4PZZA 2GNOA 5HSQA 2ZOHA 1E9EA 3JVUA 3NBFA 2JLUA 2JJ2A 2WAXA 3REGA 1TAGA 1XMVA 4TZ0A 1VCOA 2OCYC 4TTPA 3E4QA 3GJ4A 3RSOA 4TYWA 121PA 2QE7A 4TYYA 3D3QA 4TTRA 5FTMA 4X8OA 3T50A 4C0LA 1HUQA 3BFVA 2PMDA 1HE8B 1KAGA 2YOGA 4U00A 2ZI7A 2RGBA 4O25A 2F1RA 4RZ3A 4KVGA 3CO5A 3NKVA 2Z0MA 4PHFA 4B35A 4QGHA 2RH5A 4DSUA 1OTAA 4IW3B 1G6OA 3PV0A 5EXXA 3B13B 1YZGA 2NMVA 4DSNA 3NHQA 1KSGA 1W36C 1GSVA 3ZQ6A 1E2MA 2IYQA 4TT3D 2IYXA 5E95A 4B75A 1XEWY 3MFXA 1ZRHA 1E79A 1JR6A 1E9DA 4EQ6B 4JGRA 1LS1A 1EFCA 3W90A 5EZ5A 3LIBA 3E1SA 5FBWB 2DWQA 2ECKA 4FMBB 1GG2A 1E2LA 1E9SA 4B76A 2RGDA 2V55B 3WMGA 2GJSA 2P7JA 1E0SA 2OUKA 3AVYA 5D3MB 2F3TA 2XNDA 5LB4A 2ZI9A 1KO8A 3TVDA 3KB2A 3P27A 4RZUA 3GLFA 3CX8A 5JEEA 3MCAA 1ZUHA 3QXCA 4HQAA 1R5BA 2C8VA 2UZIR 1LSVA 1KI6A 4DIDA 1D6JA 1IHUA 4I99A 4BLOA 1M7BA 4HSEA 3CF6R 3FHOA 2XZPA 621PA 5HTKA 5HDSA 1KIMA 4O0MA 1GL6A 4EPWA 4Z1MA 1TL7C 3A1SA 1AQUA 2NGRA 1ZJ6A 4TLBA 2XZLA 1D2MA 3EZ2A 3ZQ5A 3NIBA 4A2WA 2O8EB 4UJ3A 1NMZA 4C7OB 3T35A 1YRBA 3WHLA 4HDOB 3EASA 5IRCD 3ZJYA 3BRWD 4LJ6A 4Q66C 4Q9JA 3CKLA 4Q02A 4LRXC 2IYLD 4U5XA 4CEHB 3A36A 1W46A 5DSZA 4W7SA 3K3CA 1ESMA 1JR3D 3DPUA 3Q85A 3B7GA 4R70A 4M1MA 5FTKA 1F5NA 3I61A 2A2ZA 5EXSA 4A82A 1LVGA 2VBCA 4MQBA 5FOXA 3CM0A 1W49A 5L8VA 1SVIA 2VP9A 5A0FA 1RYFA 5H70A 2WSSD 1P2UA 5KPDA 1DAKA 2XGJA 1X86B 2FEOA 1Q12A 4YQFA 3H86A 2C98A 1S96A 2V3CC 2REOA 1XB2A 2IK8A 3KQLA 3DEFA 4PX9A 4RFVA 3ND8A 1VG1A 4IOMA 4AYTA 3SI7A 2XXAA 2CL7X 4GI7A 1G4AE 2A24A 2CLCX 3PG5A 4FIDA 4ESHA 5F98A 3SW1A 1KJWA 2F9LA 2YVUA 4NYIQ 3LQRA 4IVQA 1GIAA 3OAAD 4HOIA 4W5WA 2ZU6A 1X1SA 5HKKA 4MRNA 3LXXA 4B47A 4BWYA 1OPXA 3VHXA 4F7WA 5JWOA 4WZBE 2H92A 3DVLA 4JGPA 4OI4A 2RGAA 2ANBA 3IEUA 4HAXA 4IFBA 4GZMA 2D4HA 4JSTA 4UXIA 5AVFA 1OIVA 4OHWA 2J9RA 4URZR 4WIAA 1DELA 1YHNA 2ZS7A 2KSQA 5G53C 2AWNA 3SEAA 2Z6VA 3QI2A 3GLGA 2BJVA 2ZOIA 2V6JA 4RJLA 1N0UA 1XRJA 2EVWX 2QTHA 1VPLA 2BC9A 5SZKB 4D6PA 4DCUA 5JSZB 3TUZC 5KPJA 1I2DA 1QRAA 3HR8A 4PPFA 1A1VA 1GL9B 1QG2A 1XFAA 3DO6A 4RD3A 2BJWA 5TV2A 4B6EA 4EETB 3H0KA 3LBHA 4IDHA 1NBME 1WMSA 1G18A 2J87A 3A4NA 4DJ3A 5EE3A 4PQFA 5FTLA 2RHDA 2JIZD 2VSFA 4MUAA 3QEOA 4RKEA 1N6LA 4ITRC 2RKOA 1TQ2A 1LY1A 2IYTA 2WBLC 3QBVA 4D80A 4KLNA 3IPXA 3IIMA 4IJMA 2IT1A 1JECA 4JKIA 1EGAA 2V54A 2XSZA 3QNUA 1DG1G 4CEJA 2FSHA 2O0JA 4BASA 2G6BA 1U0HC 1E4YA 2Q3MA 4XTRA 5BN3A 5KYKA 1KI9A 2QBYA 2BBOA 3U3MA 2C99A 3W6NA 4K81B 4EPRA 2OSBA 1M1YE 3C2WA 3R8CA 1GTVA 2VHUA 3L0SA 5DNYB 1MKYA 1U9IA 1TS7A 4DXAA 2AFIE 3GLIB 3IIKA 4Q5IA 1G3QA 2PR6A 4GFDA 2DR3A 1NG1A 3TSOA 2JJ2D 2GAAA 4LC1A 3WYGA 4ZDIA 5F3WB 1YR9A 3AEZA 4TZ6A 1JI0A 2CCGA 3ZH9B 1FZQA 1P75A 4TN1A 2YJTD 4TMKA 4NXBA 1RFLA 2K7SA 2JLRA 3W5JA 4FI3C 3SR0A 3QSYA 4DVGA 3RC8A 2CE2X 3PUXA 3KQUA 5JI2E 1UPTA 4LHYA 4TLCA 3A1WA 1XWIA 4XOIA 2IS2A 1LTQA 1FP7A 3CF0A 4M8NE 4TSFA 5P21A 2W0NA 1KAOA 3RSLA 2W6IA 1FP6A 1HH4A 1MH1A 1KMHA 1S3SA 1E79D 4OQFA 3R9WA 2ZVQX 3PUWA 3EWAA 2CCKA 2XTMA 1FX0B 2BKEA 4IEEA 5HZHA 3GEHA 2Q0HA 1KK1A 1R0ZA 1P0ZA 4GS9B 3KKPA 3QKTA 4KYUA 3VR3A 4G5QA 1BOFA 3MUFA 2IYRA 3SFZA 3VNUA 3TAHA 1J2JA 1BO6A 2JA1A 1P62B 1SZPA 4MGIR 4L15A 4MRSA 4PZLA 2EFGA 2C78A 4A8JA 1XXHB 2D01A 1UBEA 1WE2A 4QM6A 2JJ1A 3UK6A 4HYYA 2A5GA 4H6JA 4DIEA 2O8BB 1W1WA 3VR1A 5G4YA 1JAIA 2TMKA 1S1YA 2F43B 4KUOA 4KAXA 4DLUA 3K9HA 1ZD9A 3VMFA 1E0JA 1H8HD 4PKYA 5EP2A 1P2SA 2CK3A 1J7KA 6Q21A 3BWLA 5M04A 4FCWA 4MRVA 4E09A 5TDHA 2GCOA 2A5JA 2GTPA 3PEUA 4Q4HB 1TADA 2ONKA 2J3EA 2C9OA 3THXB 4Q4LA 2QN6A 4HUQB 3ADCA 4AK9A 3U7EB 5ELXA 4HDQB 2PYRA 1G17A 4NHOA 2RHMA 4B33A 3V4FA 4BPBA 3G5UA 4JGOA 3QOFA 4DRZA 3NOUC 2FFBA 1ZD1A 3RS2A 2JLZA 2JLWA 2XITA 3DM5A 1VYTA 5IHPA 3ZIAD 3QKSB 1IN4A 3NH9A 2QL6A 3I8XA 2ZRPA 4LHZA 2FDCA 1TF7A 5FOTA 1DADA 1IN6A 1NLZA 3OEED 3OIYA 2Z4SA 4KITB 4DHEA 1ZNYA 1ZIOA 3GLHA 3EW9A 3EX7C 1E2HA 2ZU0C 1OB5A 1CBUA 1LL8A 4BEBA 1GKIA 3TSZA 1E2IA 3VR2A 3T5GA 1EK0A 1ZCBA 2QJ5A 4US0R 5CB8A 1F2TB 1YRAA 2HLDA 1MABB 2KE5A 3B6EA 1E2QA 4D4LA 4BRWA 4I3AA 4HAWA 4AG6A 4M1SA 4YDHB 1E6CA 1E2NA 3SS8A 5KSYA 3CW2A 1MRNA 5G3ZA 3X1DA 3JZMA 1HTWA 2ZAMA 1SXJD 4QBHA 1F2UA 3RYTC 4EUNA 4F91B 1E1RA 5FPYA 1GITA 3ZDQA 3E4PA 1FMJA 1NWZA 4LV5B 4DLTA 3I5XA 3WHKA 1P6XA 1EFRD 3GJ6A 1N6RA 1OJ5A 5DYGA 5TB5A 3TH5A 4Y0VA 5AUNB 4BFTA 1IJFA 4LBVA 4A15A 1SKYB 4Z8YA 4L8GA 2D2FA 1TTTA 1WA9A 4R6LA 2BMEA 2Y8EA 1R0YA 4KV9A 3MGCA 1R8SA 2ZPTX 4LX0A 5BXQC 3QXXA 4JVNA 1KK0A 3K09A 3K1JA 4D81A 3QVUA 4HZUB 4KFTA 1RW4A 1OE0A 1XX6A 2NOAA 2RCNA 1DP9A 3UXMA 4TYNA 2N42A 4HNBA 2ODNA 2XSZD 4HUTA 1N25A 2NZ8A 3TNFA 4CIDA 4BLPA 3TR5A 5CDFA 4X8HA 3TGPA 4ZIRB 2AWOA 4NE2A 2LKDA 3BFXA 4DCTA 1NN5A 4Q1CA 2N46A 3HU2A 4E03A 4W9MC 1SVWA 1O3YA 4KYIB 2VL7A 4I1SA 2O8FA 1KDRA 1AKEA 5G3YA 2FSFA 1OV4A 4NCNA 4LJYA 2OOLA 1Z6GA 2JDIA 4JLBA 4P4SA 4KCGA 1D2EA 2CVFA 1U2RA 1HYQA 2VV8A 3E70C 2HYIC 4NCKA 3MRSA 2V1BA 3X1YA 4WAUA 1G1MA 1SULA 5EJEA 2ZJOA 3ONWA 1QHXA 4W5HA 3WXMA 4R38A 3BBPA 4C0AC 3LIDA 1T1AA 2ZUBA 1MOZA 3NTUA 3UPUA 1UFQA 3BERA 4M22A 4MA4A 2BMJA 4C0JA 4PHGA 2QJ7A 3L43A 3IHWA 1A5TA 4M1OA 4OI2A 2W6ID 4XT2B 2ZRMA 4RFSB 2QGZA 2FFAA 3A0RA 1S3GA 1XFNA 1P60A 2I1QA 2CHQA 3CWZA 4PANA 5C4MA 1NKSA 3PUZA 4HH2A 5AK0A 4C0SA 2FGJA 2WTUA 3H7WA 1B23P 1TQ4A 3C4JA 4RQ9A 2BVNA 1GVNB 1QDEA 2CJWB 4M2LA 4Q19A 1NVXQ 1W2HA 2VIIA 1Q3HA 3U4QB 1P5ZB 1M34E 3C41J 4W5JA 3CUEF 4WZ6A 2JJ1D 3IO3A 1K6MA 2ZYUX 4EAQA 3C8CA 1ZM7A 1IBRA 2IEYA 5JZVA 4PO9A 3MG9A 2ORIA 1Z6YA 5HCNA 2DFTA 4N0DA 3U7HB 1IJEA 4M9ZA 3DKVA 2REBA 3L2OB 5KDOA 4I1OA 3KXIA 2C04A 5LD2B 1NN3A 1YVDA 4QGFA 3LAWA 3C5HA 5J3WA 4LOAA 1BH2A 2CK3D 2QSYA 3AF2A 3QE0A 1IY2A 1Z47A 4CGZA 1NF3A 1QHGA 2YWHA 4UNRA 3AP2A 1ZD8A 4XWOA 1UAAA 5HE8A 4MYHA 4M9XA 2OG2A 2ZROA 1G5PA 1VHLA 2HCBA 5HE9A 4CT4B 1Z0DA 3L0PA 3OFNA 2FPMA 2FGKA 2V4ZA 4WBSA 3Q7QA 5FPTA 2OZEA 4C0BA 3CPHA 2QUZA 3K0FB 1QVAA 4YXWA 4UNSA 2BCGY 1VG9B 2VV6A 1F60A 1KNXA 3T1OA 3AVTA 1FNNA 4IDPA 5FOVA 2RMKA 1KI2A 2WKRA 4FD2A 5FPSA 1R5OA 4FCVA 4ZDJA 3F1NB 2W58A 2YZ2A 3RLFA 4FXPA 5FBQB 4OHXA 4AYXA 4LYHA 1KOFA 3SNHA 4D0GA 1AGRA 1VDZA 3I73A 4RD1A 1E4VA 1U81A 2VRWA 2ZSBA 4G0NA 3HYRA 4WXPA 5EFWA 2XB2A 2YC2C 4IDNA 2BOVA 3UKDA 4I39A 4R2IA 1GNQA 3GMTA 4R98A 4Z8XA 3A58B 3WBKA 4WW0A 2C96A 3AF3A 1T1BA 1EG7A 2P2LA 2HLDD 1LS6A 3H1TA 3CX7A 3A4MA 5FTJA 1U8YA 1MO6A 2DFNA 4Q4JA 4CEIB 2QT1A 4F4IA 4JL5A 1AA9A 3UMDA 4E04A 2AKYA 1U98A 5TY0A 2I1VB 2MMCA 2DB3A 1OW3B 2O5VA 1P7CA 4IOKA 1E1RD 2FG5A 2NO1A 5EE0A 1DAFA 1UKZA 2PX3A 4C3ZA 4P32A 5J4VA 2J80A 1X6VA 2VP2A 2Z5FA 4LBWA 4OHZA 2WVJA 4DDUA 1HT1E 3THOA 5FFMA 3AB3A 1OIWA 3L8YA 5EP4A 3K8YA 3K0SA 3QPUA 3T15A 5BN5A 2GHIA 3K70D 1W0JD 2CE7A 5BWMA 3RHFA 4KO8A 1N6OA 3OESA 4EESA 1J90A 1VKJA 2ERYA 1T9HA 1E9RA 1UBFA 4DLSA 2P3SA 3K0CC 3KUCA 1W7AA 1CJTC 4Q7LA 1W4CA 2ATVA 4BEJA 2CMKA 4DEYA 5BW8A 3LDAA 4JT2A 5BN4A 3VOLA 1JJVA 1N3BA 3G82C 3QY0A 1OTEA 3U44A 5JJLA 4PKYG 2VHJA 3K0AB 2GDJA 1R0WA 3EC1A 3T61A 4A1FA 2P5TB 4V0ME 5CM8B 3PXGA 4P0TA 3KZ1E 3B1WA 1NLYA 1Q57A 4IHQA 2QEQA 3IILA 4PAMA 4QC2A 4JVSB 5J40A 4L9FA 1YKSA 2AXNA 4DWJA 1FPMA 2PBRA 4EJSB 5FL7A 3T1VA 3U2QA 2QMOA 3RH8B 2WWIA 4BFYA 2JDID 4LK2A 4TL9A 5EXTA 3AVUA 3LWNA 4B32A 3C15C 1KHTA 1JR3A 4LJ9A 1Y63A 3QF7A 1OT3A 2V1AA 1XTJA 3SBDA 3L8ZA 4DLYA 2HXSA 1BMFD 1L2TA 1T0JB 2P6NA 1S4QA 3CRW1 4C0KA 4Q18A 2P6UA 3EEHA 1S0UA 4WL9A 3AF0A 5CJ2A 5TARA 4A4DA 1NVVQ 1W48A 1Z0KA 2QAGB 2X19A 4JLKA 1ZUIA 2GA8A 3LBIA 4RY2A 1XXHE 2ZRGA 3GD7A 2NZJA 4PPNA 4EDHA 2A5YB 4IXMA 4DBLC 2R9VA 2OAP1 3EZ9A 3OZXA 2CXXA 4Q7MB 2PYPA 5DIFA 4ZDWA 3LFUA 4IDQA 4OL0A 1XDBA 4M21A 1XD2B 4NYMR 1D9ZA 4D2IA 3ULFA 2LWIA 2PZFA 4A2QA 1ODVA 3FFAA 1DP6A 3AKEA 2V1XA 3B1VA 2ZJ5A 4NL4H 5JFGA 3VNVA 3LW7A 2VHQA 1NJGA 1N6NA 2ZE8A 2GBLC 1YU9A 3FE2A 5F6AA 1II9A 3JZAA 3QF4B 4QBGB 5H1YA 2VSXA 2ZIAA 4PTLA 1GL7A 1J8MF 2DYKA 2UKDA 4ZI3A 2IXGA 3F0TA 3SQXA 2H8KA 4F3LA 2XJ4A 1E1QA 4PSAA 4OI0A 4M53A 1DAEA 3S1AB 1UKEA 1I4TD 1ZBDA 1XEFA 2F6RA 5K8IA 1GOTA 3FPAA 4NDZA 4LSGA 4D4MA 4IVRA 2ZAOA 3VU9B 2Z4RA 2D7DA 2R6DA 4OQLA 4Q9HA 2R2AA 3B1YA 2KJQA 2GZHA 1ESNA 4P33A 2O8CB 4P3YA 1CJVC 2WICA 1R10A 4CDGA 1T19A 2ZRLA 5BQ5A 3H84A 4URXR 1JBKA 3CX6A 4JGQA 2W2XA 3L82B 5KSOA 2ZRBA 2ASEA 1OFHA 5L3SA 4MDFA 3OFND 1XTSA 3GLIE 2HCJB 821PA 1OJLA 3KQNA 2A5DA 1D8TA 1Z6XA 3LBNA 1GNPA 1D2NA 4WN5A 1GFIA 4GOKA 2PJRA 2JASA 3TBKA 1FMLA 4TL6A 3QEJA 2FFQA 5LD2C 3W8NA 4Z54A 3LI9A 2GJKA 5EP1A 4R71A 3UMEA 1TPZA 1X8LA 4NONA 4QBFA 2Q9AA 5CITA 4NCIA 3GLFB 1DBSA 1K5DA 4HJ3A 1CLUA 5CIWA 4PQRA 5IT5A 1E96A 1KI6B 2PEZA 3IBYA 1IXSB 4Q9LA 5H68A 2QWSA 1TMKA 4DKXA 4HP4A 5JHGB 4UXJA 1KJZA 3GJ7A 4OJQA 4DLRA 1D06A 1HV8A 2W2TA 4QHYA 2BASA 4YLGA 2ZJYA 5DGXA 4UNNA 1WF3A 4M9QA 1R7RA 1SKYE 4JSYA 4Q01A 2D3WA 2R78A 1Z0IA 2ZTSA 4FWIB 5HPYB 1G8GA 4BECA 1WRBA 4GNKA 2WWHA 5JCZA 5G40A 1K5GA 3ASZA 3ETLA 3U7GA 1BYIA 1HY3A 3LW8A 4LYAA 1BKDR 5FUXA 4ZV4A 4ESVA 3ICEA 3WNBA 4EQ1A 1G5RA 1G21E 3BOSA 3ZVMA 2IWRA 2UZ3A 2ZJ8A 3B78A 1KYIA 1TU3A 4KI0A 4QHTA 1NIPA 4AKEA 4Q9IA 1WQ1R 1EFUA 1I4LD 4Q03A 5JS7A 3W8RA 3UB7A 4B2LA 2A5FA 2QM8A 2ORVA 2HV1A 2NPFA 3RVBA 2XB4A 1LV7A 1RE0A 4M1WA 2L4RA 1OKKA 2ZITA 3FWYA 2A24B 4LJ5A 2Z83A 3KFVA 4PO8A 1UWPX 2BBTA 2YOHA 1E9AA 4FW9A 1H8HA 1V9ZA 2D62A 4L5BA 1D9XA 2E9SA 3QJYA 2OHFA 2PH1A 3ZZ0A 2ZQ5A 2VQSA 1NBMD 1OTDA 4CRWB 5FL7D 5B57C 4JZKA 4HLUA 1W36D 2MSEB 1KZGB 3CNOA 4B34A 3EIEA 1RRGA 4TMXA 4ZI2A 2WHXA 2IS4A 5FBRB 2ZSAA 4LPKA 1GDDA 1QG4A 4RKFA 3KKMA 1DPFA 4O2LA 1C4OA 4CZ2A 1HEIA 3KQKA 1UDXA 1OTBA 3PENA 2IYVA 3FKSD 3QUSA 3A8TA 2KBFA 3ZIAA 4XSHA 3WYAA 4LY6A 5CK5A 1E2EA 3HDTA 4NPHA 2AD5A 1NY5A 1CKEA 3OEEA 1T1CA 2WOOA 2OBLA 4RZ2A 4L9EA 2DCUA 3T12A 4KFRA 1UKYA 4IRUB 1OHHA 5I5LA 1G8PA 1K8RA 3FYHA 4B48A 1KJYA 3FG8A 1XTKA 1JNYA 1ZVQA 5C1BA 4CEJB 2F7SA 2A7QA 3QIAA 3DL0A 3N2IA 5J4EA 4US2R 2OLKA 2QBYB 2L0XA 4PC2A 3N70A 4RCZA 4GBMA 1E1QD 2F1HA 2QAGC 3MWYW 4KUKA 3BB4A 1G3IA 1SXJA 2CHGA 1US8A 3KDSE 3NG1A 3I5YA 4B71A 4PR0A 2MSDB 2XTNA 3GFPA 4R7ZA 4HB2A 1OXTA 3LX8A 4UJ5A 1OFUX 1EFRA 3FHTA 3SZRA 1XMJA 1VIYA 2ATXA 1NN0A 4CYMA 4URWR 1EESA 3X1WA 4N1AA 4MYUA 3PVSA 2HEIA 4KODA 3CNLA 3QENA 1P3JA 4HAUA 1NIJA 1UBGA 1ZUNB 3HJNA 5AJXA 5EQTA 4JYBA 3R7WA 5EXPA 4XVUA 1W5TA 2ZRJA 2GWHA 3E2IA 3EZFA 4Q00A 1GRNA 2J0UA 5K8UA 1DVRA 2G1JA 1LFDB 2EFCB 4CF7A 1M7HA 1KMHB 3MSXA 1XJ0A 4II7A 1XPOA 3EWKA 4L9GA 1KY2A 3GJ3A 3WRXC 4D25A 3LH5A 2MMGA 4UKDA 2RB4A 4ZPXA 3K0EA 3EPLA 2FU5C 1M8PA 4YDSA 3KJHA 1P72A 1X8KA 5HWWA 2FZLA 2HJGA 4I3JA 4I81A 1QHYA 2GVDC 1KSJA 3U3JA 4A8JB 1Z0JA 4R9UC 2QSZA 4LHXA 1SVMA 3SJCA 4H6JB 2FN4A 2H17A 1U0LA 3LIFA 5IU1A 2NO6A 5G4ZA 3D8BA 4R3AA 4CW7A 2CVHA 3KJIA 1GILA 3AM1A 3HJKA 1V43A 3NWJA 1Z3IX 4AD8A 5AJZA 4B74A 5FUYA 4MGZR 4MITA 3WY9A 4B9OA 2YKHA 2WJVA 2QP4A 1OIXA 3VX3A 2ZBBA 1OT6A 3KQHA 2HT6A 2GCOB 2IF2A 4XWKA 2PR5A 1LSXA 1V5WA 2QMUA 5EE9A 1DAHA 5DJTA 3IPYA 3NVAA 5D3QA 3TW8B 4PPGA 4C4PA 5KSZA 1AZTA 1GKYA 1XD8A 3NEYA 3REFA 1H65A 4L4UA 4L9WA 2FE4A 3AKDA 4LRYC 1OFTA 1NY6A 4LJ8A 3RS7A 5KDLA 3I72A 1ANKA 3VE3A 5KUTA 2Z6DA 4LUCA 3IHLA 2NO7A 3SJZA 4DDWA 1E2FA 3A1UA 1TEVA 3BWDD 2K5UA 1RVDA 3IDQA 1P73A 4G3XA 4OQMA 3VX4A 4BLQA 4Q47A 1AS2A 1OKKD 1FUKA 3GLHB 3LRPA 2VTKA 4EKDA 5HZKA 2FOLA 4BZQA 1QBKC 1OYWA 3QPVA 2GVZC 3PR1A 1KMQA 2R6AA 1JXOA 1N5JA 2ZUCA 4XD7D 2VEDA 5JLJA 4AIIA 1KO7A 3RNLA 2HUPA 3D6TB 4AKHA 3CWFA 2GK6A 2H5EA 2VLIA 1N9OA 1OH7A 2GZDA 1AIPA 3X1XA 1G291 5AVEA 1NKTA 1TQ6A 3CF2A 1UF9A 2PLRA 5SZHB 5FUVA 1F2UB 3Q3JB 5IDVA 5IK2A 2CNWA 4TMVA 3U61B 5C46F 3THWA 2YOFA 5CM9C 4GDFA 3SN6A 2ZI6A 2OCPA 2YWEA 2FPLA 1GKUB 4EFLA 4GZLA 1XCMA 3RS4A 1JJ7A 1TUIA 1UGUA 3DMNA 2EFHB 5HR5A 2A3RA 4B2IA 2DY1A 4KLZA 4F93B 1GUAA 1OXUA 4C0HA 3UB8A 1OF1A 3K70B 2CLDX 2H57A 4J0QA 1OH5A 4IOJA 1W44A 3RRNA 1OT9A 4PQYA 4Q1AA 2ZRHA 3A4LA 2GETA 1OHHD 1M7GA 1Q0UA 3N2EA 2P0EA 4NYJQ 2A30A 1VECA 4BZXA 4ZO4A 5KIZA 3LLMA 1AZSC 1S67L 4WZAE 3AVVA 2ANCA 1PUJA 2Q9CA 4HB0A 2FSIA 4Y0AA 1Z0AA 1S9HA 1U0JA 2A78A 2GZAA 1KNQA 2GCNA 3CPJB 3CH5A 3K9NA 2H7VA 1UJ2A 4RD0A 2WV9A 2O8FB 1UWNX
chains in the Genus database with same CATH superfamily
1PYGA 4P4SB 3WQQA 2QQ0A 3ICOA 5IJ9A 5DRYA 3OLOA 3KD3A 5A7GA 1ZGJA 3AF4A 1I32A 5CTAA 1I10A 2Y6VA 3H9WA 2XJ9A 2J0VA 3DVAB 3LR4A 2CB0A 2YVKA 4ARZB 3EGVA 4EKEA 5I7FA 5CEBA 4LI3X 4EGAA 2ATEA 3LLUA 4LQDA 4M1KA 3AUTA 4ZKEA 1KC3A 3OLYA 5LQRA 3V55A 4HPXB 3TW6A 3HUFA 2A9OA 4MZXA 5FRDA 5A3JA 1Z6AA 3N86A 1QE0A 4AKTA 5J8XA 1VB6A 1KVSA 1SK9A 4TZKA 3RTAA 3SZ3A 2CL6X 1GZUA 4XXHA 2K6GA 5CVTA 1N5MA 3IV6A 4Z0HO 1GNRA 3NWBA 4L72A 4YCAA 3AL3A 2W42A 4DNQA 4ML3A 1QAOA 3NANA 2JK0A 1C4WA 3E9YA 2OD2A 1G0OA 1V8ZA 2DHCA 5KDDA 2V7UA 3ZHBA 2X7XA 3PDIB 3T34A 1OLSA 3BJEA 1N2GA 3ME5A 4HN4B 4Q4JB 3UEOA 2EFYA 3TQFA 4UHKA 4DG5A 5HKBA 2Y1FA 3PS9A 4QQFA 1XZQA 4P4LA 4JXJA 4ZTZB 5IARA 5BSUA 4E15A 5BWNA 3F6BX 1RJFA 1LT0A 4N01A 1E9FA 2YHUA 5LBTA 5BVGB 2LRHA 1YQEA 1YVRA 4F4HA 5BNIA 4B7ZA 1TGYA 3ICPA 1GTJ1 4G5OA 3QP9A 2HA5A 3OY7A 1X13A 4DUPA 2WGWA 1TKAA 4Q1FA 4L8YA 1NMXA 1HRDA 4FFOA 4UFPA 3D9YA 5T6BA 4V2UA 1MQSA 1Q3TA 1TVEA 4BQEA 1GNLA 3UXHA 3K35A 3VDRA 1AHNA 3IXHA 2H0AA 3LNCA 4WELA 3H82A 1L5KA 2P4HX 4JENA 1ZZEA 3OPVA 1D1SA 1FOEB 3SHWA 1JAHA 1DCTA 4GOXA 5GVSA 5H9VA 1U2TA 5JH7B 2PVSA 3MLAA 1RXEA 5KTTA 3GX1A 3PHBE 2G83A 4EYSA 1OTYA 4ME4A 1DJMA 4BO8A 3COJA 1C4XA 2EDCA 3TEFA 3AB8A 5ENDA 1PFUA 2FJUA 5CT5A 2QL5A 2HDRA 3CNBA 1SOAA 3ZPXA 1TCCA 3DULA 1DBWA 1JTGA 4BUZA 3CJRA 3C16C 5EIOA 2WJZB 3O8BA 4C88A 3QMPA 3P4XA 5BURA 4H4DA 2DLDA 3FUVA 3D8UA 1ZQ1A 3M89A 1IH8A 2YN0A 3GF4A 3NBMA 1BLSA 2DFKB 3HCYA 3QUQA 4NATA 4LE0A 1DX6A 2AI2A 2OCBA 1OMOA 2JKVA 4IV8A 1U8AA 1FNSA 4AKGA 2CEAA 3Q3GE 4BGIA 4D8WA 2X14A 1L0GA 3LXMA 4KVAA 2HXYA 1ZK2A 3B1XA 1KQGA 4QBKA 3S7OA 3CV3A 5CLQA 4OYHA 1NM5C 3KPWA 1DTWA 4Y6LA 3WRXA 3V2GA 4ZGWA 1SPXA 2QTVA 2HFKA 2VEOA 1E7QA 2A88A 3ZG8B 1QVRA 4JMPA 1T8TA 3OFVA 2DERA 2RC6A 1TIKA 4IMIB 2FKAA 4P4UA 3DEHA 4LGVA 1O1YA 5EESA 1QIIA 3E1GA 1RAEA 2CJXA 1CR1A 4FOPA 3KYQA 1ECPA 3MJRA 1E89A 1ZITA 1OAOC 4RA9A 3VYVA 1Z6FA 1J8DA 4CV2A 1V1RB 2IPOA 2B6NA 3V6LA 2ZRCA 1HNNA 3HV2A 3MRVA 4U5QA 3KQTA 5KIAA 3MMXA 2IA5A 2AN4A 3UMVA 5CM2Z 1J24A 4NJMB 4L8LA 3ZVTA 1A0KA 4Y30A 5EP3A 4LG1A 1B0UA 2R5NA 1ZYUA 2VZEA 4AYWA 3WKBA 4WF0A 2YIJA 4BP3A 1JSLA 2UUPA 2KS6A 1PCXA 3WSWA 5ALSA 3PT5A 4U2BA 5JHHB 1KR2A 4MR8A 4CEHA 3B6KA 1NXOA 3FH0A 4Y5FA 3DZHA 2I6QA 4JR0A 3OC6A 1MNAA 4IRXA 1L1QA 3JWEA 4ZEMA 4E1BA 3WLMA 4RLHA 1WDLA 4ZZ1A 5CNIA 4G0WA 4FC7A 1G7SA 3O47A 3IH5A 5D5PA 1WY7A 4IIEA 4CKBB 2PGAA 3EC7A 5M18A 1CETA 2Y59A 4HB4A 3VA7A 2JKRM 1U6KA 1RJGA 5G41A 3QVOA 4RX3A 2ONCA 3RYFA 3W9BA 2XHZA 4IBOA 2CMNA 1KEZA 1U04A 3CT6A 1GUFA 1WLYA 3WDKA 2QTCA 3M4ZA 3WLRA 5ALUA 4XOUA 1EM6A 3NUZA 3A9SA 2Q1YA 1N36B 1CY0A 4R9SA 3DE6X 4CWAA 2IL1A 5IJ9B 4J76A 2BWJA 1DAGA 1ZHFA 2AEEA 1G8HA 3RC3A 3D7MA 1IY0A 1JKMA 1TTQB 4U2DA 1P9RA 4QOIA 1YCHA 1IY8A 2IP4A 2DMRA 1WCWA 1GAJA 1TVCA 2GX5A 4B6QA 2HHAA 2QA5A 2O8BA 4TWIA 1W4RA 1EP2B 1GSHA 1S1MA 3ZJVA 1DBRA 2HNAA 2XQGA 4WADA 1B15A 2UZ1A 3C6ZA 1FF9A 5CXQA 5JWRA 3A4VA 4ZT2A 1XZJA 4BMXA 2BM1A 4TVOA 3M6UA 5K3AA 3HZZA 2H1WA 2NSDA 1I4EB 4GH5A 1RP7A 4NXFA 1ESDA 4NV0A 4WXHA 3H18A 3FGNA 4H4EA 2E0IA 4BKOA 1OLSB 2YXBA 5IUKC 5KS2A 4YIKA 1CFJA 3PEWA 2HU5A 3LKZA 1XDDA 4ERNA 5BQFA 5KJEA 3OCXA 4FR0A 2V3WA 3ICYA 2FR1A 2FWIA 1DXYA 1ES3A 1Q44A 3IV7A 3CTPA 1N2SA 1CF2O 1M75A 3UFBA 4KXYA 4JVLA 2HMTA 4BX3A 1L7PA 1NMEA 2GF9A 5I9LA 4GT1A 2COKA 1M9NA 4J9VA 3IF5A 2C4KA 3FTPA 2DPMA 4A0QA 4LF5B 1YTLA 3WTCA 3U1VA 4OLAA 3VZQA 1YU6A 1J8YF 4BMSA 4RS4A 2WP0A 5J59A 5GJCA 4BFUA 2J0QA 5ALHA 1O87A 2V6BA 2R2GA 2CJWA 3H82B 3U5ZB 4NU8X 4XSGA 1JPNA 1VPDA 1WYBA 3R20A 5GLCA 4RACA 3BQAA 1CRQA 4PRYA 5DYTA 2VNHA 3GVXA 3NYWA 1D1TA 3WL6A 4YEDA 1A95A 4FEAA 3V1NA 3QEMA 3RVSA 4ZRMA 3A1TA 3SLGA 3WRYC 3HS3A 2B4QA 4RZXA 4CIBA 3M9WA 2QN3A 3L40A 3FMGA 2UVDA 1R2QA 4EF4A 4IYRA 3EDCA 1CDDA 3IAS6 4LLOB 4ZHQA 3UT6A 5KMWA 2QZJA 3AUXA 4LMPA 1NLMA 3RABA 3OZHA 1T8UA 3KCNA 2B37A 2RFLA 3R7NA 5F4BA 1UEIA 4IUBS 3OIFA 1O95D 4UM9B 5DHPA 1VSTA 3V8PA 2ZTMA 1IMJA 4FK8A 2NXCA 2IE0A 2N3ZA 4K6FA 3WADA 1V5GA 4DJTA 3R8FA 2O4UX 1XJ3A 4I6GA 4WBNA 1DTWB 2QXUA 5ICGA 2QTVB 5A03A 3HB0A 1UDRA 4KUEA 4EK9A 4OMUA 3TOXA 3OOYA 4IF6A 3ZE1B 3R0QA 1FTSA 2YHIA 5IKEA 3JD4A 4YCNA 3ZNOA 4EHAA 1U0TA 5DNEA 2ID8A 4XD2A 4DJ2A 3C7UA 4I4CA 4DLXA 3MAGA 1SOMA 3QVTA 4COOA 4L22A 3EPJA 5UKDA 4B4OA 4PZZA 5KVQA 1DC8A 3QELA 1XMVA 4DIUA 1GTL1 2AYZA 3L7JA 4X8OA 3Q3CA 5FEMA 4B4DA 1F0YA 4Y9SA 5IWAB 3R7FA 3I5AA 4CQMA 1BQ4A 1SU4A 1IQUA 3VC1A 1BROA 2HO4A 2NSYA 5EN4A 4YJDA 4EGQA 4Z9XA 1IK4A 1JR6A 2GEFA 5FBWB 1JSCA 2ECKA 3T7JA 4FZVA 2B7LA 1C30A 4AJEA 2ZI9A 2EFJA 1CJSA 2L82A 3M6LA 3ZXUB 1F2VA 3EGDC 4Z4GA 1LSVA 1A4XA 1IHUA 3CGGA 3PNYA 1MQ9A 1R6UA 1AQUA 3EASA 4LJ6A 4MR8B 4Q9JA 1QCZA 4FGSA 1U2PA 4CEHB 1XU7A 4G0XA 4ZC8A 3GTCA 3Q85A 2Q3CA 4A82A 4ZCTA 1TRHA 4MVJI 1W49A 4L4XA 2W2NA 2XGJA 2F3SA 4WMLA 3O7WA 3R3YA 4G9GA 1RADA 3JYQA 2CVQA 1YA6A 1QK3A 1ZRSA 2ZU6A 4N41A 3VHXA 2V9ZA 3LP8A 4EHKA 4DWWA 4URZR 2BZSA 3AYXB 2PWYA 2HIHA 3SWWA 3MMNA 4M86A 3A70A 3MOIA 2FPUA 3RYFB 3DO6A 4J0HA 2C4NA 2VKSA 4KLNA 2B5OA 4IJMA 3U7RA 5CDYA 4U3TA 4HWTA 1LTHR 2UAGA 3R5KA 2EC5A 4S1TA 2AVDA 2VOJA 2VHUA 4CJNA 3N39C 3MBZA 5LKAA 3GRJA 1X1TA 1JWAB 2BPOA 2F64A 3JPWA 3SEZA 4CM6A 2VHYA 1U0GA 1MWRA 1G2OA 5CFNA 3I7JA 1G8SA 4I46A 2PTHA 4H1HA 2EBUA 4DF6A 3ZDYB 3AZOA 3PU6A 4YAEA 1PYDA 3RHZA 4MRSA 2LP4Y 3CEJA 3UK6A 2O8BB 1PWHA 1DX9A 4M3NA 4KUOA 4DLUA 5LR6A 2UZ1B 4KYTA 3E22A 3CZ9A 3KBBA 5AQEA 2IKQA 1EBBA 1L6RA 2XLNA 2J3EA 3KQVA 2P1RA 2QN6A 3U7EB 1WNFA 1Y3HA 2HM7A 4BMCA 1N2XA 2JLZA 5IHPA 4IJVA 1TF7A 4INAA 1S8NA 2TMYA 5TX7A 2GBIA 4PX3A 2VRCD 1BD4A 2BM9A 4HXEB 4S2NA 3L1VA 1PG2A 1NASA 2X0JA 1TVMA 1SXJD 5FLKA 4BRSA 5FPYA 1M5RA 3HRKA 2MSKA 3FCYA 1BC5A 4KRFA 2J8ZA 3BMOA 3GJZA 1SKYB 1MUUA 1SXHA 1QQ5A 2NOAA 3PPIA 1XJWA 3BFXA 5I5EA 4LV2A 4JDPA 2C7QA 4RH0A 3BFCA 3MF0A 1OV4A 4RVGA 1EFAA 4WAUA 1TUBA 5DBHX 4N8EA 2QI9F 1E3EA 3U56A 2BMJA 3A0RA 1L1EA 3HYLA 3PUZA 3H7WA 1LI0A 1JIJA 2CJWB 2BGNA 1FFWA 2VA9A 5CEFA 2JGRA 1MIOA 3MG9A 4CM4A 4BD1A 1RWXA 1YVDA 4MWGA 3ZLTA 3BXFA 4XWOA 4KREA 1W35A 3OT1A 4QU3A 3QEMB 5HHTA 2FGKA 3DR5A 1GCAA 1GCIA 3CPHA 4Z7JA 2QUZA 4S2JA 2WGVA 3U39A 3ZI0A 3ZWBA 1NV9A 4NETA 1R5OA 1EHIA 1Y6FA 1PR1A 1Z34A 3SNHA 5HMLA 3OCJA 3UKDA 1W7FA 1KWKA 3MS4A 3AF3A 1XZBA 1I0ZA 4JQOA 4ZHQB 3ANNA 3FLEA 2IIVA 1LC3A 1DAFA 4PS0A 3RFUA 2JGIA 4I6JA 1J06A 1NBIA 1CYDA 3EDYA 2O23A 2Q0OA 2P68A 3MHTA 3LDAA 3QY0A 1YI0A 4YUXA 1FMCA 2YQ5A 4F0JA 3OFKA 3D64A 3UT0A 5EKXA 3NC8A 3U2QA 4WBNB 1U3GA 2DJIA 4MOWA 4MINA 1PTJA 2WE7A 4GVXA 3FY4A 4DLYA 2HXSA 3H3XA 3KU4A 3VMMA 3HM2A 4IH4A 3HUNA 1W48A 4X1MA 4CM3A 2YHIB 3I2GA 4QLBA 1E1LA 4M38A 4D2IA 2AZ4A 2PIAA 4NL4H 3UAXA 4XWGA 3GNTA 1NJGA 1DC6A 3IMEA 1J8MF 3OCCA 2IXGA 1C4KA 4HFJA 1EH5A 1XZAA 4EI2A 2BR4A 3QELB 4TS4A 4IFIA 2R3SA 4F97A 4P33A 1P31A 4CDGA 3FWZA 3RJTA 2X4GA 3NJRA 4CQMB 3PL1A 2JIBA 1GNPA 4GOKA 3TTUA 1QF7A 5HJEA 2V8FA 1RXVA 4Y2HA 1CY8A 4Z99A 2GJKA 1D4OA 1ICIA 1C30B 5KVVA 1NXSA 1EWTA 1K86A 3FTCA 5ESRA 4CG1A 4B3JA 3IBYA 1KKUA 4ZP1A 3KTFA 1SKYE 3DLTA 3FOCA 1WRBA 4C7XA 2FK8A 4MUFA 3HB4X 1FJ2A 1C7IA 1YCGA 3QVMA 3BRMA 2QRMA 4ZO6A 4YR7A 3OTHA 1VKHA 2C57A 1YCFA 1RE0A 3KFVA 2BBTA 3MQ0A 1W8YA 3S22A 3VHXB 3PFBA 3A25A 4OJYA 1NBMD 3VDQA 2FN9A 2J5BA 5A0TA 1HTZA 1MU0A 2CD9A 3NIDB 3D6HA 1QVVA 5DNDA 1GFWA 4TWRA 4WXEA 4XSHA 4L5CA 5D7BA 4DKJA 4EBFA 1EK6A 4JP2A 1TEZA 1BX1A 4YQEA 3E81A 4FDUA 3DUWA 2A7QA 3QIAA 3N2IA 4HQLA 1JQBA 4X60A 4RCZA 1JWBB 4KUKA 3BB4A 5C9ZA 2WF7A 2E85A 5CB4F 2J08A 4JJ7A 1XAGA 1I2SA 2BTQA 1VIYA 4AZWA 2A9VA 3PVSA 5C31A 1ISJA 2UWXA 4IV5A 4QREA 3OZDA 1XZNA 1LFDB 4YUAA 3BFFA 3IUBA 5AOBA 2BYTA 2VJOA 4YDSA 5JNTA 2HPHA 2ZIUB 3E7FA 4GLJA 3JD3A 1I94B 3WK7A 3E22B 1KDSA 4WDQA 1I2WA 3CHYA 3CJTA 4ISCA 4GUAA 3SHVA 4P0MA 3PBQA 1EVZA 4XWKA 3C98A 3IBFA 5K0LA 4EYGA 4ZJUA 5IEBA 4MEBA 3REFA 4L4UA 3KKEA 5AQ9A 1NY6A 3L7KA 3VE3A 3GQVA 4EBNA 5BUZA 4G3XA 3PXEA 2IVFA 4EKDA 4BZQA 2GVZC 1UBMS 1JXOA 4XD7D 5C8YA 3A6ZA 3RNLA 3LY8A 1G291 3K6JA 5YASA 1YLWA 1DXQA 2I4LA 1AF7A 2A67A 1L4GA 3Q3JB 4TMVA 1V1MA 1N8TA 4Q8IA 4GPBA 4OPYA 3KLPX 4GZLA 3T3NA 1GD1O 1JPVA 3BMOB 4PAGA 1TC2A 1ILEA 1AXGA 1O8BA 3T1XA 4J0QA 4IOJA 3EY9A 4YMHA 2GETA 3TD6A 4ZBEA 4ZO4A 1ODKA 2FSIA 3AJDA 3H2GA 3RREA 3HCNA 1UJ2A 3TQOA 5JMWA 2OD7A 3LCUA 5JISA 2WV9A 3BGIA 3F9IA 2IY8A 5BT9A 2ONJA 1TUBB 5IM4F 3ZYCA 1CK3A 1I6LA 3IDAA 5JSKA 2CDRA 3AEYA 3CH4B 3LU1A 2A3NA 3A0RB 1XN4A 4YNRA 2WIAA 3H7WB 2VLBA 4S2EA 1AUVA 4MN5A 2DUMA 5GLDA 5A04A 1V8BA 1HDEA 2JC3A 3H6HA 2COUA 1MIOB 1BEEA 3MW8A 3BXOA 4CM4B 2OCIA 1NVTA 1L5SA 4FFVA 4IL5A 4BNLA 2F3QA 4Q7KA 5LPNA 4JT8A 4XFJA 3OT1B 1PV1A 4TRNA 1RIFA 2B2CA 1RJ9A 5IC5A 3PBSA 4OQIA 1VG8A 5IC6A 3LOUA 4AQDA 1LXCA 2Y2IA 3M4JA 4MVJG 1J0AA 2H2IA 1N1MA 1T1EA 3CG5A 1P1JA 1PGNA 1IC6A 3OA2A 4FJ0A 2R7NA 3O73A 5IAEA 2QX4A 2FE1A 2BHSA 2D1TA 1CWUA 2ZQDA 3BE4A 2P91A 4PPRA 4UBJA 2AK3A 3FLBA 4WUJA 4KN8A 5L3ZA 1I7PA 3B70A 3IQAA 1ZAYA 4B0OA 2APJA 1IOWA 4MIYA 3TI9A 2GHRA 4M9SA 5HW0A 5ILOA 1W88A 2X4IA 3HFJA 3CB4A 4BNHA 4DT1A 3GNSA 1E32A 4YMSA 4HEFA 1KDTA 4QFBA 1WB4A 4IJWA 4DQLA 4AKSA 2EGGA 3CVWA 1PLLA 2Q6VA 4BRZA 1AQNA 2IU6A 3MWJA 4KRXA 3R74A 1ZIDA 1U2SA 1GCOA 2WFLA 4QRHA 2FR0A 4KE9A 3IQEA 1NVBA 3CYFA 3OWOA 1VKOA 3OCYA 5A4FS 2VBFA 3RTGA 2NTYC 3TL6A 1MZUA 3W4QA 1ZSNA 1G5TA 1LWOA 2WHQA 1ZNWA 3EHEA 1SDNA 2I2DA 2WWWA 1VL8A 1F9IA 4QUBA 1AKQA 4COKA 4L6CA 2O2CA 5JZOA 4CVNA 1S66L 3N58A 2ILVA 3G2IA 3WK5A 3BWXA 3FWKA 3VKHA 1P5JA 1D0VA 4DJ5X 5K0JA 3EYAA 4X55A 4NXMB 1O96A 2XNSA 3NTOA 1O9GA 2D7JA 1LDYA 4OHYA 3GFTA 2ZUDA 2X2EA 4PZPA 5ALMA 1UBJS 2HK7A 4U8GA 3UPOA 1UXGA 1UDAA 4TL7A 5DZSA 3CRQA 3B42A 4I50A 3AR8A 2YJ5A 3LVQE 1J33A 3IOEA 3C3KA 4UUQA 5NULA 3E2PA 5BNWA 3FVRA 2CHVA 3THYA 1ESEA 2IWBA 3CZMA 1K25A 3PKIA 1PT5A 4REOA 5ILQA 4I66A 5A1JA 4GNRA 1R66A 3BLMA 1PIWA 3A6FA 1NR7A 4AMUA 3TSGA 1BVHA 3H0CA 3ZH2A 2XLBA 1A5SB 2P6RA 1GDHA 1UP7A 1M54A 2ZQ7A 2H3EA 4A0RA 3LCEA 1T9GR 4DM7A 3P4UA 4ND7A 2BTQB 4MROA 3MILA 3SYRA 5AW1A 5FR1A 3K94A 3RAPR 3PFIA 2C5EA 2FRXA 3M6IA 3CZ4A 2LIPA 4I4LA 2OVBA 2O52A 3AERA 1TF2A 3TB4A 1Z08A 3WLSA 5T67A 3RFFA 3SICE 1CPYA 3MCTA 5HDDA 1M34A 4MW0A 1KI4A 1XTPA 4GPZA 4RD4A 5HQJA 4BO6A 5CD1A 3M3HA 1ZSVA 4OH1A 3KXLA 1B0AA 5TSDA 4U6QA 2X0DA 3RTEA 3LV8A 4FD3A 4AUEA 1KO4A 1WMAA 4FYIA 3BH6A 3G17A 1KDPA 5A3QA 5C8YB 3RU3A 5JDIA 5LMNB 3TQRA 1R9GA 4U0KA 1Y6JA 4FEEA 3QQ5A 3PTAA 1FEZA 1QVZA 2JAUA 1ID8A 5F2NA 1V1MB 3H19A 3JAKA 1CIJA 3QLJA 4HZIA 3C5CA 1N7GA 3VOYA 3VH1A 1RYZA 1ACFA 4QD4A 3FPWA 4TYPA 4BNUA 4V3CA 1T29A 1YR8A 4PG7A 1DWUA 4B73A 3IAAA 4FLMA 4YT2A 5FADA 2BUAA 5CT6A 1MEOA 1DS6A 3T4XA 1TIPA 2Z2ZA 4DV7B 3NM5A 2W1TA 3LIPA 1IEWA 1HDRA 2QMYA 4EZIA 4P5PA 4I55F 3DE0X 2H65A 4JLUA 4V0MA 3C4QA 1YQQA 1U99A 5TJHA 4F8EA 5CCXA 4H7PA 5G4LA 5BSGA 1TNDA 3T9FA 1ZGHA 2W37A 5ADUS 3V5MA 4QPDA 4MAMA 3FJYA 4Y1FA 3PBRA 1XNHA 2V9AA 2WSMA 5JS8A 4XQ0A 1PAUA 4UCQA 3HA5A 4RQAA 1IBLB 3HWSA 4ND4A 4S2IA 3X1MA 2JAWA 2QNRA 4CR6A 4B2PA 4NRDA 1X9IA 4BQOA 4KQDA 5CA1F 5HKKD 1KZ6A 3F90A 3Q41A 4MCIA 2O1SA 3OPMA 4WVFA 4UOEA 1AJEA 5DJUA 3PPYA 3H1BA 2G76A 4QEKA 4MUGA 1ZAKA 1RJ9B 4L3OA 4BO4A 1ZD3A 3KJZA 2X0RA 3HVKA 5F83A 4DE0A 1L8AA 4YONB 3LYXA 2GNAA 5DF7A 3SF8A 4Y8VA 4D6YA 3F4LA 2PS0A 2EAUA 4FZ3A 4RJIA 1V95A 4URVR 3G5MA 4MHOA 1D4AA 1WXGA 4JF5A 4WVLA 4F5EA 4FNMA 5DEOA 4DDYA 1BS1A 3D8SA 1UOPA 1EDZA 5EIHA 2VPZA 4GU5A 1P97A 4MMZB 2PKCA 3E9NA 3H9QA 3OE7A 1SHUX 1W88B 3FPHA 4PONA 3KLMX 3W8DA 3WAJA 4IOLA 2G07A 1KFJB 4FLEA 3KB8A 2ZRAA 4ARZA 4DV2B 1Q74A 4DT1B 3RSFA 4FGLA 1G8AA 3GZNA 2QPTA 4ARBA 3NOOA 2IHYA 3R7BA 5DTKA 4KX5A 3T9EA 1Z5GA 5F33A 4K08A 1N6KA 4XB6B 1Y5RA 1VP3A 2W2PA 1O6BA 3FB4A 4YLYA 3I1FA 2PKYX 2ZTVA 2WFLB 2HKIA 4RM2A 3P0JA 2P9GA 1PVDA 1RABA 2OBYA 4M1EA 3WISA 4ECAA 2V20A 1LHYA 4YXFA 3BD8A 4XUXA 3PITA 5AKJA 1N2BA 5B7NA 3JYPA 1JSXA 5BSHA 3FAKA 3Q6NA 1MR3F 3VR6A 5LYJF 1Y5MA 4CL0A 1GPAA 2HGZA 1CRPA 3PYPA 4Z4QA 1FP1D 1YVEI 2UDPA 1XN1A 5DI9A 4QXAA 3GROA 5AKZA 3PHHA 3T4TA 3GRZA 1QIHA 3K0FA 4J3FA 4KBGA 3ZK7A 5E2HA 1GM5A 1BHJA 4W5RA 1NTRA 9LDTA 1FDRA 5EOOA 4AMVA 5FLXA 1SUDA 5ADWA 3JTMA 2EXBA 1O96B 3TCNA 1M2FA 1TZCA 4NAUA 4CODB 4JCCA 4C89A 2CVPA 2PKQO 1IYQA 4N9WA 2F90A 4QFDA 2AKEA 4I50B 4YCMA 1RYEA 5JMPA 2DJ5A 1I4OA 2FR8C 5AR1A 4RHUA 3K0AA 4RDIA 3INTA 3THYB 1Y28A 1EUYA 1XX2A 2X2FA 2JN7A 1ODFA 3UHOA 2ZB8A 4JMLA 4CLOA 3WYBA 3CONA 4NR0A 4ADSG 1G5HA 2VDUE 1M2WA 3Q7IA 3FMIA 1N6PA 4NKRA 3RKRA 3BC1A 1U7TA 2WF8A 5JY1A 3GO4A 3ICWA 4EY4A 1XEAA 3WZ2A 2BTOA 4MV5A 1KAMA 3T1QA 3W7VA 1G6AA 2GPTA 3CLUD 2KPOA 4GB7A 3EIHA 1I6MA 3FDIA 2X5OA 1ZWKA 4NXGA 3IWIA 3GPDG 3JQBA 3VYUB 2JJ2A 3REGA 3MJTA 4TZ0A 2OCYC 1FDTA 3H4VA 2QE7A 3CCFA 4CDMA 1HE2A 3R77A 2GF2A 2RGBA 3N3AC 4JXZA 2WTEA 1XPJA 2NMVA 4B75A 3OTQA 3W90A 3I37X 2XMBA 2RK3A 3AERB 3BA1A 2FW1A 3EGOA 5KWSA 3DFKA 4BQIA 3QWAA 3U16A 1VKRA 4WI1A 2XA7M 1DIAA 4TLBA 1EQUA 3V50A 1M34B 5CPFA 3BLSA 2Q45A 4PYRA 4E5DA 3CKLA 2J5RA 3QE4A 4M1MA 4M87A 2BFCA 1DJBA 5JAIA 2GBCA 3DFIA 4HNVA 3FNFA 4IBRA 1DFGA 4B80A 3RVRA 2QDXA 3GJTA 3AEUA 5HRUA 3LC2O 2BGWA 4B7AA 2KOIA 1EQAA 1UFKA 4IXWA 4HOIA 1AO3A 4EFDA 1LTKA 2D1RA 4OI4A 3FPBA 2O2YA 2XF8A 4JXKA 4X24A 3JAKB 5F1FA 4JZYA 4I4TF 2LIVA 4RJLA 4BENA 2AYYA 2GEJA 2YXEA 1QG2A 2G82A 1O07A 3EMVA 4KBYA 4R1GA 3HJGA 3QEOA 2LPMA 3HB7A 3H9GA 1BZAA 3ABRB 5KNCD 4JYAB 2L17A 2BBOA 3WGHA 2YIMA 5CVDA 2W1TB 2HAEA 1T9CA 4I9FA 3DE7X 4E2WA 1KAEA 2LB5A 3BD7A 2CE2X 3KQUA 5DM60 4RMNA 4TLCA 2PQ6A 2Y05A 1KS2A 2W0NA 5F78A 2XTMA 1XNGA 2HRDA 3LE8A 1TZ2A 2V9CA 1R0ZA 1VL6A 3QKTA 4H7DA 3OOSA 5BT8A 2GB4A 1GT91 1UBNA 4ZRRA 2MU1A 2ZTHA 2QIOA 3BMNA 1N4OA 5G4YA 1H8HD 5EHQA 2ZBFA 1DO8A 3RSCA 4NS1A 5E9QA 5TDHA 1TOAA 4EY8A 4QY6A 3JQ7B 3QNCA 1KZ1A 1F9EA 3VVMA 5B5SA 3BYZA 3G5UA 1EFPA 4JLSA 1ZD1A 1UANA 3M82A 3CKYA 3NHWA 5HF5A 3G2LA 3SF8B 2C8LA 4N1XA 3OEED 1Z74A 5JCJD 2Z5GA 4KIUA 1EEHA 1GKIA 1E2IA 4AJJA 1GCUA 1MJ5A 1R74A 1ZCBA 4BBZA 1YRAA 1WULS 1NATA 4UE6A 5ICMA 4BRWA 1JKJA 3ENNA 4AG6A 1Q0ZA 2V03A 4MHSA 1C0IA 1TJ3A 5F3RA 4G1CA 3RWBA 1QQBA 2QXTA 2XDMA 4LV5B 2YYAA 5DYGA 3A9UA 1F8FA 2D2FA 2BMEA 4J1TC 4GVPA 3OOEA 3LGOA 3KR1A 4KPGA 4E5MA 3LUBA 5JFTA 3WOVA 1L1FA 4TYNA 2ODNA 4ZVLA 1N25A 3O8NA 1GAEO 5CDFA 3GZNB 3T3MB 1SVWA 2VL7A 3CVYA 4YRBA 4G8CA 3SHOA 3VU3A 4MQLA 1P1CA 2XZDA 3LT0A 1G1MA 1Y9JA 4NULA 4I4IA 1FU8A 1KMIY 3L4JA 1RKVA 3V80A 3OEWA 1RFGE 4PANA 4HH2A 3K5PA 3E2KA 1C7EA 3H99A 1VPTA 1M34E 3FPKA 3BF8A 3NONA 3WLKX 3VAYA 3L2OB 3BILA 5L51A 1NUQA 3TOVA 4G89A 5JY6A 4CGZA 3UXEA 2A4KA 2J9OA 1VKZA 2BRUA 1FYXA 1G5PA 2HCBA 4HNUA 1BE6A 5CPBA 3I9MA 1Y33E 5CFRA 1JG3A 3K0FB 4XIIA 1F60A 3IAHA 2AOVA 3BULA 3RBAA 3BF7A 2YZ2A 1KC1A 4AYXA 3T0FA 3SDSA 4ZYUA 2VQFB 2VHVA 3JQFA 3Q98A 3T94A 3E8MA 3QBEA 1AQIA 4QXOA 1DV1A 4AW9A 4DBVO 4NNJA 5EE0A 3KC2A 4MVJP 2YJZA 4BVLA 4JXWA 3A31A 3E0YA 1Y1PA 2WD9A 3NHKA 1EK2A 4DLSA 1IEVA 3GDOA 2ZB7A 3K0AB 2R5FA 2I6XA 3F5SA 4V1CI 2EZUA 4V0ME 1SQFA 4LY9A 2PZMA 3BQNB 3VR0A 1M2VA 1T9GS 1ZMTA 5EXTA 3GZ4A 4E6XA 4EBLA 3EUFA 4CLOB 3MB8A 3B9RA 1L2TA 4UCFA 5HUJA 4FUWA 2H00A 1ZUIA 5EZYA 4UMDA 5DIFA 4A2QA 1W93A 2WAEA 3B1VA 5JFGA 2IZ6A 3T1QB 4HEHA 1UZUA 1EWKA 5DNCA 2O2XA 3G2QA 4BNFA 3K8QA 4NDZA 4MQ5A 3HNOA 1SHJA 2R2AA 2XUOA 4FGWA 3UB4A 3QVLA 1RTTA 1NRXA 1W5BA 3HI6A 3AUUA 3O3CA 1Z6XA 3MWGA 3B47A 1AUOA 5D1HA 3DMHA 3G68A 3HXKA 4IP0A 1AVTA 4NONA 1X14A 2P78A 1UK6A 3THRA 4UNNA 4M9QA 4J2TA 2ZTSA 2XY4A 4IBXA 3ASZA 2PYDA 4TXLA 4XEHA 3BOSA 1UXHA 2BFCB 3FPCA 2IWRA 3PTLA 1JILA 3UN7A 1EFUA 4WJKB 2UYOA 2QR2A 3AEUB 4A6EA 5EM0A 2P0YA 2E3JA 1H2BA 2XB4A 4U7GA 2ZITA 4NFSA 5CEJA 1OZHA 1P4GA 4HDNA 5H02A 3FIJA 3LT4A 4L5BA 1ZICA 1FS5A 1Q15A 5IBQA 3W5CA 5FL7D 3HN6A 2D00A 1AG9A 4UTRA 5DCUA 1C0EA 4UHBA 3ESYA 2IUEA 4LOIA 3PHLA 1PW1A 2GPBA 2OFPA 3WGZA 4Y6RA 2WA1A 2AD5A 5F77A 3TE7A 3Q7SA 3UXYA 2WHPA 1KJYA 3FG8A 1W34A 4OQDA 5CDTA 1ZVQA 3C8MA 5J4EA 2OLKA 1TECE 1GU7A 1M2KA 4GE3A 1XRSB 2CV2A 1E1QD 5KZHA 1SUPA 3NG1A 4DLAA 5LP1A 2ZJ0A 4Q16A 4MRMA 5DTIA 3BDAA 4TRMA 1ESUA 3AC0A 1I4WA 1NIJA 3AFIA 1GLVA 4DREA 4F60A 3I23A 3WRXC