2WKQA

Structure of a photoactivatable rac1 containing the lov2 c450a mutant
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
317
structure length
317
Chain Sequence
ATTLERIEKNFVITDPRLPDNPIIFASDSFLQLTEYSREEILGRNARFLQGPETDRATVRKIRDAIDNQTEVTVQLINYTKSGKKFWNLFHLQPMRDQKGDVQYFIGVQLDGTEHVRDAAEREGVMLIKKTAENIDEAAKELIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGLEDYDRLRPLSYPQTDVFLICFSLVSPASFHHVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase, cell adhesion
molecule keywords NPH1-1, RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 1
publication title A Genetically Encoded Photoactivatable Rac Controls the Motility of Living Cells.
pubmed doi rcsb
source organism Avena sativa
total genus 108
structure length 317
sequence length 317
ec nomenclature
pdb deposition date 2009-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2wkqA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2wkqA02
3K70C 2FDCA 3K0CC 4KODA 3ZGXA 4Q9HA 4F92B 2NIPA 2R6AA 2ATVA 2X2EA 1T19A 3H82B 2PT7A 1IN4A 1E9CA 4XWKA 3ZD7A 3LI8A 1BO6A 1E1QD 1X8JA 3Q5DA 2RHMA 3D7MA 2G88A 4ZO4A 4W5WA 2WBLC 1HQCA 3UG7A 2BJWA 4WF0A 3RWMB 2QM7A 1GP2A 2CMKA 1G5RA 2ZE8A 4JJZA 4PSVA 3EXAA 4CZ2A 3KQNA 2IYWA 3D8BA 3MGCA 1PLJA 2R78A 2VPPA 2JJ2A 2LKCA 3IGFA 4CW7A 4DT1B 5GVSA 2BKUA 1NN1A 3QIAA 4DSOA 4I99A 4PQFA 2FFBA 4M9XA 2QTHA 5KSYA 4OJQA 1XXHB 1KNXA 1GIAA 2G6BA 1JPJA 1Z83A 2QA5A 3IEUA 3UK6A 2A5DA 1E2HA 3VR5A 3OEHD 1TQ2A 3E4PA 1LW7A 4GDFA 4J0QA 4AYXA 1W36C 3KKOA 4EDHA 1G7CA 2YKFA 4FMDB 3OAAA 3WYGA 2IEYA 1TF2A 2OLKA 3RS2A 1TMKA 2FGJA 1LNZA 2ZS8A 3SBEA 3M6AA 4S2EA 3DEFA 2G1JA 5J7EA 5FI1B 3ICEA 4FWTA 4LRWA 4QGHA 2H8KA 3B5JA 2QGZA 1R8SA 4WOPA 5FUWA 2G0NA 1RFLA 2B02A 1G4AE 2FE4A 3H0KA 1IY0A 1PV4A 2A5YB 1XZPA 4CT4B 5FTLA 2N42A 4JT2A 3WXMA 1L8QA 3WNBA 2GJ3A 1GITA 1ZAKA 3PUVA 3H86A 4YONB 1DE0A 2QT1A 1N2CE 2QQ0A 4TL8A 4A0RA 4MGZR 1JBKA 2P0EA 5BQ5A 4A15A 2NGRA 2ZE6A 5DI3A 5GJBA 1VYVA 3UE6A 3FWYA 2V55B 1GL7A 5EE3A 2W0NA 3BWDD 3NIBA 1KI4A 3LX5A 4TQAA 2AR7A 5FBVB 2NPFA 2RCNA 4URZR 4BPBA 3AH8A 2OXRA 3EIEA 3RC8A 4Q9LA 1IAQA 1ESNA 2GEDA 3E4QA 1AS0A 4Z8YA 4C3ZA 3FKSA 4R6LA 4A0GA 3SYLA 1UF9A 3CRMA 5AUNB 1OE0A 1JAHA 1JXMA 2QUZA 2W6ID 3A37A 2E87A 1CKEA 2ZJOA 1I4TD 2VSOA 3CZQA 3ONWA 2WPDA 4AYTA 2QROA 3A1SA 3REGA 3U3KA 5KDDA 1YHNA 3FHOA 4FCVA 4WLAA 4DLUA 3LDAA 2PH1A 4HATA 2NO9A 3FTQA 1DAHA 4ZPXA 4L9FA 1K5GA 2WV9A 5L3SA 3ZQ5A 5AJVB 3VE4A 1N0UA 1AN0A 2JJ2D 2W27A 1GKYA 5G4YA 1WP9A 1G18A 2HDNB 1JECA 2REXB 2QBYA 2ZSAA 2JHEA 3SDZA 2OV2A 3QBVA 3K9LA 2OSBA 4Q1BA 5FOTA 4G1UC 1QVAA 2JGNA 3QEOA 3E4OA 3R8CA 4EJSB 1D9XA 2FFHA 5H68A 3WYFA 1SQ5A 4NYMR 5HD3A 2QRZA 3B78A 1D2EA 2GF0A 5CB6A 3HJIA 1LFDB 2QP4A 1SHZA 1XB2A 5FPSA 5A4JA 2FNAA 3IPXA 3OAAD 2J59A 4G5GA 1DARA 1O87A 2B7CA 3IO5A 2BMFA 3GLIB 1AJEA 1AKEA 1G3MA 5BN4A 4TMZA 1QHHA 2FV8A 1W44A 4UQOA 5G41A 1KI9A 3QF4A 3MCAA 5FBQB 3T1VA 4A4DA 4EPRA 1P9NA 3EWKA 2WOOA 1XJ6A 2VTKA 3HYRA 5GJWC 2JLZA 3EPKA 2R6DA 3FFAA 4WA7A 4BBTA 4BZPA 2AN9A 1G291 1P61B 3FHCB 3QJYA 3ADCA 2H16A 2QP9X 4B6EA 1T91A 1F9IA 2XTMA 1G64A 1OFIA 5J40A 1J8YF 2EFCB 3JVUA 2CCGA 5GVRA 1GFIA 1P2UA 5CJ2A 4E22A 2RH5A 4JLDA 4BFTA 1E4VA 5KHOC 4D80A 8OHMA 3AF0A 4L9GA 1KKMA 3AQ4A 4IDOA 1KK0A 1N3BA 5CJPA 2F3TA 2C9YA 4FCTA 2FPMA 1N6IA 1SVOA 1Z06A 4M1WA 2CK3A 5JEDA 5FTNA 1Q57A 3MD0A 5DN6D 4KBFA 1EW0A 5KSZA 1O3YA 1E0KA 1EFCA 1W5TA 4BE7B 2ZRNA 4U5XA 1XEWY 1OIVA 1ZNZA 3BE4A 4PAOA 1XTSA 5KOYA 2WKPA 1DVRA 2D2FA 2ZSDA 4JVSB 4A6PA 2ZETA 2RKOA 3REFA 5CK4A 5FFMA 2ZAOA 3EIHA 1G21E 2CCJA 1BYUA 1KJYA 4OKSA 3VNVA 5LB2A 3RS3A 1H65A 2P7JA 3OE7A 3THOA 1VG9B 2QMOA 3CB4A 5DKLA 2V6JA 3NBZC 3BH7A 1KO1A 1W4BA 1UWPX 1D2NA 3DHWC 4B35A 1VIAA 2INWA 2GZHA 3LD9A 3KJGA 3GLGE 3BRWD 1GUAA 2W0MA 2PZFA 4RY2A 4P4TA 2QJ7A 3AUYA 2BMJA 3CM0A 3RS0A 3T34A 2P6NA 2UKDA 3FG8A 2ZRCA 3KTAA 2BM1A 2OHFA 1NMYA 2QM8A 3GJ6A 2WOJA 2V0UA 4JVMA 5E4FA 3SBDA 4IKEA 3RS5A 2QMUA 1PUIA 5JWHA 1P62B 4NXFA 4N1AA 2CJWA 2DWPA 4Q7MB 5TVKA 3F0TA 4NE2A 4HDQB 1J90A 3ULFA 3GLHA 4TWZA 2ZJ5A 3B1YA 1KKLA 3VX4A 2CBZA 1G3RA 5AVEA 1MV5A 1N5KA 3WRYC 1L4UA 3P32A 4PZLA 3K3CA 3B60A 3UG6A 4B44A 1T5LA 3CRRA 4PPQA 4P32A 1M6NA 1P75A 2VHQA 1VYTA 4KXFB 1YU9A 5JJKA 5DLQC 4WVFA 3GLHE 4FXPA 4GT1A 4R2HA 4YMTA 4C9BA 3UMDA 1ZBDA 1XZQA 3T12A 4XVUA 3A8TA 2D06A 2YINC 3A58B 4EPTA 4MGIR 1N0WA 1AK2A 2GHIA 1QHNA 2BMEA 4C30A 3I5YA 4M4XA 3KKPA 2WSSD 3B8HA 1VG1A 3VNUA 3KKNA 4QJ4A 4XD7A 2CVFA 5TB5A 1VCIA 1KY2A 1ANKA 4US2R 3PYPA 1WDTA 2BKEA 1C9KA 4Q47A 3U61B 2RHDA 3IQWA 4LGMA 4TZ6A 3OLOA 3GJ0A 3VQTA 3CPHA 4HOIA 1OHHA 2EFHB 5JCZA 4DC9A 4LHYA 3PEWA 5CM9C 3MR0A 421PA 1KO5A 5FTKA 4YXWA 2DFKB 2H1LA 2HCJB 3KXIA 3JVVA 1UKEA 1NWZA 5JI3E 1FTNA 2OOLA 1ZIOA 4WBSA 3V4FA 3K09A 4Q4HB 4WL9A 2ODBA 1Q1QA 3MLEA 5H70A 2O8DA 1UFQA 4AC9A 3BXZA 4FMCB 3F1OA 5J5CA 4NTZA 5HZHA 3THYB 2NG1A 3QBTA 3T1OA 2NO0A 5E95A 1CEEA 1TPZA 2AD5A 4Z1MD 4PSAA 3I8SA 3RTYA 4PC6A 2ZRKA 1UAAA 1CU1A 1DAEA 4LJAA 1R5NA 1F60A 3GECA 2GWHA 4KVGA 1ZYUA 2Q3HA 4UNRA 4HAVA 1R6BX 1ZMXA 1GRQA 1Q1BA 2FGKA 4F3LB 5HR5A 1WXQA 1R0XA 2ZIAA 5UKDA 3KKMA 4PC3A 3BY8A 1L4YA 5AJYA 4GMDA 1XBTA 4XSGA 2O5VA 3TUIC 5IF9A 2D3WA 2MSDB 1S1ZA 5TBMA 4I1SA 2OLJA 3Q7PA 4OYHA 1I4DD 3MRSA 4US1R 3AVTA 3MXQA 3KJHA 2IS1A 2F43B 5SZIA 1V5WA 3G6OA 3KDSE 1GSXA 2IS4A 2ZRGA 1S1YA 1XD2B 2A3RA 4HJ6A 1JR3E 3EA0A 5L3RA 4OK3A 4XSHA 3TQCA 4B34A 5AJXA 4DIEA 1KI8A 4BZXA 4HIAA 3UKDA 4WZ6A 1C1YA 1E2EA 4GSYA 2PEZA 3QQ5A 2D7CA 4G5RA 2FEOA 2O0JA 2F1HA 5FOVA 3RSLA 3V00A 4DLVA 2BEJA 4AIIA 1FQKA 2FG5A 2P2LA 2ZJ2A 2YWFA 2BOVA 3CZPA 4LLOB 4HZUA 3VKHA 1AQUA 2HV8A 2FU5C 4JLAA 3H9WA 1TQ4A 4XTCS 2ZSFA 2GDJA 4EQ6A 1RJ9B 3VHLB 3RS4A 1ELOA 2W2VA 1G16A 4NONA 2A30A 4NYJR 4LYJA 4HUTA 4MYUA 2JATA 2E1RA 1A5TA 1HTWA 4KO8A 4Q1EA 4OQNA 1GNPA 1OXUA 4IXNA 3V4RA 4P4SA 1R0YA 3LWNA 1NKTA 1U8ZA 3IUYA 5LBIA 5EJEA 2YOFA 3QKSA 3EASA 3RYTC 4M9ZA 3CH5A 5FR1A 1EK0A 1S8FA 1OH8A 4KJZA 2ZQ5A 5F68A 1G6OA 4NCJA 2Q6TA 1UBFA 1VDZA 4Y0AA 3C8CA 5CB8A 2OAP1 2QI9C 1N9OA 2O8BB 2FFAA 4JIMA 2A24B 4OI0A 2SHKA 1XTRA 3Q8XB 5BN3A 1J99A 1MO4A 2IYUA 4A92A 3LIFA 1TL7C 1XJ2A 5M04A 4TMKA 3K1JA 5JMTA 3ASYA 5KDOA 1KDRA 2H92A 3IS2A 4F38A 2YV5A 3BD9A 1NY5A 2WKRA 2HJGA 3UMRA 2NTYC 2IHYA 2WSMA 2OWJA 4XT2A 2CHQA 3A36A 1ESMA 4F4IA 2A9KA 1TS0A 2IYYA 2QENA 4DDVA 3LAWA 5BN5A 4QBFA 4L8GA 4EKDA 4B3GA 2WIBA 2QAGA 3DVLA 4KLNA 4HUQB 1F98A 4TYNA 4MYCA 2C9OA 1Z22A 3IBYA 3HR8A 1SXJA 3LNCA 4QHSA 4XTRA 1R5OA 1UPTA 2VV7A 5IDVA 4JKYA 1COWD 1KAOA 3EA5A 4POAA 4HP4A 2HT1A 2WJHA 5JFGA 1P4SA 2IWRA 4A8JB 3CX6A 2XZLA 1LF5A 3QUSA 1RKBA 5EXTA 3RDPA 1SKYE 2AWOA 5DGXA 5BYJA 3N70A 4JZKA 3C8UA 1US8A 3ZS9A 3T1TA 1RPZA 2J7KA 2OT3B 1ZVQA 2VSXA 3FMOB 4QKQA 2C5LA 3X1XA 1FZQA 5JEEA 3CW2A 1IHUA 4HAWA 4LBVA 1OTBA 4QM7A 1FMLA 1ZIPA 1T4GA 2AL7A 3TAUA 2ZOHA 1FL9A 2B8TA 4PPNA 1KMHB 2ANCA 5AK0A 4D4KA 3HP1A 2AK3A 2FZ4A 3CH4B 4A6XA 4GW9A 1XU4A 1S3SA 4Q1CA 4CVNA 2Z4SA 4JYBA 1T6NA 5CIWA 3QPVA 4ON9A 2H17A 3E70C 3SJBA 2B7BA 2QG6A 2IEZA 4TMWA 1KO4A 1NI3A 2D2EA 2XAUA 3TSZA 1T1CA 3EPHA 1YR7A 4MITA 3U7EB 2I3BA 2DWOA 2ODEA 2QORA 4MDFA 1EXMA 2G9NA 3RC3A 1P9RA 1DG3A 1NIPA 1CJKC 1GWNA 4PZZA 1DP9A 4C4PA 5LD2B 5HWVA 3QVUA 2J0UB 1A1VA 3SQXA 1XD9A 2OBMA 1UADA 4DWJA 5J4VA 3QSYA 1RRGA 5JI2E 2YC4C 1F2TB 5F5YA 2FX3A 5IT5A 1IN6A 1Y63A 2CLDX 5JBQA 4AI6A 3D72A 3I4LA 4IFBA 1YRBA 2J0VA 1OLOA 3SFVA 2W6JA 1CTQA 4LBZA 5FTJA 2OILA 4JBWA 3MWLA 1R4AA 3F8TA 3E1SA 1DP6A 1JQLB 3VOLA 1NBMA 4L9EA 1W49A 2QL6A 3B1WA 4CYMA 4B6FA 1LB1B 2BDTA 2H5EA 1RVDA 3VR4A 1LSVA 4KAXA 4N3NA 3SYKA 2IHBA 4IOJA 5HCIA 2FJUA 3KFVA 1JALA 3HU3A 1ZNXA 4HAZA 4I1UA 1IOZA 2G0TA 2FPLA 3GLGB 2WM9B 2WHXA 4NKRA 1CRQA 3L82B 3WMGA 1UJ2A 3ZJYA 3ZVNA 1SXJD 4P33A 2LCFA 3FMFA 1NLFA 3IO3A 5IRCD 4LHXA 4I4LA 2WWFA 1QZXA 2ZS7A 3O8CA 2ZRHA 1Y3AA 3FMPB 5BWMA 3B1VA 3U60B 2GK7A 1W36B 3HU2A 1GNRA 5C4MA 4I1VA 3W90A 2QKPA 4B48A 3PHYA 1KO7A 2K5UA 2VH5R 1DAMA 1Z8FA 2J7PD 1T8TA 2KJQA 2OBLA 2RAPA 3S1AA 4DZZA 2HYIC 3LBHA 5TY0A 2ATXA 4CF7A 2PMKA 2EYQA 2ZI5A 4JKIA 3U7HB 2QHKA 4AKGA 2ONKA 3K9HA 1P5ZB 4HB0A 4M1OA 3QY0A 1UBGA 4IVPA 4RFSA 1DELA 4YLGA 5B64A 1E1QA 3U7GA 1HEIA 3WMFA 3OIVA 4G01B 4G5SA 1T9HA 1X86B 4AY2A 1XFAA 3SS8A 1ZM2A 1PVOA 1OJGA 3A1TA 3LLUA 1OTAA 1R0WA 3IILA 5J4LA 3ADBA 3F3YA 4Q7LA 4MYTA 4MKFA 2HXSA 5FOSA 3H1TA 1T3SA 1E2DA 1G3QA 4P4UA 2J3EA 4NZYA 4AK9A 3CRQA 1VHLA 1AS2A 1S4QA 5EE0A 4KITB 1CR0A 2BIFA 4PSKA 1OYYA 3UB9A 3OIYA 5JZVA 4L9WA 4NHOA 4A8JC 4RD0A 4RD4A 2DR3A 1S3GA 1YZGA 5DYGA 2Q21A 5E7IA 5TMPA 1IJEA 4A0FA 2L1MA 2RGEA 2M1CA 1N6PA 3TR5A 3EPLA 1RC8A 1KI6A 1NBMD 3PEVA 3U4QA 4NPHA 2QMEA 2VL7A 4DLTA 2ECKA 3BFKA 4OI2A 4LPSA 3PCRB 4Z54A 1OT9A 4V0MA 1XMJA 4NYJQ 4PANA 1VHTA 2FSHA 3GJ3A 2AKAB 2OBNA 2JCSA 2WWWA 3P20A 3HU1A 3U7FB 1XMIA 2CL7X 4PPGA 1TQ6A 1NN5A 1G5PA 4O2LA 1JR6A 3LBIA 3FMIA 2FZLA 5FH9A 4DDWA 4FMCF 2VLGA 2VYFA 1CXZA 3NH9A 4URVR 2J0SA 2HF8A 1K8RA 2BCJQ 3PUZA 5HKKA 3G0HA 1E32A 1XJCA 2F1JA 4LPZA 1IY1A 1RRFA 4R3AA 5J4EA 2P65A 4QOSA 1AQYA 3A4NA 5ANRB 4TQUS 4ZI2A 4Q00A 2VEAA 4BLTA 3LQRA 3R20A 1LL8A 2BM0A 3BS4A 1E9DA 4PQYA 4LJ8A 1KGDA 5F9HA 3QKRA 1ZNYA 4B47A 2W6IA 3NH6A 1D7EA 1S4SA 1N25A 1QF9A 2EVWX 3FHTA 2KB0A 2J45A 3L2OB 4AWXA 4GRAA 4QG7A 4BFXA 4WZAE 1YR9A 5DHAA 3UB6A 1Z07A 3EG5A 4IVRA 4E07A 2OM2A 4CEIB 1UKZA 1ZM4A 1YRAA 1MOZA 4CDGA 2Q9AA 1NF3A 2ZBBA 4IVQA 4LYHA 4TLAA 1DAIA 5EXSA 3BY9A 3U3JA 3C41J 4BECA 5JHHB 2YKHA 4MN5A 5FI0B 4V0NA 3NC0C 5DYIA 1GTVA 2UZIR 2PR6A 2VV6A 1DTSA 1K5DA 3SQWA 1Z0FA 3GQBA 1Z47A 3HJNA 2REBA 1MO6A 2JIZD 1W2HA 4D82A 5J4YA 1S4RA 4KI0A 4DLYA 1GG2A 1HE1C 4MH0R 2GXQA 5HSQA 1OV4A 1Z0AA 2R6GA 2MSCB 2DFLA 5TDHA 5L3QB 2JLWA 2ZRDA 2JLUA 1ONBA 1M34E 3FC7A 5KPDA 2OZEA 2V3CC 4TL6A 2ZRMA 3FE2A 1QVRA 4EAQA 1E9SA 1Z5ZA 1JAIA 2XGJA 1R5BA 4OHVA 2JEOA 4M1YA 4JGOA 1CP2A 1X1SA 2VRWA 3NBFA 2IYVA 4JLOA 4KFTA 4L5BA 4UXIA 2V1UA 2J5XA 1TS7A 5H8WA 1WA5A 2IUTA 1VCMA 1U2RA 3FOZA 5KSPA 1Z6XA 2NO7A 5C18A 2EFGA 5A0FA 2J80A 2DHRA 4G0NA 1NMXA 2A5GA 2PL3A 4C0JA 1ZU5A 4M2LA 2QY9A 3DZDA 4XOIA 1E1RA 3AB3A 3RRMA 1GL9B 3OZXA 3EC1A 3QI2A 1XFQA 4EUNA 1RJ9A 1Z0JA 1XCMA 2YWHA 3CONA 3F1PA 1E2KA 2ZI4A 5G3YA 3L0OA 4TYPA 5EE5B 3HPRA 2R6FA 5HKKD 3T06B 2ZVQX 5K8LA 3X1WA 4NDZA 4UNNA 3GFTA 4NXEA 2Z6VA 4US0R 2XZPA 4C0HA 2WWYA 4LV6A 2RGCA 1NSFA 1Q0UA 4IW3B 4Q7KA 1NKSA 3PUWA 2ANBA 1Z08A 2FFQA 2ZEJA 3H4MA 2J1LA 5DISB 5FUYA 4BBVA 4LJ7A 1IXZA 4B71A 5DN6A 4LPKA 4EESA 1Q1EA 1Z6GA 2J46A 5HWWA 1NJFA 2FSFA 4AD8A 2O8FB 1ZUHA 2UVQA 4BFZA 2JLRA 3WNCA 5F9FA 1Q21A 3KQLA 1KSFX 4M0LA 3A4MA 3W6NA 3BJIC 2GJKA 4PC2A 4Q4LA 4MDEA 2KWIA 1EFRD 1S1CA 5FPTA 1U9IA 5L8VA 4PO8A 3LYXA 4RSGA 2PEYA 2ZUBA 4LOAA 4TMVA 1SGWA 2BBWA 1OXVA 2GJ9A 3I8XA 3B33A 4ARZB 4M9SA 2B6HA 1NVVR 3NBXX 3UATA 3X2SA 4PX9A 2BASA 3GFOA 1NJGA 2E9SA 3Q5EA 6Q21A 1AGRA 2O0HA 3FB4A 3SFZA 3DDCA 3AF4A 5HE8A 2GETA 3VU9A 2F9LA 2ZU6A 1JJVA 1XD8A 3VR6A 3LIBA 2IW3A 4GS9B 4B3CA 2YNMA 4WXRA 1G8GA 1HURA 2R2AA 2ORVA 4FIDA 2CXXA 1KK2A 1W46A 1Z3IX 4JJKA 4PHTA 1E94E 4XIGS 3K0EA 2GXAA 2XX3A 2G83A 4GHIB 2YC2C 4LC1A 4P31A 1XDBA 2GJAA 2RGGA 2IUUA 2CE2X 2GAAA 4LJYA 2GBLA 5EE9A 1N6KA 4X8OA 3K0FB 2AXNA 3PV0A 4K81B 1E6CA 1NG1A 2F6RA 5FL7D 3WBKA 2CCKA 3SHFA 2XSZD 1WA9A 1QHGA 1RW4A 3A4LA 4HH2A 4ZKEA 2J0QA 1RIFA 2PZEA 3MQQA 1GL6A 1TUEA 1GKUB 2ZM5A 5J47A 4LHVA 3FKQA 3AKDA 1Z0KA 3K53A 2ODNA 1E1RD 4MGYR 3KX0X 1E96A 1NLZA 3FGNA 5IU1A 2ZJ8A 1IM2A 2PHYA 2QSYA 1G17A 4B3DA 2VF7A 3FYHA 3I32A 4TMTA 2J41A 2V0WA 5AUQA 1S67L 1FFHA 2WJIA 3BFVA 3K0AB 3L8YA 3WP1B 3RS7A 4DSUA 3H7WA 3P27A 5GJVC 3THXA 2IF0A 1XTJA 1XEXB 2WSSA 3EX7C 1C4OA 3WY9A 3ZLJA 1U0HC 5JWOA 3W5JA 5G4ZA 1XF9A 3BBPA 4V03A 3T50A 4QNMA 3ZQJA 1II8B 1FW6A 4GOKA 5EUMA 5GJCA 3W6PA 1G9XA 3AP2A 4A1FA 4M1MA 1F2UA 2EA9A 1ZRHA 1MO3A 1G1MA 2QRNA 4MA4A 3CX7A 1E9EA 1FOEB 1W2GA 3OEED 2XXAA 2ODWA 3QKUA 3U2QA 4NYIR 4ZDJA 5KTYA 3MJQA 4BEJA 3GLFB 4R38A 2PR5A 2F1IA 3Q7QA 4L15A 1TX4B 4JGPA 4JBXA 2IBMA 1PZNA 4PO9A 1OTIA 3VR3A 2RGNC 5A8BA 5JLJA 3RLFA 4Z1MA 4NCIA 5FOUA 4CEHA 4YDSA 3TAHA 3GEHA 3FDIA 3P4YA 2ZAMA 4O2RA 4OJKA 1E0AA 3A0VA 5JECA 1VB6A 5FPHA 3NXSA 4GP7A 4Q18A 1LS6A 3KXLA 2JAQA 3KX2A 5HTKA 1NN3A 1W1WA 1OF1A 4Q4JB 1IN5A 4CEJA 3IHWA 4BRWA 1NVWQ 1U0JA 4KUKA 1DAFA 2BJVA 4BFUA 1Q1ZA 2VP4A 4DXAA 1CS4C 1SVLA 2OO7A 4MKIA 1MABB 1HT2E 4S35A 2OCPA 4MKGA 2HCBA 1XJ4A 2GA8A 2ZE5A 4KHZA 4XVQA 1E2GA 2NZJA 2UZ3A 4NCHA 4Q02A 2IS2A 2ZRJA 3CPEA 4ZI3A 1JNYA 4MRVA 1EWRA 1F48A 4DDTA 1DO2A 2ERYA 1EFUA 3RSOA 4G5QA 4ACBA 3LXRA 2GRJA 1II9A 1S9DA 2AK2A 5D3MB 4HQAA 4BUJA 3UB8A 2IA5A 3RAPR 3SR0A 1I4LD 1D6JA 3I1FA 4JYCA 2X2FA 1TU3A 1EFTA 2JLQA 2JJ8A 2IXFA 4RD2A 3RABA 2AWNA 5JWRA 4RD1A 3R9XA 5IHPA 3MFXA 1HH4A 1GSWA 2DBYA 4MUAA 1NVXQ 2A7QA 2X77A 4WAUA 1EWQA 1RRPA 4RD3A 1V43A 4OK5A 3AVWA 2GCOB 1E3MA 1EESA 1LY1A 3KL4A 4RFVA 1DG1G 4LJ5A 2ZRFA 2JA1A 3OFNA 3PVSA 4BLSA 4AG6A 4MRNA 3K70D 1IY2A 1T1AA 2C96A 2CHVA 4IOKA 4K46A 5EE1A 4DUGA 4RVCA 4ESVA 3IEVA 3VR1A 3AM1A 3NKVA 1E79D 3C7KA 3BORA 2ZI9A 4DB4A 3LIAA 1YVDA 5E3HA 2CL6X 5JS8A 1DEKA 1NY6A 4Q1FA 3DO6A 3MJRA 1Q44A 3VAAA 2MMCA 4JMPA 5J4HA 5JSZB 4M1SA 3BH6A 1KI7A 3QNUA 1SVSA 3KQHA 1E2QA 3FFBA 1W7AA 4PKYA 1F6BA 1A4RA 2ZRAA 2IWHA 3BK7A 1S9HA 2PX3A 3W5IA 2O8CA 3KFXA 4ACAA 4AKHA 1OW3B 3HR7A 5SZJA 3R7WA 3CR7A 2WIAA 2W00A 3AF1A 4P0TA 4YMUA 3CNOA 4JS0A 3ZD6A 5LDDC 3PIRA 3CF6R 2DFTA 1E9AA 4LX0A 1BYWA 4I5SA 2WJJA 3SOPA 4B75A 5DJUA 3TSOA 2GZDA 4R9UC 4OQXA 5FOXA 2LWIA 1HV8A 1W36D 1IN7A 1XTQA 3IIKA 4JLPA 4LV8B 4B3XA 3F1NA 3QENA 1GM5A 2FN4A 1KAGA 121PA 2H57A 1L7VC 4Z51A 3P7NA 1LSWA 3TQFA 3T5GA 4DCUA 3E5HA 1II0A 1HY3A 4B43A 2OESA 1COWA 4TLEA 2GILA 1VIYA 2FEMA 1NG9A 3H82A 2GEVA 1D5CA 4PKYG 2VHUA 3UPUA 4PC7A 5J3WA 2KX6A 1NVVQ 1X1RA 2WWHA 1CULC 1HT1E 4KVAA 5TV2A 1R2QA 4OL0A 1JPNA 2QSZA 2ZYVX 3U6KA 4MUBA 1WCV1 4HDOB 5AR1A 1YKSA 2BCGY 5K8UA 2WMNB 1OFUX 1SVIA 4IXMA 4NYMQ 4UJ3A 2OFXA 1XPOA 4DT1A 1BOFA 2OEPA 2KI5A 2QWSA 3B13B 2RMKA 4O3MA 1Y28A 3LQQA 1GDDA 4KFRA 1OPXA 1G8FA 1SULA 4M9QA 2HEIA 1P7CA 3CBQA 3OFND 5JRZA 2RGAA 1XXHA 2QU8A 3C5HA 1W47A 1P2VA 2IYXA 1DO0A 3BIFA 3KUCA 2WWIA 4KU4A 4PQRA 3SE0A 1SKQA 4IOLA 4DUGD 4UNSA 3O8RA 1WQ1R 4AG5A 2QAJA 1GSIA 1OFHA 4R71A 3IKJA 5BYKA 5KNDA 5L3QA 3U6BA 4YDHB 3EIQA 4JSYA 2V7QA 4JLNA 3BFXA 3VX3A 3ZIAA 2P5SA 2QTVB 5JRJA 3QG1A 5DJTA 4PO1A 2G3YA 3CR8A 4U7DA 4R7ZA 1XTIA 3NTUA 5JCPA 2ZRIA 2PLFA 4LJ4A 2R6CA 1G41A 1LV7A 3C2WA 3R9IA 5EP1A 3DOEA 1OXXK 2VP5A 2OFOA 1E9FA 1E2MA 1CRPA 2Z6DA 2EW1A 1BIFA 4ZDKA 4RZUA 3TUZC 821PA 4DLRA 1KSHA 1TUIA 1WBBA 5FPKA 2IYQA 4LK2A 3J81k 1WMSA 2TMKA 1FNNA 1F3OA 2ZR9A 2EQBA 4D0GA 4PAQA 1LT0A 2DY1A 2X19A 5C2JB 1KO8A 1U8AA 2C03A 4KSBA 5L3SB 4NH0A 1E2FA 4PHFA 5EP3A 1W4AA 1B23P 1DADA 4BGDA 4IHQA 4OHXA 1MKYA 1IXRC 4HJ3A 1FUKA 2YVUA 3BOSA 4LDJA 2O52A 2DFNA 3PUYA 4FCWA 4NYIQ 5EXXA 3U5ZB 2QBYB 3I92A 1CR4A 3VHXA 5LB4A 1Q3HA 2O8FA 1SXJE 2GESA 2H28A 2J7PA 3MJHA 2EFDB 4F7WA 5DE3A 4KUOA 4M53A 4HB3A 2GXUA 1WB9A 2ERXA 2IYLD 4LI0A 5P21A 3GEEA 4A2PA 2EWWA 4PXAA 4C0QC 2ZTSA 2BEKA 1M74A 4LBWA 2Q9CA 4JLJA 2ZROA 4ARZA 2IC5A 4LJ9A 1J7KA 1QHHB 3VMFA 2VHTA 1UEIA 5C4GB 2ZI3A 1IXSB 2CLCX 5K8TA 3QF4B 4C0KA 1U98A 3HPQA 4DHEA 2FMXA 4OHYA 1H8HD 5SZKB 3BB1A 3LICA 2IYRA 4UNQA 4BEBA 4EJSA 2HXYA 2D4HA 1ZP6A 4FN5A 3LO5A 2B92A 2O0KA 2Q3FA 3GFPA 2ZANA 4JL8A 2B8WA 4QFMA 4UXJA 4DSTA 3A1UA 4ESHA 1E9RA 1VG0B 3ZVLA 3Q72A 2VV8A 1KYIA 5FBWB 2JN7A 2V7QD 1OXTA 2QMHA 1G7RA 2P6UA 2QE7A 3ZIAD 3IQXA 1UDWA 3ETLA 3K9NA 3L0IB 3OF5A 4B2IA 4AYWA 3AGPA 4YMVA 3GLIA 2GF9A 3M4YA 2GVZC 1MRNA 3B1XA 3U3MA 2QZ4A 1TS6A 4RKFA 1DS6A 3TE6A 2PT5A 2EFEB 4CIDA 4ERNA 4GOJA 5BW8A 4DJ2A 1W0JD 2QTFA 4NMMA 2OWHA 4BFYA 4MGKR 1AA9A 4GNKA 1XMSA 3H84A 2W2XA 1E2JA 3ND9A 1OXSC 4FI3C 5AJZA 3K8YA 4RZ2A 3W6OA 3I61A 3ICQB 1T1BA 5F2EA 1IONA 1MT0A 3UMSA 4F4CA 2OCYC 3TGPA 1I2DA 1T5IA 4HAUA 2YYZA 5DNYB 2PJRA 3VE3A 2WICA 2YWEA 3T1QA 4BLPA 2FOLA 1LS1A 1NBME 5IS1A 1XRJA 5DH9A 3NJAA 1W4CA 2IX3A 4NU0A 1KNQA 4RJLA 4U00A 3PEYA 2O8EB 1ZD8A 4D81A 4Q03A 3GJXC 1A82A 2J87A 1YZQA 4OBEA 4OI4A 3T61A 5IK2D 1FP6A 1JXOA 3C4JA 3I5XA 3EPJA 2PCJA 5KPJA 3X1DA 2JDID 3CPJB 4XWOA 2KSQA 3PXGA 3KTAB 5SZHB 4PR0A 2CMNA 3U3OA 3M0EA 4URUR 3C14C 4L4UA 3K0SA 4LSGA 3D6TB 2R8RA 4WUJA 3GJ5A 3PR1A 4HLUA 4OK6A 4HAXA 3GLFA 1R10A 1CJVC 2R44A 4TTPA 3UXMA 1UKVY 2GVDC 4HY8A 3GLHB 3PFIA 1P0ZA 5EQTA 4TSFD 3GJ7A 1AM4D 4I38A 2OCAA 2Z83A 4B32A 4HHDA 4RQ9A 1ZC4A 2FF7A 3PQCA 4TL9A 2W58A 721PA 2YOGA 3RANA 4EEPA 1KDPA 4IOMA 2GTPA 3P4XA 1XPRA 2W0SA 5A5GA 1VG8A 4G3XA 4MYHA 1DOAA 2QE7D 3THWB 3AEZA 1U9IC 2C95A 1TNDA 3P1JA 4EIWA 4RCZA 4TTRA 1RYFA 2JIZA 4XWAA 3EZ7A 4JGRA 1GRNA 4Q9IA 5B30A 4RZXA 1OTEA 2Y8EA 5KSOA 1S66L 4FINA 3IDQA 1BS1A 1MABA 4ZDIA 3NDBB 4HP9A 1D8TA 4LCBA 4EFNA 3RVBA 5G3ZA 2IL1A 5AJWA 2AD1A 4AURA 3SYNA 4JLBA 1MH1A 3L0SA 1VTKA 4QM6A 1TU4A 4M8NE 4WZBE 3R9WA 4B76A 1E98A 2KDKA 4PHHA 2G77B 4D26A 3B85A 2Q0HA 4IFEA 4KLZA 4K08A 1T3HA 1ZCBA 2QEQA 2ZYTX 3GMTA 3BB4A 3LIDA 1JJ7A 2ZITA 2C78A 2CVHA 1G8YA 2GAOA 2RGDA 1KZGB 2WAYA 4EPYA 2VP9A 2EU8A 3AKYA 4QBHA 1MZUA 5L3VA 2O8DB 1QHXA 4I81A 1PLLA 4PPFA 3F1OB 521PA 1Q22A 1XCPA 2K7SA 1LF0A 2ZE7A 4V0ME 1M7GA 2GKSA 4ZIRB 3BWLA 2CLSA 1OIWA 5JJLA 1DPFA 3ASZA 3N2EA 4FD2A 1CR1A 2GNOA 3SJZA 2WWGA 1KDOA 2OXCA 2H18A 3E2IA 2LKDA 1MRSA 3G82C 2RGXA 3GCGA 3OHMA 3QOFA 4C0LA 1CJTC 1YQTA 5JJIA 3TNFA 1P73A 3PUXA 2PJZA 4Q4HA 2PLRA 4DLZA 3SW1A 3LVQE 3O8BA 5ELXA 1KI2A 1YE8A 1Z0IA 1KTVA 1G8PA 1ZD1A 4UKDA 3VFDA 1CBUA 3THYA 4GCZA 4X8HA 1Z2AA 5TBMB 1L2TA 2I1VB 3NHAA 4I3JA 4EEUA 3EARA 1HE8B 4QNRA 1XMVA 4Q9JA 4ZV4A 3TVDA 4OQMA 1EFRA 1Z63A 3LIEA 4TMXA 3EZFA 2ZI6A 1ZJ6A 2ORWA 4B73A 3CKLA 4IEEA 4JT4A 2JLXA 3MQOA 3VR2A 1G4UR 5CYPA 2C8VA 3LA6A 2I9VA 2OAQ1 2X8AA 3HJKA 3GPLA 4F3LA 1UGUA 1YJ5A 4D2IA 1H8ED 5EFWA 1GKIA 4TN1A 2ZU0C 4BWYA 3GJ8A 4DIDA 2Z0MA 2PD8A 4M22A 2GK6A 4M4SA 4HZUB 5CLLA 3AP1A 1GILA 3T5DA 3NWJA 5KDLA 2F43A 2F3RA 5H1YA 2MSEB 4EQ6B 5I5LA 3I62A 3DL0A 4R98A 1XD2A 3WRXC 3KUDA 3SEAA 5EP4A 3HYTA 3MWKA 1BKDR 4XVRA 5B57C 1NVUQ 5FL7A 4P4SB 1AS3A 2XSZA 3GDIA 2HV1A 2FPKA 3QKSB 4JLMA 3TIFA 4DB2A 1G20E 1TEVA 1GOTA 1N6LA 2IT1A 2XITA 4JVNA 1GZSA 1A2BA 3FVQA 2OUKA 2XOKA 4AKEA 4A2QA 2WWXA 3V9PA 1M7BA 3WBJA 4H6JB 5KUTA 1QG2A 1U90A 4CGZA 2XNDA 1UM8A 1T0HB 4Q21A 1W0KD 2V54A 3ZYCA 5CITA 3BAFA 2ZJZA 3NG1A 4IDQA 2NQ2C 5J4KA 4GL2A 4A82A 3JZAA 1OJ5A 5LPNA 2R9VA 3QXXA 3NVAA 5JHGB 3PJRA 4L9SA 1EG7A 4YWZA 2QPOA 4II7A 4V0OA 1Z29A 3Q85A 3QXSA 1YZNA 3AVYA 3IIJA 4NXBA 1I2MA 3IS2B 4CRWB 5FUXA 4DCNA 4EETB 1BMFA 1MR3F 3CWZA 3FPAA 4Q48A 4TYQA 1OYWA 2C9CA 1FNMA 5CIQA 2GXSA 3SJCA 3ZDQA 1KK1A 2CDNA 4N0EA 3SC3A 3LX8A 2BMDA 4XT2B 1V9ZA 2AXPA 2O8BA 2DYKA 3AVXA 4C7OB 4DJ3A 1ZU4A 2VHJA 1TADA 2A24A 4RD6A 2QAGB 2XJ9A 3N5CA 5EZ5A 1SKYB 4DSNA 4TYYA 3HDTA 3OEEA 4C0AC 1SXJB 4ILEA 3MSXA 4E03A 5AUOB 1JQJC 4JSTA 4DLSA 2V8OA 2FSIA 1YR8A 5CK5A 4B3FX 1XJ0A 4EQ1A 4MRSA 1X3SA 2X1VA 5DKKA 2GCPA 3M1IA 2WJGA 3GD7A 3K09C 4D25A 3TW8B 2AFHE 3PENA 1OJLA 1KY3A 2VQSA 3KJEA 3SZRA 1AZSC 1US8B 2Z5FA 1V9YA 1YZUA 2BBOA 2DPXA 4LWZA 3ZVMA 3ADDA 1E4YA 4HUQA 1P60A 2IYSA 2P5TB 4E5UA 4Q1DA 4W7SA 3ND8A 5B58C 1PLKA 1KOFA 3TK1A 1B0UA 1CIPA 3QEJA 3L0PA 1OTDA 2FA9A 4A8JA 3IIMA 1XJ3A 2V9PA 3G5UA 2QN6A 2VLIA 1M1YE 3A0SA 3U3RA 3WHKA 4Z8XA 2ZSBA 1NSTA 1RYHA 1E2PA 4Q19A 4WW0A 4ABYA 1OIXA 1TTTA 3CO5A 621PA 1NLYA 2XOKD 3NBYC 3LVRE 4PZYA 4AKIA 4DJTA 2XNDD 1NIJA 1KMHA 1A2KC 2YHSA 4X8MA 5AWFC 3LH5A 2F9MA 1G8HA 3A6PC 3W8RA 3CNNA 4FWIB 2XB4A 1ODVA 2WMOB 4HNBA 4TLDA 1P6XA 2VP0A 2A2ZA 4RKEA 1N9LA 2ZJAA 3MWJA 1YZKA 4URXR 4JVLA 1GRRA 3GEIA 4JL5A 3ZVRA 2HF9A 1M8PA 2L4RA 1BMFD 1XX6A 3TSWA 3W8NA 3NDPA 3UMFA 5KIZA 3NC1C 4QC2A 5HDSA 2ZUDA 4Q7JB 2J0UA 1D9ZA 5DIFA 1Q12A 3B1ZA 1FTSA 3NOUC 3CNLA 3K0CA 4EPVA 2Z6CA 1F2TA 3ZZUA 4KSCA 1NP6A 3L43A 1XWIA 1E79A 2PYRA 2GZAA 1EFHA 3AGQA 3C16C 4FW9A 3MWYW 4HDCA 1DAGA 1PUJA 1Z28A 1W48A 4CT5A 2D62A 1OKKA 3EC2A 1X8LA 1ZUNB 1RRCA 3EW9A 4YC7A 4OI1A 3BC1A 3T35A 4A0HA 3FKSD 2C98A 1KK3A 1WE2A 4Q1AA 1M2OB 1MO5A 3AUXA 1KSJA 3CRW1 1GVNB 2FSGA 1HYQA 3QF7A 5KNCA 1OH5A 3TMKA 2F7SA 4X8LA 1G5TA 1CLUA 2PCLA 2P67A 2WPDD 3MUFA 4JLKA 1IJFA 3Q3JB 4TL7A 3S1AB 4GPTA 3GLGA 3ADKA 3KQUA 1SZPA 3QXHA 3W3AA 3U44B 2P6RA 1KZ7B 5C46F 2PMDA 2V4ZA 4ZCIA 2ZXUA 2V9AA 1VCOA 2O8EA 4IDPA 2PZGA 1T18A 4JL6A 4TQ9A 4RFSB 4H9GA 5DI9A 4KQDA 1E99A 2MMGA 4NXGA 3DOFA 4U02A 2ZS9A 1F5NA 3LW7A 3WMEA 2XB2A 3HWSA 4BLOA 3OESA 1D2MA 3NOPC 1G19A 3SNHA 4EERA 3AF2A 3A1VA 4NBSA 1XFNA 4L16A 1FX0B 3LW8A 4HB4A 3W9YA 3TBKA 1KSGA 4UNPA 4GP6A 2DCUA 3RRNA 3IBRA 2QPTA 4LBYA 1S1MA 1Z2CA 4W5JA 2QAGC 1T0JB 2ZJYA 1N6HA 2C04A 3C15C 1XJQA 4Q4AB 1SXJC 1QHYA 2VA8A 5HD5A 3AVOA 3EEHA 3L8ZA 1NNEA 1YR6A 4IEIA 1ZUIA 2F55A 4HB2A 3WYAA 4ZKDA 3TKLA 5KO2A 4RCYA 2D7DA 2A5FA 4A36A 1XNJA 2VBCA 2D02A 3Q9LA 5AVFA 1FUUA 2NO1A 1KDTA 1KI6B 1W4RA 1ZM3A 5DSZA 3VTKA 2HUPA 1W5SA 1ZW6A 3RRYA 2ONJA 3U4QB 3BB3A 2ZREA 2HT6A 5G40A 2NOAA 4ZCLA 3THWA 5KU1A 2G1KA 1AKYA 4ZDWA 3LUQA 4TYWA 2L0XA 1DAKA 3LXXA 1KI1A 4D6PA 4HAYA 3EWAA 2ORIA 3I3SR 3AP3A 4BFVA 2R62A 3CF0A 2ZI7A 1GSVA 2W83A 1XEFA 4NL4H 3ZZTA 2AKYA 1UEJA 5EUQB 3ZH9B 1FQJA 3RH8B 2JASA 2VSFA 2VEDA 4KV9A 4NCKA 1JEEA 5HWTA 1S0UA 1TS8A 1OKKD 2WVJA 4BLRA 1PJRA 4EJSC 1G3UA 2CK3D 2WAXA 3KZ1E 3SU8A 1TF7A 4B3BA 3AV0B 2P3SA 4W5HA 1N6OA 5FBRB 3NEYA 2BBSA 5JS7A 4C2TA 4LRZE 4D0LB 1OH6A 1EX6A 2IK8A 3I72A 5BXQC 2NPIA 1NRJB 4JLVA 4ASUA 2V6IA 4MQBA 1E9BA 2C99A 2WJYA 4OHZA 4BZQA 3D31A 2J9RA 1N0VC 5B2ZA 3OE7D 1QHSA 1RZ3A 4NCNA 4PHGA 1XP8A 4M1KA 4D4MA 1OB5A 1OSNA 3KB1A 1R0ZA 2ZYWX 4QBGB 3QKRB 3VKWA 4D0NA 3QPWA 5EP2A 4W9MC 4ZIRA 5GADl 1TQDA 2C2HA 1VPLA 3A1WA 3UB7A 2YKGA 4D4LA 3TUJC 5F3WB 1WF3A 4DDUA 1K6MA 4HLCA 1QDEA 4JGQA 1WRBA 2R65A 3AVPA 4BASA 2IF2A 1XPUA 4BLQA 1VMAA 3KXKA 4B9OA 1NN0A 3UWOA 1P2TA 1P2SA 1DRMA 4EFMA 1JR3A 3DZ8A 2ZR0A 3TR0A 3LLMA 1R7RA 2BV3A 4H1VA 3ICYA 2IYZA 3AKEA 2BBTA 2ZOIA 2DWQA 4KBGA 4LHZA 4QBIA 4CEIA 1DBSA 3TW4A 1G6HA 1X8KA 1OB2A 1U81A 4PFSA 1KMQA 4B74A 2ZRPA 4BFSA 4F91B 3P26A 1J2JA 5HZKA 4LRYC 4V0KA 2Q3MA 4F93B 4K8OA 3TH5A 3EZ9A 1S2MA 4URYR 3SN6A 4GI7A 4GZMA 4HLUC 1H8HA 3I73A 4UJ5A 3LY5A 3H2YA 1J8MF 2IXGA 4HLQB 5CYOA 1OH7A 4EXOA 1IQPA 1G7TA 4GFDA 3EZ6A 4LC0A 4O25A 3LFUA 3OIWA 4R2IA 1N5IA 2Q9BA 2JLYA 1Q3TA 2D74A 5TXGA 4XD7D 1EX7A 4DBLC 2L0WA 1HA3A 2CEAA 4FMDF 1P9WA 2WZQA 5KNBA 4BBUA 1XXHE 2WJVA 3UWKA 3F1PB 4EFLA 4GZLA 5G53C 2VO1A 3RWOA 5DI3B 1DP8A 3BGWA 3NEJA 2ASEA 4LUCA 4PTLA 2VF8A 2PDRA 1OHHD 3RNLA 3DKPA 4LV5B 2CHGA 3OIUA 4GMXA 1Z6AA 2QT0A 3C5CA 4YXWD 3QXCA 3NOTC 1ETUA 1M7HA 2AFIE 3LV8A 4HYYA 2GJ8A 3B9QA 3EWSA 4ASUD 4MN6A 4HI4A 1TF5A 1W0JA 2H7VA 2VP2A 4WXPA 3ZZ0A 1HQYE 1N9NA 1G28A 1E2NA 2RGNA 4H6JA 3CWFA 1E0JA 2A78A 3K9GA 3PITA 5HPYB 2XEXA 3B2EA 2AX4A 2PX0A 5HE9A 4V02A 1S96A 4WIAA 1CJUC 4D4JA 2JLVA 5FOWA 1RE0A 4DVGA 3LRPA 1QBKC 4M1TA 2GEUA 5HDDA 3NHBA 1WBDA 1KIMA 2PYPA 4F4JA 2NMVA 2XZOA 1U99A 2QGNA 1BH2A 4KFUA 4DLXA 4O0MA 1JEDA 1AZTA 3CLVA 2ZPTX 5FR2A 4DCVA 3AVQA 1QHIA 2IYTA 4DCSA 1IN8A 4Q01A 4QJ5A 1Z0DA 3O47A 3WNDA 4KYUA 3JZMA 1X6VA 221PA 2ZSEA 2ZRLA 5CDFA 4A9AA 5IK2A 4XH9B 1JR3D 1AGPA 1D06A 1U94A 3VU9B 1P97A 2N1BA 4C7OA 4YQFA 1N5LA 1FPMA 2JDIA 3SHWA 1ZD9A 3F5FA 3PG5A 2N46A 2WTUA 2OFWA 2GJSA 1NMZA 4HZIA 5FUVA 1VYUA 4HJ4A 2RGBA 1ODFA 1SHKA 1ZCAA 3MMPA 4HLDA 5CLQA 4Q5IA 4I1OA 4EPXA 5CDFE 3QKTA 3LI9A 2REOA 3TVTA 1KJZA 2EWVA 4KCGA 4KFSA 4QXAA 2HYDA 1QRAA 2XJ4A 4IJMA 4TSFA 2CE7A 4URWR 4QHYA 2C77A 2QPAA 1KOUA 3UMEA 1A7JA 1AIPA 1EGAA 3AKCA 5FTMA 4BRUA 4IRUB 3CLOA 4GS9A 3KJIA 2V1BA 4N0DA 2KBEA 3WHLA 4LY6A 4IDHA 1QG4A 1XTKA 4LRXC 3T15A 4GHIA 1U0LA 2GCNA 2ZVPX 4M21A 2WKQA 5F6AA 2QP3A 3W3ZB 1ZC3A 3AVUA 2I4IA 4MRRA 1CR2A 3K0FA 2CNWA 5FBLB 4QJ3A 3H7WB 3THXB 3PEUA 1CF4A 4PC1A 1FP7A 4IDNA 5AUPB 1N5JA 2F1RA 3ZQ6A 5F69A 2PBRA 3GLIE 1SVMA 3LBNA 3IPYA 1U8YA 1VECA 2PD7A 4HH3A 2YZ2A 4BFWA 2QJ5A 2KE5A 5FPYA 2Z43A 4ZCMA 3K70B 5KYKA 3EZ2A 1F2UB 4C0BA 3A0RA 1ZINA 3SI7A 4C2UA 3K0AA 3D3QA 2EYUA 2NZ8A 1XEWX 1Z6YA 4I39A 3BERA 2XXAB 1XEXA 2XTZA 2IXEA 1KHTA 4DKXA 5HCNA 1BYIA 1JI0A 4QHTA 1XCGB 5TARA 4B33A 1X0OA 4EPWA 4MKHA 3N2IA 3CAXA 2BHRA 1II8A 4EW7A 4PAMA 2ZRBA 1LVGA 4DLWA 4CEHB 3K3DA 2IUSA 4GBMA 3GJ4A 4E04A 3BH0A 3CF2A 3TLXA 1G3IA 3MFYA 2YWGA 5K8IA 1YZTA 2VIIA 3KB2A 1OT6A 1ZM7A 3DMDA 4RZ3A 4A2WA 1GNQA 4G5OA 3TRFA 3X1ZA 5HDCA 2ZUCA 2CJWB 2Z4RA 3ECCA 1OFTA 4KYIB 2HLDA 1T3LA 1SVKA 1KI3A 1J70A 4CEJB 4FMBB 4NP6A 4Q9KA 2QQEA 4LYAA 2B21A 4Q66C 3R8FA 5F98A 1P72A 2RB4A 3QVVA 2ZJBA 3O8DA 1UBCA 4QGGA 1VKJA 2OG2A 4TT3A 2JJ1A 3GLFE 4HEJA 4OHWA 4DRZA 5D3QA 3U44A 1HUQA 2IS6A 3WP0A 4I3IA 1E2IA 4B2LA 5E7JA 2NO6A 1H8EA 2YJTD 4Q4JA 3SJAA 3QE0A 1ZNWA 3AVVA 4Y0VA 2V1XA 2VHCA 2XNSA 2CNWD 4TLCA 3W34A 2OE2A 5C1BA 1YZLA 3IHLA 4H1UA 4HSEA 1UBEA 3QPUA 1FX0A 1R8QA 1JB1A 2QNRA 5E7MA 3QXJA 4DCTA 1UDXA 4E09A 3IBGA 1FMJA 1UKYA 4QGFA 2KBFA 3EAQA 3UANA 2BWJA 2XTNA 3CRVA 4Q4AA 2VP6A 2A5JA 1JNUA 1G7SA 1Q20A 2ZR7A 5D3MA 3TJZA 2JLSA 4R70A 1ZM9A 4JBYA 3OEHA 4HI0E 1P3JA 2I1QA 1SVWA 5EZ6B 2D01A 3B6EA 2W2TA 4ITRC 2GBLC 4DEYA 1E0SA 2W6JD 4LZZA 4BQSA 2FH5B 1W0KA 2V1AA 1N6NA 3DMNA 2OCBA 3B7GA 4QL3A 4TTQA 2DB3A 4MRPA 4YMSA 3UIEA 2FWRA 5DHFA 3DM5A 4B2PA 1LSXA 1Z6TA 3AF3A 2GCOA 1T8UA 3CX8A 3DM9B 4V0LA 1IBRA 3MG9A 4UXHA 5CM8B 3CIOA 3B82A 3RHFA 4TZ0A 2CL0X 3KKQA 1TEXA 1CJMA 2O8CB 4QRHA 5EXPA 1E69A 2YOHA 3R7WB 3ZS8A 3KQKA 2AHOA 3B9PA 4LJ6A 5FL3A 1NL3A 4QGAA 4GOXA 4LYFA 1E2LA 4XJXA 4OQFA 5DO9A 2HLDD 2BC9A 3CUEF 1LTQA 3CWQA 3VKGA 1OT3A 2ZYUX 3NHQA 3DKVA 3RRZA 3X1YA 1UWNX 4DEXA 5JSZA 4I3AA 3DPUA 1GAJA 4YMWA 4OQLA 4P3YA 3QG5A 3F1NB 1N6RA 2BVNA 4LHWA 4TLBA 3MAAC 4WN5A 5LD2C 4C0SA 1KJWA 3GP8A 1TAGA 1VCNA 4TT3D 2HJVA 2JJ1D
chains in the Genus database with same CATH superfamily
3K0CC 4WZAA 4XQGA 4OGLA 3QP1A 3CRZA 2HPVA 3Q5DA 4IVIA 3BRMA 2E4WA 5B53A 1YMSA 1A8QA 3N0WA 3WQQA 4I99A 4UBMA 5BW6B 5FUBA 2I2WA 4EUVA 4C20A 1XP5A 3O94A 3S2EA 3OEHD 7ABPA 3HJGA 3GSGA 1PI3A 1IZYA 3G68A 2QXUA 3CVVA 4RMGA 4H08A 5J7EA 4LRWA 4IMRA 2A5YB 1XMPA 3WNBA 1A9ZA 2GJ3A 1PSDA 5GV7A 1K4FA 5JE8A 4A0RA 1FP2A 3MJDA 5BSHA 2WFLB 1X14A 3UE6A 1JX6A 1KI4A 4BPBA 4Q9LA 3VISA 2WJ3A 1N4OA 4N3CA 4Z8YA 2F8TA 4TV8F 3D9YA 1ARZA 2NT4A 2NQTA 5FULA 3RRXA 3VE4A 4XW2A 1TCAA 1GKYA 1UFOA 4GOLD 3AEXA 2ZSAA 3K8OE 2TECE 4O4IB 1QVAA 3R8CA 2GF0A 1EM8A 3EOZA 3HJIA 4G37A 3HUTA 2B7CA 3RUAA 4ZMBA 1G6Q1 3SXJA 3QF4A 3MCVA 4A4DA 2WIJA 5TQ2B 4BMNA 2FDRA 1TGYA 2P35A 1R9MA 4EY3A 3EVFA 2YXBA 5EMNA 2HBQA 1E1YA 3HDVA 2ABWA 2QP9X 4Y1RA 4JP3A 5CBPB 5JDIA 2WIGA 2WTXA 3KD3A 5KC8A 4PZPA 3FM9A 1VDMA 3WLMA 3QM1A 2C9YA 1N8NA 3O2SB 4HVTA 1P74A 1O3YA 1PGQA 3V67A 2XAAA 4M83A 3BN3A 3FOAA 2EP5A 4OKSA 1K89A 3ONDA 1W4BA 2XYRA 3OCUA 1O57A 1SKUA 3BTOA 1WSDA 2H1FA 1N2EA 2B94A 1B8PA 4N01A 3HH8A 4AZ0A 5IN5A 1XRQA 1ESDA 1GCGA 2REQA 1O0CA 4MVJI 3SR3A 4TWZA 1NURA 2ZJ5A 2XR0A 3WRYC 2XD5A 5SY9A 3WJ1A 3S7TA 1FFYA 1WHTA 4RWZA 4O59O 3WWOA 2E1PA 1JAXA 3AB8A 2Q9MA 5GLBA 3HCYA 1DIRA 3KKPA 4HNQA 1VG1A 5GZ1A 1VBKA 2QVGA 3AF5A 2UAGA 4QG3A 4L0LA 4BMWA 4DC9A 1FSGA 4LHYA 3EF1A 4R0VA 3DZIA 3JD3A 1BG6A 2E6KA 2HCJB 1BDBA 2YX1A 1XDDA 1LCIA 1Q1QA 1P31A 4G5YA 1TPZA 2BPOA 4HWKA 1ZGHA 4EO9A 4BUCA 2B0CA 3ORQA 3GECA 1ZYUA 2WMDA 2C2KA 2CDBA 1R0SA 1ZMXA 1Y42X 3H0EA 3PI6A 3BY8A 1XBTA 2CGEA 4US1R 4DILA 3RIYA 3GUYA 1PEYA 3S2ZA 3ZV4A 1VL8A 2A3RA 4LNUA 3PFHA 1EA7A 1KI8A 2O54A 1IIBA 4GSYA 4YAUA 4D74A 5DX1A 1CQJB 1NQWA 3BMOB 4INOA 4HX5A 3CHYA 2ZSFA 2GDJA 2O9BA 4E5VA 1DJPA 1C3OA 2RK3A 3P0JA 1A5TA 5IARA 1D0VA 3D6AA 3RIGA 1BXKA 1T1SA 2YICA 2JJYA 1FB5A 4UMEA 3W2EA 4TTVA 4HNGA 2SHKA 1C3EA 1P91A 5CAEA 4A16A 3DWFA 1NY5A 4DABA 3K5WA 2WSMA 5FEUA 1UC4B 4JQOA 3JTMA 1MJGA 5HF9A 4L8GA 1YVEI 4PCVA 5A4FS 2I5PO 4QHSA 4BV9A 4C6SA 1UPTA 1XKXA 1CZNA 1DHTA 2WYIA 3C8UA 2GX6A 4YDRA 3EDRA 1KKUA 1FMLA 4MVJH 1FL9A 4NSNA 3WGLA 2ZTVA 2OQ2A 3RTBA 3HP1A 2VXYA 4MI1A 2H0TA 2FZ4A 4KE9A 2G17A 3GA0A 1WZNA 1YR7A 2I8CA 1F0PA 2H7YA 2ODEA 1JNXX 4H7PA 1NXSA 1A72A 1DP9A 1J9ZA 5J2TB 4UEWA 4OVKA 3BQMB 4ZXPA 4J1NA 1YRBA 2I66A 4G2NA 1O97D 2VTDA 5B3KA 5IVPA 3THSA 3WICA 3VOLA 2H5EA 4N0MA 2W42A 3TOCA 2Z3WA 2J3HA 2B5RA 2I03A 2WE7A 3CVOA 1R1DA 3G1UA 1SXJD 4EHHA 4QDXA 2W3DA 5JCJD 2Y2JA 1P4HA 1U2TA 4TV9B 3STWA 2UUAB 1Z8FA 2ZI5A 1U8UA 1KIAA 4HEA1 3HEBA 2FP4B 5IFLA 4NCAA 3QU4A 4LQ4A 1E2DA 4P4UA 2C2BA 3KVRA 4LMPA 3VKFA 4KITB 1SCKA 4JOCA 4RD0A 5F1OA 4RE6A 4N9LA 3UJ6A 2WPNA 3UOWA 1KAEA 1IJEA 3IT0A 4JI1B 2VL7A 4Q16A 4MR7A 1GZ7A 5GHZA 3C6BA 2E4ZA 1OX6A 1NASA 4JI0B 2AOXA 4DDSA 3WTCA 5M7EA 3NH9A 2BCJQ 2WVGA 2JFXA 5K2MA 3BTVA 2C2OA 1K7SN 4DR4B 3MLBA 4BS9A 3EXIA 4GZ3A 1YR2A 3CUEA 3C97A 4O29A 3TM4A 1GTG1 2PQMA 3M4XA 2Y2KA 4R7GA 4MQUA 3MGBA 4MXDA 4V0NA 2IVZA 1U2EA 1QCCA 3HJBA 4OPMA 2JIZD 3UO9A 2QSJA 4YVFA 4DMLA 4V1CB 4Y98A 4FJ2A 5DWVA 4HV4A 3CUVA 5AVVA 4P2BA 5FASA 3PQ7A 2IHUA 4JQYA 4M9RA 4B85A 3BMOA 4D9MA 5EJFA 1D4AA 2ZWIA 2PL3A 3EXHC 1YLYA 1NE7A 5FADA 1U6JA 2YWHA 5JV5A 3F1PA 1QB8A 3X1WA 3AUSA 3BD7A 2XZPA 2JIRA 4CT0A 4PRKA 4UZEA 5F5LA 2ANBA 4U0KA 2FFQA 5FUYA 1P80A 4LJ7A 4AD8A 3IJEB 4M86A 2VQFB 4NDAA 3DXXA 4TMVA 1Z73A 3DT9A 4OLGA 2B5OA 2SECE 4HEA6 4JDUA 3G30A 4UOEA 2ZZKA 4JC8A 3L0ZA 4XCXA 4GE3A 4OMFG 5DM0A 2V03A 2GAAA 3H3FA 4B4ZA 4X8OA 3PV0A 3KOUA 4FOFA 4B17A 3G89A 4L4YA 2PSDA 4YJKA 4KR9A 4IBRA 1DKPA 1L4GA 4EVSA 3FGNA 2ZJ8A 2WYWA 3I32A 1HL3A 1F6WA 3UAZA 2EBFX 4MCIA 1VBNA 3DVQX 3OQHA 2J4CA 4CI0B 1NPYA 4K9KA 3VZPA 3BBPA 3T50A 4FQ5A 4KN5A 2PKCA 5EIHA 3B3QA 4FYJA 4NZZA 4OLHA 2QIPA 2G1AA 4U7JA 4NS4A 2V59A 3NHUA 5KTYA 4L15A 2F1IA 3N8KA 4H18A 3LGAA 4PO9A 5IBPA 4ENSA 2BEVB 4MI6A 3ZGOA 3TAHA 4JC5A 1KEKA 2OVBA 1SQ6A 5FPHA 3L6BA 1BFUA 3NXSA 5DBHX 3Q8WA 2VJAA 1LLFA 3KC2A 1Y4DE 4N7RA 1DAFA 1RRKA 2H0YA 4RXMA 5IMBA 1OV6A 1I4WA 4CV1A 2OCPA 1XJ4A 5JS2A 3WRWA 1DO2A 5CTJA 1DIGA 5HYVA 1I14A 3E9ZA 5HRUA 2P9ZA 1B8OA 5D3MB 3RAPR 3B42A 4FFMA 4B3JA 4HGPA 4RD1A 3MTBA 2FP3A 5DNDA 1V43A 4RHEA 2XEPA 3AR9A 3ZCSA 3MS7A 4C1NA 2XT6A 1WUJS 2JKTM 2H9AA 3JY6A 5SICE 4RIGA 3LGOA 2EZ4A 1DIHA 4NESA 2MMCA 2WNIA 3HVKA 3NDJA 5JPCA 4WCVA 3IHBA 4PSDA 5K1ZA 4R0NA 2P27A 2CXHA 3K6SB 2NUPB 3AF1A 3A3YA 1YAHA 3CF6R 3DOCA 4KZBA 2FYTA 4BWIA 2LWIA 1IN7A 5K5BA 1XTQA 5HKOA 4LV8B 2CV0A 2UZAA 5FI5A 3GFSA 4CM7A 3MJSA 3TXAA 2BDUA 2FG6C 3C4OA 2DUJA 4IJGA 2FQWA 2FZWA 3FVVA 4KDRA 5FLXA 4OL0A 2Q6KA 2QNIA 1NW3A 1SVIA 4NYMQ 1PGJA 4GEKA 1YA8A 4WLVA 5LYJA 2H1SA 2LTAA 2QTNA 2XUJA 3OSUA 2P5SA 1A0KA 1L6RA 4PO1A 2IYAA 2C5WB 4JVOA 1HLUP 1OPRA 3K96A 4FUWA 3HVRA 3HDYA 1SBNE 3DF7A 3EPPA 1ULHA 3LUFA 1LQTA 1C7ZA 3AR8A 1Q83A 5GPBA 1G2QA 3OPYB 5ILGA 3YASA 1RM4A 4IHQA 5L7YA 2MSKA 3UT0A 4PZEA 3OCXA 1E7WA 1L0BA 3CFYA 4BNJA 3GT7A 4E3KA 2GXUA 1KFEB 2UYOA 3ZHBA 1FIKA 3ZKAA 3QY9A 4Z7JA 1UEIA 2PX8A 4DIUA 3G0BA 3LCMA 3BB1A 5TPZD 1ORWA 2P9YA 2QUBA 4LV2A 3TBFA 4WFKA 2PS9A 4MQ5A 2W1RA 3DW0A 4LVNA 3AMVA 2VJMB 5EI5A 4Y2YA 1E1CB 1VBMA 5I51A 4YT5A 4NMMA 3OZTA 1WE4A 1I6WA 1E9VA 1DXHA 1IK4A 3UCFA 4FB5A 1L5QA 1T1BA 3QUQA 4HAUA 2PJRA 3UFXA 3HI4A 4D81A 4G1FA 1V6CA 3IP5A 1TC2A 4DCGA 1RWPA 2XZTA 4Q3EA 4S1OA 2XVMA 4BO5A 3I5XA 4RVOA 1KQFA 3PL5A 3IAFA 2CMNA 1EFVB 1Y0BA 3GR2A 4Y6LA 2BJHA 3O4IA 4YRJA 3UAXA 2PRKA 2ZYDA 4UCXA 4B32A 3V3KA 2W2LD 3KZMA 2EDCA 1KDPA 4O4JA 5LYYA 3ELUA 1CWUA 2PH3A 3NDRA 4YMLA 4WOKA 4X53A 1J00A 3FLAA 4ZDIA 4FBGA 2PS3A 1GCOA 4DJEC 4IMPA 5LP6B 4JLBA 3B5IA 5ICCA 4YP7A 1OLUB 4PHHA 5ITZB 3OQ6A 1QH1A 1YT5A 3B85A 1H4SA 2H65A 2O2SA 1L7RA 5CXWA 1G8YA 1WKVA 2Y0PA 2FW1A 2VQDA 1GQSA 2VCHA 5CCXA 3K6RA 3B1KA 1WSBA 3KYQA 2VPIA 2LKDA 3SVTA 3CSUA 1ZG6A 5EUBA 3VZRA 1CQIB 4RK6A 5EIAA 4X1YB 4MVCA 4L4RA 4CE6A 1ORTA 5DMXA 4OQMA 2Q3CA 1YOVA 5CYPA 3QV1A 3H2GA 4P92A 2V7VA 5FLEX 4Y9SA 4EG0A 4YRAA 3OZAA 2Z0MA 2G0AA 3I05A 3WLOA 4XCVA 2WKEA 1TA4A 4NFHA 3HYTA 4BENA 1PR2A 4XVRA 1NVUQ 3AFMA 4D8XA 2P41A 2XSZA 1VLVA 1XSEA 1JP7A 1NJ6A 1V5IA 2AMVA 4HO1X 3V8NA 4II7A 2VWGA 3PS9A 4TYQA 3ZDQA 3SJCA 4N0EA 4QUEA 1Z4KA 2O8BA 1TMYA 3PWTA 2H2FA 1S6YA 1NF9A 5HIJA 3HDTA 3PGVA 3FPLA 3IELA 4JSTA 5KMWA 3X43A 2V8OA 4KZAA 4EX7A 4GGMX 4B3FX 4EG1A 1XJ0A 3L7LA 4Z4CA 3ZFZA 2VQSA 1F5SA 1N3IA 2VPTA 4Y2UA 3QYPA 1PZPA 4QD4A 3RHTA 1WCXA 4JGBA 1XNHA 2YHUA 1CIPA 3G2ZA 3ZY2A 5AXAA 3AR5A 2QTRA 3K6KA 3FOBA 3CG0A 3U3RA 5CH5A 1IVYA 2XNHA 1AO3A 1OIXA 5JADA 2FPIB 8MHTA 4PCUA 3UC5A 4BC0A 5AWFC 4GPD1 2F9MA 3GBVA 4YQZA 3H5RA 3A0RB 3FUVA 4URXR 1XX6A 1T4CB 1KZHA 3A06A 5LDHA 3PNLA 4W63A 5DIFA 1EBFA 3JALA 1SB9A 1P7YA 2DZDA 4DQXA 4IFIA 1LHYA 2IEAA 1ZIXA 1OKKA 1RRCA 4C04A 4RTLA 1F06A 4P4NA 2WPDD 4DM3A 4JAVC 3QXHA 3QUCA 2ZXUA 1SQGA 1G2PA 2WLSA 4Z0HO 2J4DA 3WMEA 3HWSA 4BLOA 1Z56C 2JB9A 4RPCA 2DCUA 1PW7A 3PB3A 1AGNA 1LJLA 2JVJA 5HP4A 2O5RA 2C54A 4XDHA 3WYAA 4C0XA 4AT1A 2D02A 1JDVA 4AZ3B 2NO1A 4OJYA 2Y6UA 3DZJA 3I83A 3KZOA 2B82A 4LRUA 1QKJA 1PX0A 5F9MA 4BFVA 4KQXA 1UAYA 3I6BA 4KV9A 3WLEA 1TKBA 2DJ5A 2QSUA 1ZL2A 4LAFA 5KNCD 5ITZA 1JU3A 2V6IA 1YKGA 1NHGA 5HBRA 1YUBA 5BWNA 1ZOIA 2Q5EA 1NZOA 3RTCA 4TRMA 3U26A 1C3JA 1NVGA 13PKA 1QVVA 2I4NA 5ALVA 2I6XA 1NNUA 3BWMA 4M0UA 1DBSA 1X8KA 3CMMA 1NJ8A 3OBFA 2YXDA 3JWPA 1PYOA 1U4NA 4KRXA 1OTXA 3TH5A 4EA9A 2AR0A 3ZCUA 1NFRA 1FU4A 1MXFA 1H5XA 3NHYA 4K9OA 2A3UA 1XXHE 3BWYA 5DI3B 3CZ9A 4RQAA 4EBBA 4XPIB 2VDWA 1N9NA 2RGNA 3IHKA 3OT1A 5HPYB 5IASA 5ENVA 3VSCA 2JLVA 3PA6A 4M1TA 1HRKA 4CM5A 4YR9A 2PYPA 5A91A 2IEBA 3PUJA 1PL0A 4MCJA 1DXYA 5I7WA 3D4BA 1X6VA 4OGKA 3I1JA 1BQEA 1R8JA 3VNBA 3L18A 2WTUA 1XVLA 3F6BX 3EH2A 1VYUA 2HLNA 4HJ4A 3QKTA 3PC6A 1ZR4A 1KJZA 4KCGA 4IJMA 2CEKA 4QX6A 4O8ZA 1LLQA 4X6LA 2VTBA 1EJBA 5ICGA 4LY6A 3D4FA 4OREX 4EWFA 4ZJ2A 4DJDC 4U9HS 1U8TA 4C07A 4JLUA 4FOTA 3RHZA 2HCFA 2FPIA 5AQAA 2QJ5A 4O8GA 3DB1A 4IDGA 5LKAA 3A0RA 1WG8A 2ODAA 1XEXA 2AXEA 2OCDA 4JROA 3E3MA 4RV9A 2HHCA 1YIOA 2AG0A 3LT0A 4EBNA 1P1IA 1EUQA 1EB9A 3MFYA 5E9QA 1P8AA 3WLAA 1CI9A 1SVKA 1KI3A 4FMBB 4Q9KA 3UHPA 2B21A 2XKAA 1UBCA 3ZQ4A 1IRIA 4I36A 4GN2A 4I8DA 1WDWB 3E0QA 4TKZA 2XNSA 2UZ1B 3ACBA 5CNIA 1AK1A 1BNCA 4I08A 1W9MA 4WY5A 5HL6A 1PDOA 4QGFA 4OLFA 1DC3A 3CG5A 3TJZA 5F1FA 1ZM9A 3TMAA 1SVWA 1BXGB 3FSJX 2UXDB 1G9SA 3IXQA 3AF3A 3CX8A 4CMKA 3F6RA 2CLKB 2PBYA 4KNWA 3FPEA 1OLSB 1OI3A 3VVMA 2WADA 5EMKA 1P7WA 1I80A 3QG5A 2UV8A 2CLMB 5E2AA 4JBNA 3E98A 3GUCA 3ZJ4A 2ATVA 3IC5A 3H82B 3VM6A 1E9CA 1P18A 1TECE 1BO6A 3BIOA 4JJFA 2BJWA 1L8AA 2CMKA 1OC2A 2IX9A 1J2RA 5ED4A 3QEKA 4BNGA 3VPXA 3BMQB 1Q7TA 4KXUA 3U09A 3W78A 1JFFB 1G7CA 5ALMA 3OAAA 2FGJA 4DXBA 2G1JA 2AA3A 2O7QA 4OATA 1TIKA 4P6BA 2I4LA 4PTYA 2ON6A 3MS4A 3DMPA 1JW9B 3RBVA 3DLAA 1OY1A 1BHO1 4MGEA 4R8KA 1O96A 5DI3A 4S2OA 3NGMA 1R4MA 3P9PA 4L75A 2AR7A 4P9NA 2I4RA 1MY8A 3BDVA 3LKDA 1N7JA 3B3JA 1CKEA 4AYTA 1EGHA 1E3WB 4FCVA 1VL6A 2PH1A 1DAHA 3UV3A 2WV9A 2YJ6A 2GF2A 1W93A 1DTEA 1DKOA 1LGYA 1UC9A 2FEWB 3B6MA 2JE5A 4IQ8A 4REMA 3BQNB 1D9XA 1PI4A 4HNRA 2V9CA 5CDTA 1L8XA 1NF2A 2HA3A 2JF0A 3IO5A 5BR1A 1J0DA 1G3MA 1QHHA 4L2IB 4GKBA 3N28A 1P9NA 4Z9AA 3HYRA 3DV9A 3EPKA 1PEAA 1G291 5LQJA 4ZVKA 1IM5A 1D6MA 3JVUA 2AQKA 2ZBVA 3FCAA 4I46A 4IFTA 2FSUA 3C70A 3VVLA 1GQYA 3LYAA 3NXKA 2WILA 3ZWPA 4A5SA 1Q57A 2BL4A 4ETIA 3I45A 3NM5A 4RF2A 3MWGA 1T0PA 2QUAA 3KR0A 1TT7A 4PF1A 3LVFO 3V3RA 1LC3A 1RXIA 3CLSC 1AB6A 4DNOA 4NBRA 2C5EA 3NS7A 4MLZA 4EGSA 1J90A 5K0ZA 5CLFA 1G3RA 5AVEA 4PPQA 2PE5A 3SQMA 3T3OA 4RCVA 1CT9A 3ZE1B 4AXXA 3ANSA 3N2GB 2BMEA 3R74A 5DLPA 3P9ZA 4PLWA 3U61B 1WDTA 4O4LB 3GJ0A 4YAKA 5DCUA 5LJLA 3MLEA 3NTXA 2PMWB 2JGLA 5HZHA 2NG1A 3X1MA 3I5MA 1YL5A 3WWXA 1RRMA 2PMEA 1DAEA 3FGPA 3INRA 2P77A 3QFTA 1NU8A 1R0XA 1OLSA 4RXTA 5AVRA 5T8KA 3W77A 2VLBA 3KJHA 3N7WA 1FTGA 1GSXA 3ZE7A 1JR3E 2CW5A 4YCLA 3BMXA 4TXMA 1RXSA 2AN3A 1JA1A 3WK7A 3TG8A 2JL1A 3UYKA 4AIIA 2B4AA 2P2LA 3CZPA 2CV2A 4OB7A 3G32A 4Y9UA 3AC0A 3GGDA 4X1OA 4LYJA 4QLOA 4JXVA 2NSDA 3WX0A 5TEVA 2Y79A 3EMKA 1R3UA 2NZUG 3SF8A 4HS4A 4ZI5A 4QY5A 1XTRA 5EHXA 1JSXA 1GHPA 3SHTA 4X3PA 1GFZA 3KQYA 1FYDA 3IS2A 1SUPA 1KP3A 4TGLA 5CD1A 3A36A 4P0MA 4TQGA 4YPOA 4QBFA 3GN2A 2HW8A 4MYCA 3V1LA 3KE9A 3DTMA 1NBEA 1COWD 1KAOA 4KL8S 2NU9A 3MUNA 2FMUA 5TLSA 2XUOA 1D6NA 1D04A 4HAWA 1OUMA 1D1TA 2B8TA 3GDWA 1IATA 5DK6A 1YUMA 5JXIA 5B1DA 2WY2D 1N5OX 1DKRA 4P36A 1L1FA 4DXCA 3V2HA 3EPHA 2RC6A 1T1CA 4Z4GA 4IM7A 4LMBA 3LECA 1DWPA 1G9TA 1PBTA 2YC4C 4AI6A 2VDRB 1L4EA 4TPKA 2QL6A 4BQPA 4I6JA 3SYKA 3PNYA 3AONB 4WN3A 5YASA 1WVMA 3ZVNA 3WKAA 1SUEA 3O8CA 4D9HA 2ZRHA 3UMCA 3U60B 3EN0A 2VYND 3PHYA 3G9QA 5G0VA 3WK8A 3JAMA 3L4KA 4NENB 2XOEA 1KRWA 3HV0A 2N75A 1DELA 2AOTA 4GWLA 1DKMA 4GM0A 3K20A 3W0LB 2ORED 3U1BA 1MWUA 4FFDA 3HYCA 1ULAA 1PN3A 1OAAA 3H1TA 4DLNA 3E9QA 2QRMA 4WZBA 1TW2A 2B4RO 4XGIA 4F3CA 2ZT6A 3MMHA 2FN9A 3BD6A 3SF0A 4QWMA 1SEVA 2YFKA 3P20A 1CI8A 4FMCF 2VYFA 4NV0A 2J0SA 2RSLA 3D7RA 2GB4A 3IRVA 3GELA 5FFNA 4AN0A 3PF8A 3A4NA 4TQUS 4HVAA 3PDJA 4Q00A 4B9EA 5F7JA 3G7SA 2F2TA 2VEAA 1XYGA 3EGDA 1RNLA 1HDZA 2IZ1A 4BX2A 4ZOLB 4LGVA 2W6OA 1N25A 4X69A 3GOQA 2TMYA 5JHHB 2RHGB 1DAIA 3E9DA 4FDUA 2PO7A 1FOFA 1UQUA 2BEUB 3WYNA 4ND3A 3ENQA 1EUCB 5JH7F 1V4VA 3AUUA 2C4UA 2HAEA 3FNRA 2FKNA 2JLUA 1I10A 3K9CA 1R5BA 4OHVA 2XMPA 3NBFA 4L5BA 3ZLBA 4CIXA 5I48A 1K4YA 4XOIA 4GYJA 3OI7A 1JXQA 4GX0A 1XFQA 5J5VA 3LQ1A 1O94D 5G3YA 2FUNB 2G9UA 2Z6VA 1YKFA 1NKSA 2EFUA 3N8HA 4OUDB 2P90A 3DTVB 2K7ZA 2W2OA 3BL6A 5EJMA 3W6NA 3BJIC 1AZLA 4MJ3A 1F51E 1PIOA 4HK4A 2NUTB 5IAKA 4RSGA 5E1BA 2FUG1 2ZUBA 1PTKA 3QVSA 4M8LA 3X2SA 2Z1NA 1FDRA 3KAJA 3TD9A 2J33A 1BVYF 4EJ0A 4WXRA 1G8GA 5G0TA 4XIGS 2G9QA 2Q5IA 1DJBA 2ZYAA 4YJ2B 2O06A 3HBLA 1IBSA 3ZU2A 4OAOA 1WA9A 4HH2A 1GL6A 1A5ZA 2WD7A 4AS1A 1G17A 4P83A 1X80B 1P19A 4LRQA 4AQYB 2V0WA 1GPAA 4PYLA 3THXA 3WY9A 1I7PA 1E89A 1VMEA 3WHPA 1G9XA 4A1FA 5DCYA 5EMJA 1G1MA 2GX5A 1E9EA 2FPUA 1F8XA 2ODWA 3WAJA 4C5BA 2HCRA 2E48A 4CEHA 1LU9A 1E3UD 3GEHA 3STHA 3H2JA 1VB6A 1SOVA 4IGIA 3OZRA 2JAQA 5HTKA 1IN5A 4DR1B 3IJ5A 4DV6B 1XVVA 4EI2A 2A9QA 4LOLA 3F74A 4R4RA 2UZ3A 4V0RA 5AK4A 3ZU3A 4XEHA 3LC7O 4NBUA 3DE5X 2O4CA 3LTEA 4NWIA 2N0SA 2VWQA 4GMHA 3RVSA 3GI1A 3H4VA 4EKGA 1N1MA 3EBPA 4UPVA 4ER7A 3ZHTA 4WELA 1E3MA 1EESA 3KL4A 1BD3A 3DMTA 4RVCA 5LDGA 2ZWPA 4LZLA 3AM1A 3L49A 4G9EA 1JTFA 3SH9A 5KYYB 3QNUA 5JT1A 3PC2A 2M6RA 1BWSA 4AKHA 2Z98A 3VH2A 4HXYA 2DSTA 2FUG6 2O2XA 4GUDA 5HK9A 3RW9A 4IX9A 4Y2XA 4X95A 2GO7A 2XLBA 3RWBA 4Y6PA 3IT3A 3ZEAA 5IM5A 2F4VB 4U2KA 4B43A 4UTOA 1XNGA 1E3LA 2B8NA 1JDTA 3WXBA 1R6UA 1X1RA 4RVNA 1JTEA 1GZUA 2FX2A 1GG9A 4RLFA 2H7XA 3TLZA 3QBDA 2GVNA 5DHQA 1FCOA 1Y28A 4BAGA 5I4KA 3H6GA 4C3UA 5ALSA 2BEUA 3TL2A 1Y5IA 3ABSB 4E3OA 1PHRA 2PSFA 1VKOA 1S8NA 4BJ1A 5IC4A 1ID1A 2BLSA 3JQBA 2OGUA 1IL0A 2OFOA 1FFDA 1CRPA 3EUAA 1JWBB 1MAVA 1L3CA 5K6RA 3DFZA 1B6RA 3BFEA 3COSA 4J0DA 3G34A 5EP3A 1E2FA 4BGDA 4W1RA 3CINA 3S2UA 2B5VA 4LA4A 4BTEA 1J25A 1NM5C 2M1XA 2H28A 2SBTA 3MJHA 3GG2A 5MF6A 4YQYA 1EM8B 3PXAA 1Z0ZA 1F20A 4QASA 1MBLA 4N3AA 5I8PA 4LBWA 1IRXA 2H0QA 4LJ9A 5B3JA 4CR8A 3QF4B 4G0PA 1I24A 1HVBA 2C6WB 5DF9A 3ZVLA 5KNDD 4C7KA 2VV8A 2WF7A 2DHCA 3P2YA 4FCCA 4Y1RB 3C2QA 3RV4A 4BBJA 4YJ2A 2QZ4A 5BNTA 3DE6X 5BW8A 4U9UA 3Q7ZA 1TEHA 1J39A 5JANA 1T2UA 3DB2A 1A5SB 5L10A 1X80A 4UVHA 4N9KA 4O01A 5H9WA 4U00A 1M6YA 4HGZA 3V2IA 4MCAA 2QVLA 3KAKA 3A6JA 5L45A 3K0SA 2QRHA 4P3OA 4AZ0B 2A0XA 4EUEA 4DE3A 4NJEB 3T5PA 4JK3A 2REQB 4OOEA 2GPBA 3H5WA 4RQ9A 2R6HA 4G8JA 4EEPA 4ZYUA 1WHTB 3VAYA 1T5OA 3S7OA 1W581 3K71B 4CQJA 4A6DA 2JIZA 4EEZA 1UJMA 4GNRA 5KSOA 1IQ0A 1C7QA 4JYAB 2AD1A 1VTKA 1L4LA 3CVXA 1R0LA 5EZYF 5C8VA 1E98A 4EB0A 3C7UA 4NQZA 4XIYA 2RGDA 2ISSD 3RSHA 5KINB 1Z5UA 3JWGA 5HS4A 2GKSA 4ZIRB 1SPXA 2NVWA 4IAOA 1JIIA 2GNOA 1JUDA 2WWGA 3I01A 3TPFA 4Q39A 3EULA 2HMVA 1ZGJA 4B4VA 3TNFA 1GV1A 4X60A 4C2BA 3N9IA 1Z6FA 3ZN2A 3LVQE 4JLFA 3MM4A 2GLXA 1XA4A 2HDOA 3U48A 2I1VB 3KAPA 3JVDA 4LRXA 4TMXA 2D1QA 4IEEA 4LNUB 4CLOB 2OV1A 2X8AA 1OVMA 3FYSA 3GPLA 4MUYA 1YJ5A 4RQUA 1HDCA 4DIDA 4TN1A 3U7IA 1QZUA 3QBJA 2Y92A 1DLJA 3E2PA 5LZ4A 2PA0A 3IUQA 1Q50A 3M5WA 1YBAA 5IXYA 1C3OB 3EXG1 5EP4A 1FILA 5IU6A 3UUEA 4KVFA 3WLNA 1PS0A 3IQAA 4QQKA 4CL3A 5BY2A 4QJGA 2XNDA 3KLBA 1NY0A 1ZH0A 4A82A 1XVIA 5JHGB 3VMAA 4L9SA 5CAEB 2CDRA 4ZGGA 4HKTA 2HH9A 2IXAA 3FPAA 1Y5RA 2BMDA 1V9ZA 4EB6A 1DHRA 1QFJA 4Q3DA 4MUFA 3QP2A 4YRFA 3IV6A 2AQ8A 5E2BA 3BJZA 1JQJC 5TMBA 5NLLA 2OCLA 4LXTA 3LM8A 4RO0A 2X1VA 2IZ7A 3H18A 2DQSA 2GAJA 2JH8A 1UT8A 1HE2A 1OXKB 3EUEA 3HB5X 5AW4A 3URMA 5C37A 4YN3A 3SSAA 4OXKA 4GPBA 4A8JA 2CWDA 1XJ3A 5JJ5A 3JARA 4L50A 5IXSA 3OUUA 3RBXA 5IVHA 4XYEA 1E3SA 4OJNA 4PS1A 4AKIA 3DTNA 4RPJA 1QUEA 4HEHA 1A2KC 4JJIA 1FLDA 4ZP1A 4XD2A 3EEFA 1DV1A 3H5LA 4NEGA 4B6PA 2OG1A 2P9BA 1D9ZA 1TXGA 2JBHA 3B1ZA 1DL5A 1ISIA 5K05A 3S4YA 4K6HA 4AZVA 1GADO 3R1IA 1L4HA 1VSBA 5AVJA 4C4YA 4OI1A 4QT0A 2ZIGA 5DBFA 3WGNA 3F4LA 1U2GA 3HL9A 1HPLA 3VHRA 3KQUA 2WABA 3WL8A 3O0TA 4HTAA 4ER0A 4H9GA 3I5AA 2Z9DA 1G19A 2R25B 5J1SB 5EJ9A 4A0QA 3TBKA 4CMGA 4DG8A 4LBYA 4J1TC 2QAGC 4EENA 3ANYB 3T4LA 3N6RA 1IEXA 4NJEA 2Q46A 1C0EA 1V1RA 2IYOA 2C4WA 1XT6A 4L9RA 5KO2A 1QYRA 1EVYA 2GN4A 4EHAA 2C5GA 4JJAA 2JI9A 1X0XA 4B45A 1N77A 5KVVA 2CD7A 4MR7B 1BDIA 1NQVA 4AO8A 1CNMA 2JASA 2VEDA 1WF6A 5HWTA 1TS8A 1A2QA 1XVTA 3FETA 1YB6A 2VZ0A 1V41E 3NEYA 1JIVA 4LGYA 4D02A 4MI3A 1EX6A 4BWVA 4LY0A 3UKOA 3HO8A 3EXIB 4YDQA 1NP3A 3ISVA 4D0NA 3QPWA 4J43A 4ZIRA 4J75A 1KFBB 1RXUA 4U8GA 1HR0B 2PWZA 2VJWA 3KSGA 1XPUA 1WXGA 3M4JA 1VMAA 2H1RA 4X71A 2Y2PA 2BF7A 1MAUA 1USVA 2ZR0A 3UENA 5AP9A 3PKJA 4HRXA 2DWQA 2OD2A 4CLOA 4M88A 4E31A 4BFSA 2FHPA 4JC4A 1EIWA 5TPZA 4H6PA 1IWBB 4LC0A 2QZSA 3D3OA 3A14A 3UBMA 3UWKA 1VC2A 3F1PB 4YAOA 4YQEA 1YACA 4ARCA 3NEJA 4LUCA 3RUIA 1QVZA 3NOTC 1ZONA 1P2FA 3OTHA 2PUTA 2RHTA 4UUOA 1DJQA 1X39A 3OQNA 1Y34E 4BO2A 4V02A 2HCTA 1CC1S 2VC2B 3GPIA 2P78A 3LRPA 1Q0HA 1NNI1 3B70A 4RMNA 1BH2A 3W79A 5FA7A 2IYTA 3EQ9A 1KA9H 1XRPA 2W2MA 4ME6A 4FZRA 5JISA