1IYOA

Toho-1 beta-lactamase in complex with cefotaxime
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
260
structure length
260
Chain Sequence
SVQQQLEALEKSSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTAPTLNTAIPGDPRDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQPEQKAERRRDILAAAAKIVTHGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Toho-1 beta-lactamase
publication title Acyl-intermediate Structures of the Extended-spectrum Class A beta -Lactamase, Toho-1, in Complex with Cefotaxime, Cephalothin, and Benzylpenicillin.
pubmed doi rcsb
source organism Escherichia coli
total genus 88
structure length 260
sequence length 260
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2002-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1iyoA00
2FFYA 3PTEA 3Q07A 4BL3A 2Z2MB 1H8YA 4KG6A 1PWCA 3O86A 1NJ4A 2JE5A 3ISGA 4FD8A 5CTMA 3P98A 4GDBA 3V5MA 4LV1A 2IWBA 3ZG0A 2XD5A 4PM5A 2P9VA 2R9XA 2HDUA 3AGEA 5FQJA 4EBNA 2HPBA 4GOGA 4UA9A 1Z6FA 2Y91A 1IYOA 3N8SA 1BULA 1L0EA 1YLWA 5CGSA 5CGWA 3C4OA 3NC8A 4F94A 5FA7A 4H8RA 3HVFA 1M40A 3BFCA 3NDEA 1KGFA 3VOZA 1KGGA 4OOLA 1K55A 3ZG5A 1K55C 1W8QA 1ZKJA 2EX2A 1U60A 3V39A 5M18A 3WS0A 4JF5A 3S1YA 4MBHA 4KG5A 1M6KA 4RVAA 4MLLA 4EBPA 3FZCA 4IVKA 4LV2A 2JC7A 3IXBA 5FQQA 5HL1A 2X02A 4OPRA 4D2OA 4EWFA 1K57A 3OPRA 3BECA 1K57C 4OP5A 3OPHA 2Y2KA 3G32A 5EUAA 3ZNYA 1KE4A 4RA7A 1DJAA 1IYPA 2ZC7A 4WM9A 2HDQA 3E2LA 5JYPA 5A91A 3N8LA 1JTGA 3ZFZA 3UN7A 3IHAA 2Y2PA 4JF4A 1JWVA 1EROA 3EQVA 5CTNA 1IYSA 2Y55A 3V3RA 4E3NA 1SDNA 4Y0OA 4R4SA 2XK1A 3PBOA 3C5AA 3VFFA 3VP3A 4ZJ2A 3ZNTA 2A49A 4OONA 4B4XA 4Y0UA 3BFDA 3S22A 2XF3A 1ESIA 4S2MA 3S4XA 2FFFB 2V2FF 2PU4A 3OC2A 5HAIA 5HAPA 4E3OA 2Y2NA 3GVBA 1SDEA 2ZM2A 4PM6A 5DTTA 5FSRA 3ZDJA 1ES5A 3BRMA 3UNWA 2H10A 3Q1FA 1PIOA 4IBRA 1K25A 1LI0A 4YFMA 1FR1A 3UPPA 1PWGA 2G2WA 2VGJA 3HL9A 4LV0A 3W4PA 1K56D 2UWXA 2DRWA 4X6TA 1KVLA 2C6WB 3GRJA 1W8YA 3NI9A 4RX2A 5EE8A 4Y0TA 2V1ZA 3MXRA 1VM1A 2H5SA 2ZQDA 2HP6A 4DE2A 5HFOA 4U3TA 3G31A 4EQIA 5EVIC 3VP2A 4C75A 4E6WA 3OZHA 5FQKA 4LCMA 4JBFA 4Y7PA 2ZC3B 4Q8IA 3A3IA 3IF6A 2DCFA 3IXHA 2Y2HA 1BLSA 1Q2PA 3N6IA 4R23A 1XP4A 3HLBA 3SH8A 4OQHA 2XFSA 1W79A 4X69A 1SCWA 4OLGA 3HBRA 5GL9A 1N4OA 2H0TA 3IWQA 1NY0A 3G35A 4DF6A 4IEDA 1I5QA 2ZM0A 4OKPA 1RGYA 5GHXA 4JXGA 1QMFA 5CERA 3I7JA 4OOYA 3C7UA 2XFTA 3Q82A 3UPOA 2BLSA 3BLMA 4OPQA 1ZG6A 1K6RA 4XUZA 5EOOA 3Q7VB 2EX9A 1RP5A 1XPBA 4XUXA 5GHZA 1K56A 5A90A 5KSCA 1NYYA 4GN2A 1IELA 4LV3A 4K0WA 4X53A 5EPHA 5EECA 3CMZA 4GD8A 3TG9A 4PM7A 3CG5A 3W4OA 4JXWA 5CXWA 2Q9MA 4A5RA 4HBTA 1IYQA 5DF7A 1PZPA 4WBGA 3UO9A 1HTZA 3ITAA 4KZAA 5FDHA 2WKEA 2Y4AA 3MZEA 2WADA 3WWXA 5J8XA 4K0XA 3M2JA 1ERQA 1O07A 1WYBA 1WE4A 1K4FA 2Q9NA 3QHYA 4R3JA 4WEKA 5GLDA 4E6XA 4EV4A 4X68A 1DY6A 4KZ7A 4QD4A 2Y2GA 1ESUA 4OLDA 1CEGA 4S2JA 4JPMA 4XXRA 3BM6A 4E3LA 3HUNA 3IH9A 3N8RA 5E2HA 1GHPA 3HLDA 4P87A 4ZAMA 4EBLA 2QPNA 1H5XA 2P9VB 4UAAA 2WK0A 1KE0A 2JBFA 3VP0A 2WKHA 3FWLA 3VSKA 3ZHHA 1AXBA 5FQMA 4KZ8A 1MWSA 1IEMA 4DRTA 4WYYA 2GDNA 3UDXA 2EX8A 3SH9A 3UE3A 3O88A 5FAQA 2QZ6A 4N92A 1O7EA 5DF8A 5CGXA 4QB8A 1FOFA 2XDMA 4LENA 1E25A 1XXMA 2XH9A 3GQZA 4CPKA 3GR2A 3G2ZA 3DTMA 3N4IA 1E3UD 1TDLA 5FI2A 5HW3A 1H8ZA 4FH4A 4DE0A 1BLCA 1YLJA 2WGIA 3W4QA 4QU3A 1ES3A 4YINA 2XEPA 1FSWA 1LI9A 3RJUA 3FKVA 4K91A 3VOYA 2G2UA 4B88A 2XGNA 4UA7A 3OCNA 5FAPA 4N9KA 4EUZA 2ZLYA 2WAFA 4RYEA 2C5WB 3GTCA 4OVDA 1NZOA 1ZC2A 2ZM8A 4OOMA 3OPPA 4UA6A 5M19A 5GLCA 4WMCD 4BJPA 4KQRA 1I2SA 3IWIA 1KVMA 3IH8A 3OPLA 2Y2JA 3MFDA 4N1XA 5FQIA 5EVID 1KDSA 2Z2LB 2EX6A 1WYCA 1FR6A 1K38A 1S6RA 3MZDA 4ID4A 2EXAA 2HDRA 3BEBA 3NIAA 5GHYA 4KQQA 1E3UA 3LY4A 4QJGA 1VQQA 1KDWA 5U47A 5D3OA 5I94A 3P09A 1XA1A 3GSGA 5DTSA 1NRFA 3DWZA 3UY6A 1FCNA 4OP8A 3ZGAB 3VP1A 5FQ9A 3UDFA 1CI9A 4R3BA 5A92A 1MWUA 4P6BA 3ZVWA 1MWTA 2P74A 2ZQ7A 1PZOA 1GA9A 1HZOA 3G4PA 4WMCA 3FYZA 4P0MA 4S2PA 1BLHA 4DE1A 1Y54A 1ES2A 5EVIA 4IVIA 3IQAA 2WUQA 5E2FA 4S2LA 5DF9A 3ZVTA 2ZJ9A 1LL5A 1EWZA 3IF6B 1S0WA 2J9OA 2WAEA 3RXXA 4BD0A 4DXCA 1PI4A 4UHUA 4BENA 4C3QA 3UE1A 1I2WA 3RXWA 2OLVA 3MKFA 4ZDXA 4O7DA 3GV9A 1TVFA 5EVLA 5HX9A 3ZG8B 5E2EA 3G2YA 1YMSA 3ZG9B 3WRZA 5KMWA 3FKWA 5G18A 3HLGA 3M6BA 1NZUA 1TEMA 1LHYA 2EXBA 2A3UA 2DNSA 1RCJA 1FQGA 1FCMA 1XX2A 3PBQA 2JCHA 4S2IA 4WZ4A 1Q2QA 1ONHA 5IHVA 1QMEA 2VGKA 2J9PA 3A3EA 1L0GA 2WGWA 3Q81A 2WZXA 4KZ5A 3M6HA 3E2KA 2B5RA 3LEZA 4HESA 3PBNA 1XGIA 3SH7A 3DW0A 1NXYA 4OQ0A 3PAGA 1GA0A 4U0XA 1CK3A 4B4ZA 1OMEA 4BQMA 4GKUA 2WZZA 3SOIA 1K4EA 1YLTA 2EFXA 5FAOA 4KQOA 3WS5A 5HAQA 5M1AA 4CJNA 3IXDA 3PBSA 2Y2QA 2ZQ8A 3LCEA 3M2KA 4KZBA 3V50A 1MWRA 2IWDA 2RL3A 5F82A 4BL2A 3QNCA 3HUMA 1IKGA 1JWPA 2Y2OA 1YQSA 3BYDA 5F1GA 1L0FA 3MZFA 3WS1A 4OH0A 2ZQCA 3NCKA 4WELA 3PBRA 4HEFA 4HBUA 4L0LA 1NYMA 2I72A 4GB7A 5TGFA 3BFGA 5FI6A 4QHCA 5A93A 3TOIA 1FCOA 3ITBA 2ZC4B 5KSHA 1SHVA 2IWCA 1XA7A 1HD8A 4MBKA 1G6AA 3LO7A 2OLUA 1BLPA 4QY5A 1YLYA 1XKZA 2QMIA 2ZC5B 3BFEA 1YMXA 2PU2A 3IT9A 3MKEA 5CECA 3WS4A 5BOHA 1KE3A 1CEFA 2WGVA 4FCFA 4JXVA 1EI5A 4JXSA 3CZDA 4N9LA 3VFHA 4KZ4A 5F1FA 1W7FA 1RGZA 4KZ9A 5GLAA 4KENB 4P85A 2E8IA 2J8YA 4E3JA 2HP9A 3IF5A 1GCEA 3NBLA 4JLFA 2R9WA 5CHMA 1FSYA 5DVAA 4GZBA 4E3MA 4PM9A 5CEBA 3OCLA 1BSGA 2RCXA 3N7WA 4U0TA 1MKIA 3C7VA 3CJMA 4FSFA 3O87A 3IWOA 1BUEA 3NY4A 3UPNA 2XR0A 3VP4A 1E4DA 3HLWA 3HREA 1PWDA 5DTKA 2HDSA 1BT5A 3Q7ZA 4ZJ1A 2HP5A 4M3KA 4NETA 5TR7A 3SS4A 3EQUA 3WRTA 3HUOA 3PAEA 4RX3A 1DJBA 4Z9QA 1BTLA 3BFFA 1ALQA 2PBYA 1YM1A 4IBXA 4N1HA 4OPZA 1KGEA 3MBZA 5AQ7A 3VSLA 4BD1A 1JWZA 4X56A 5TFQA 4MEZA 3A3JA 1GHMA 2WYXA 1ERMA 3WS2A 3DWKA 1W5DA 3ZCZA 3HLCA 3IHBA 2H0YA 3MXSA 4E3KA 1IKIA 2V20A 3G30A 4PM8A 1YLZA 3O3VA 3PBTA 1L0DA 1ZG4A 4MNRA 3FV7A 1DJCA 4OQIA 4S2KA 3UE0A 4NK3A 1C3BA 1JVJA 4ZTKA 1PW1A 4S2NA 3HLEA 5E43A 1BZAA 4S2NC 5F83A 2WKIA 3B3XA 5CHUA 4MBFA 5EVIB 1ES4A 4GNUA 4PPRA 3IXGA 1MY8A 4X55A 3QNBA 3LY3A 4R0QA 1YT4A 1JTDA 4C6YA 2Y2IA 1TDGA 5AQ9A 4OQGA 2CC1A 2Y2MA 3SS3A 2XD1A 1PI5A 2ZC6B 3TSGA 4R4RA 3D4FA 3AGDA 4DXBA 5E2GA 4WZ5A 4GDNA 4WZ5C 2BG1A 4FH2A 5AQAA 1LL9A 3ZG7B 3G34A 2OV5A 3IF6C 4QY6A 3A3FA 1L2SA 5EOEA 2EFUA 4DE3A 1LLBA 1MBLA 1XGJA 5KZHA 1K6SA 3HLFA 3JYIA 1GHIA 2ZQ9A 1ONGA 4S2OA 5GLBA 3Q7VA 4OPYA 2WGWB 2X71A 4KZ3A 4BLMA 4DDSA 2J7VA 2XQZA 2Y2LA 3BLSA 5CRFA 4DDYA 5L2FA 2OSUA 2X01A 4DKIA 1HVBA 4PMAA 4ZJ3A 5AQBA 4LCLA 4WEJA 3V3SA 2XLNA 1K54A 3C4PA 5HARA 5FATA 1K54C 1MXOA 4JF6A 5FASA 1YLPA 1CI8A 3NDGA 3AGFA 1N9BA 2ZQAA 1SKFA 5CHJA 3UDIA 2ZMAA 4KG2A 4JKTA 4GD6A 5JYOA 4KZ6A 3A3DA 5FI7A 1PYYA 1J9MA 5CEDA 4R1GA 3W8KA 2Y59A 4E3IA 3SS5A 4ZBEA 3VMAA 1PW8A 3GMWA 1MPLA 1G68A 2ZD8A
chains in the Genus database with same CATH superfamily
3H7WB 2FFYA 2Z2MB 1H8YA 5CTMA 4LV1A 3ZG0A 3T50A 2Y91A 3QP4A 5CGWA 4R38A 3C4OA 3NC8A 3HVFA 2PR5A 5TBMB 1M40A 5F6AA 3VOZA 5HD3A 4JF5A 3S1YA 1V9YA 2GX5A 1YPRA 3FZCA 1XJ2A 5L09A 1P97A 4D2OA 2KX6A 4EWFA 3OPRA 3G32A 5EUAA 2W3DA 4UQIS 2HDQA 5C5KA 5A91A 4M4XA 3IHAA 5CTNA 1EROA 1IYSA 2Y55A 3V3RA 1ZTUA 4R4SA 3C5AA 5FDSA 4JGQA 3VP3A 2A49A 2K31A 2W3GA 3F1PA 2J3WA 3K3DA 4B4XA 4FUWA 3BFDA 5DKLA 4Y3IA 1ESIA 5HAIA 5HAPA 2Y2NA 4HIAA 5HDCA 2ZM2A 4PM6A 3ZDJA 1YKDA 2H10A 4IBRA 3LIFA 1LI0A 4YFMA 4NXFA 4LV0A 2UWXA 3DBAA 2L1MA 4X6TA 2C6WB 3GRJA 3NI9A 2V1ZA 3QP6A 3VV4A 4EQIA 3VP2A 3SH8A 4OQHA 1YSQA 3QP8A 3HBRA 5GL9A 1N4OA 2LB5A 4DF6A 1I5QA 5A8BA 3BY8A 2BLSA 1K6RA 2VEAA 3Q7VB 1RP5A 1XPBA 4MN5A 1NYYA 4GN2A 2O9AA 2VV7A 5EPHA 3TG9A 3CMZA 4JXWA 5CXWA 5L8MA 1IYQA 1PZPA 3MS6A 5AVEA 4WBGA 1D1JA 3BJNA 2WKEA 3WWXA 4CLCC 5J8XA 1ERQA 1WYBA 5GLDA 4D60A 2W3EA 3E4QA 4EERA 3BM6A 3HUNA 1GHPA 3HLDA 4Z1WA 5HWWA 1H5XA 3PHYA 1KE0A 3VP0A 2WKHA 3ZHHA 2V9AA 1AXBA 2XSSA 4HI4A 1IEMA 3R7WB 4PHTA 2EX8A 5HSQA 2QZ6A 1ODVA 1O7EA 1WA9A 4QB8A 4LPZA 4LENA 1E25A 2XH9A 4CPKA 4YNRA 1XJ3A 2Z6DA 4HJ4A 1TDLA 5HW3A 4FH4A 2WKQA 1BLCA 1YLJA 2WGIA 4DE0A 4QU3A 4XT2A 3P01A 3RJUA 3IS2B 2G2UA 2XGNA 5FAPA 4EUZA 2JKRI 1VETB 2O99A 2C5WB 4OVDA 2ZM8A 3IBRA 3OPPA 4UA6A 4KQRA 2Y2JA 5EVID 1MZUA 2EX6A 2NUTC 2HDRA 4Y13A 1XFNA 5MC7A 5I94A 3P09A 5DTSA 1UGUA 1LSWA 5J3WA 2YKHA 4MCWA 5FQ9A 3TJZC 1EW0A 1GA9A 1T19A 5F68A 4P0MA 4S2PA 4DE1A 2W27A 3D72A 5EM0A 4EEPA 5DF9A 3E4OA 4LGWA 2ZJ9A 1LL5A 3V67A 2J9OA 4C3QA 1S4RA 1LSVA 3UE1A 4AFIA 4Y2FA 1TVFA 5EVLA 5E2EA 2JN7A 5G18A 2WKPA 3M6BA 1TEMA 2EXBA 2A3UA 4WZ4A 3PBQA 1ONHA 3T1SA 1OTEA 1L0GA 3T4KA 1F5MA 1XGIA 3DTIA 4FTXA 3E4PA 3SOIA 1YLTA 5M1AA 4CJNA 1K0KA 2ZQ8A 3LCEA 2Y8HA 1JWPA 5F1GA 3H7WA 3NCKA 2VGLS 4HEFA 5FEGA 1S66L 4L0LA 2I72A 2L0WA 2PDRA 2JKRM 5A93A 1TF1A 4LRZE 4BMWA 2IWCA 1XA7A 2EWVA 1LL8A 4MBKA 1ZHHB 3BQAA 5TBMA 1YLYA 2QMIA 2ZC5B 3NULA 5BOHA 2WGVA 4JXVA 3VE4A 3NOTC 3VFHA 5FL3A 3U2AA 2PYPA 2VLGA 1H8MA 2OAQ1 3IX3A 5HZHA 5CHMA 2GJ3A 4WLAA 4PM9A 2RCXA 3N7WA 1MKIA 3C7VA 3UE6A 1BUEA 3TW8A 3UPNA 3LEQA 2HDSA 4ZJ1A 3SS4A 4Z9QA 1DJBA 4G3VA 3BFFA 2PBYA 4IBXA 4N1HA 3MBZA 3UMEA 4Y15A 3A3JA 3DWKA 3LGOA 3HLCA 3IHBA 4EUVA 5HWTA 1DP8A 3G30A 4PM8A 3PBTA 2XROA 1DJCA 4OQIA 4ZTKA 3T4OA 1BZAA 3A0SA 4NXGA 5EVIB 4PPRA 3IXGA 3QNBA 2GZAA 4C6YA 3QP1A 1OTBA 1OJ5A 3S7NA 3SS3A 1PI5A 4R4RA 5E2GA 2L4RA 1P9RA 3ZG7B 4ARZB 5EOEA 1MC0A 3HLFA 1GHIA 5HDSA 5GLBA 3Q7VA 2WGWB 2XQZA 5CRFA 5L2FA 2X01A 1KOUA 3LUQA 1OT6A 5HARA 3C4PA 5FEFA 5AJGA 1K54C 3FG8A 4JF6A 5DJUA 2VA0A 2GNXA 3E0YA 2ZMAA 3B33A 4KZ6A 3UMDA 2Y59A 3SS5A 3VMAA 3B42A 4Y0OA 3DTMA 1MPLA 2W3HA 3Q07A 4BL3A 5HD5A 1NJ4A 3ISGA 4PM5A 2R9XA 3G6OA 4UA9A 1BULA 4QWOA 4PKYA 3R7WA 4PKYG 3NDEA 1KGFA 2PAVP 2KDKA 2QYBA 1W8QA 4Q0JA 2EX2A 5M18A 4MBHA 2NUPC 3PR6A 1M6KA 4RVAA 2P04A 4IVKA 5HL1A 4OPRA 4R70A 3IS2A 1K57A 2QJ7A 2D01A 1VETA 2Y2KA 1KE4A 2YKFA 2HJEA 2ZC7A 4ETZA 1UWNX 4K08A 3ZFZA 5LBRA 1JWVA 3EQVA 1SDNA 3PBOA 2KLIA 2WKRA 4BWIA 4OONA 4B9OA 3S7QA 5L07A 3S22A 4S2MA 1LT0A 2PU4A 4E3OA 3GVBA 1SDEA 5FSRA 4WF0A 3VOLA 4CLCE 3W4PA 1K56D 3LFVA 2ZMVA 4NEED 4RX2A 1VM1A 4DE2A 4G3KA 4U3TA 3G31A 5EVIC 4O01A 5FQKA 3B47A 4LCMA 4Y7PA 2ZC3B 1BLSA 3CUEA 3MFXA 2XFSA 4X69A 3T4SA 4OKPA 5GHXA 5CERA 1S1ZA 3C7UA 3Q82A 2JHEA 3BY9A 1P0ZA 4OPQA 5EOOA 4XUXA 5A90A 5KSCA 3NOPC 4X53A 5EECA 3SW1A 4A5RA 4HBTA 3KO6A 3MXQA 4HP4A 3UO9A 3MZEA 2WADA 3NJAA 3QHYA 2Q9NA 4E6XA 1K4FA 4GS9B 5TJJA 1DY6A 4QD4A 2Y2GA 2VX8A 2E8JA 4S2JA 3N8RA 4P87A 2XA7M 4ZAMA 4EBLA 4UAAA 3VSKA 1S4SA 3EGDC 4WYYA 2GDNA 3SH9A 3O88A 5FAQA 3VE3A 3IBJA 1FOFA 1XXMA 1LSXA 3MF0A 3GR2A 3G2ZA 1GSVA 3LR4A 4Y17A 1E3UD 5G4YA 5EFWA 5FI2A 1ES3A 2XEPA 1FSWA 1LI9A 3CPTB 3FKVA 1AWIA 3ULFA 1A0KA 4DJ2A 4RYEA 1NZOA 5M19A 3NOUC 4JGPA 3IH8A 3MFDA 2P08A 1S6RA 1STZA 2EXAA 3JVVA 1X0OA 3FC7A 1H3QA 1VQQA 2K7SA 3GSGA 3DWZA 3UY6A 4NG2A 2CMNA 3UDFA 5A92A 4P6BA 1VHMA 2ZQ7A 4X25A 1HZOA 1TD5A 3C30A 3FYZA 3OBFA 1IOUA 5EVIA 3IQAA 2VK3A 3RTYA 1EWZA 4GCZA 3IF6B 2WAEA 4DXCA 4BD0A 2W1RA 1I2WA 4GLQA 4ZDXA 2H28A 4O7DA 3ZG8B 3ZG9B 3WRZA 2PHYA 4ARZA 1LHYA 3KSGA 3D9YA 2JCHA 1Q2QA 5IHVA 2VGKA 2WGWA 3Q81A 4KZ5A 3M6HA 3UB8A 3E2KA 4NXBA 3LR3A 2V8FA 1GA0A 1CK3A 4LRYC 4BQMA 1OMEA 2EFXA 5HAQA 2O9BA 2V0UA 3V50A 2RL3A 1YSPA 4BL2A 3MZFA 2ZQCA 5G4ZA 1NYMA 4GB7A 3JVUA 5FI6A 1GSXA 3MR0A 1N9OA 1FCOA 2ZC4B 1TS6A 3LO7A 1BLPA 4QY5A 1G5UA 2PU2A 3IT9A 5CECA 1CEFA 5EVEA 4N9LA 4KZ4A 1W7FA 3MQQA 1RGZA 4P85A 1GCEA 2R9WA 1FSYA 1T1CA 3C38A 5DVAA 3OCLA 3CJMA 4IJGA 1BYWA 3O87A 4ETXA 2XR0A 3VP4A 2V1BA 3HREA 3MQOA 5DTKA 4EQ1A 4BBUA 3Q7ZA 4M3KA 4NETA 3EQUA 3WRTA 3EEAA 2PT7A 4LLOB 1ALQA 4OPZA 1KGEA 3CITA 5TFQA 4MEZA 1ERMA 1W5DA 2H0YA 2OAP1 2PRFA 3O3VA 1ZG4A 1V9ZA 2BASA 4MNRA 1JVJA 1PW1A 4S2NA 3TRCA 4GNUA 2FZ0A 4X55A 4WN5A 3KSFA 1YT4A 1JTDA 1SKOB 2Y2IA 4CQHA 2XD1A 4DJ3A 3D4FA 3R4KA 1Y28A 4FH2A 5AQAA 1LL9A 3IF6C 2HZ5A 1FILA 2V8CA 1T1BA 4OPYA 2X71A 2J7VA 3BLSA 2OSUA 5EV0A 1HVBA 4WEJA 3V3SA 3K2NA 2O9CA 3NDGA 1J3WA 3UDIA 4KG2A 1J9MA 1VB6A 5CEDA 4R1GA 3W8KA 3LIEA 4GS9A 4E3IA 4ZBEA 1PW8A 1G68A 1TS8A 3PTEA 4KG6A 1PWCA 3O86A 3NECA 3V5MA 3P98A 4GDBA 1PFLA 5IS1A 2XD5A 4EBNA 2HDUA 2OWHA 4GOGA 1IYOA 1L0EA 1YLWA 5CGSA 2M1CA 4F94A 4MN6A 2Z6CA 3BWLA 3CHWP 1L3LA 3BFCA 2Y79A 1N9LA 1K55A 4R3AA 1ZKJA 2QJ5A 3WS0A 4WUJA 4KG5A 2VGLM 4MLLA 4EBPA 4LV2A 2JC7A 3E98A 2X02A 3CPTA 4HQAA 1K57C 4OP5A 1DJAA 4WM9A 4WL9A 2Y2PA 4E3NA 3F1NB 2XK1A 4ZJ2A 3ZNTA 1S67L 2J80A 1HLUP 2XF3A 3S4XA 4YOFA 3CWFA 5DTTA 1ES5A 3BRMA 4MDZA 1D06A 1PWGA 3HL9A 2DRWA 1KVLA 4Y0TA 1CJFA 1W8YA 5EE8A 3MXRA 2HP6A 4JGRA 4I3AA 4Q8IA 3IF6A 2DCFA 3IXHA 2Y2HA 3N6IA 1XP4A 3CUEC 3T1QB 1OPXA 1W79A 3D3OA 1Z09A 3IWQA 2H0TA 5HL6A 4CLCD 2JKGA 2ZL1B 4IEDA 2ZM0A 3RFBA 4HNBA 4JXGA 4OOYA 2XFTA 3UPOA 4XUZA 5GHZA 1K56A 2PR6A 3SZTA 2V0WA 3C2WA 1IELA 4LFUA 4LV3A 4GD8A 4PM7A 5DFYA 4BBVA 3BQ8A 3CG5A 3W4OA 2Q9MA 4F3LB 3NHQA 1W63Q 4KZAA 2Y4AA 2B02A 4R3JA 4EV4A 4X68A 3U4LP 3OLOA 5J4EA 3RH8B 2HF6A 1ESUA 4HH3A 4OLDA 1CEGA 4E3LA 4XXRA 3IH9A 5E2HA 3IX4A 2P9VB 1VEUB 3FPVA 1NRJA 3FWLA 1DP6A 4E04A 4KZ8A 1MWSA 4II7A 2ZOHA 3A0VA 3UDXA 4N92A 4RQ9A 5CGXA 2MJ6A 3QP5A 3OOVA 4HOIA 5KIZA 2PBDP 1H8ZA 4YWZA 2VV8A 3T1RA 3VOYA 4B88A 2WAFA 5I5LA 1OTDA 1ZC2A 5J7EA 3T12B 4O0PA 5GLCA 4WMCD 2ACGA 3IWIA 1NLYA 1KVMA 2JKFA 3OPLA 5K5BA 1N9NA 1KDSA 2Z2LB 1WYCA 3MZDA 3PYPA 2G7UA 3NIAA 4ZRRA 3T4TA 5GHYA 4KQQA 1E3UA 5DFXA 4I5SA 1G6OA 3LY4A 3HJIA 5U47A 5D3OA 4P6ZM 4OP8A 2J3TD 3W2ZA 4ESPA 2HJ9C 1CI9A 1MWUA 3ZVWA 3G4PA 4NKPA 1DP9A 1Y54A 3CAXA 5HPFA 4IVIA 5E2FA 3MSHA 1SKOA 3ZVTA 3QP2A 1S0WA 1F98A 4I39A 1XJ4A 4HJ3A 3RXWA 2OLVA 2FH5A 3GV9A 5HX9A 3P7NA 1YMSA 5KMWA 2EA9A 3FKWA 1NZUA 2DNSA 1RCJA 1FQGA 4S2IA 4I3JA 1QMEA 2J9PA 3A3EA 4I3IA 2WZXA 3F1OB 2AVXA 2B5RA 4KUOA 1JNUA 2W1TB 3DW0A 2BTFP 4OQ0A 3PAGA 4U0XA 4B4ZA 2WZZA 2XA7S 2P7JA 4G3WA 2LB9A 1K4EA 4CLCB 5FAOA 4HJ6A 3WS5A 3IXDA 3PBSA 2Y2QA 1MWRA 5F82A 2PD8A 3QNCA 2Y2OA 1L0FA 2QHKA 4B93A 4WELA 1IFQA 4HBUA 2ZBBA 4HH2A 4QHCA 3TOIA 5KSHA 1SHVA 1HD8A 4LRXC 1G6AA 2OLUA 3LI8A 1XKZA 3MKEA 3WS4A 4GHIB 1KE3A 4FCFA 1EI5A 2ZMFA 5F1FA 1W63M 1DRMA 4KENB 4EXOA 4E3JA 2HP9A 5AVFA 4JLFA 4O8GA 4U0TA 4X1LA 1OTIA 3HLWA 3HJKA 3CLOA 2A2LA 1YM1A 3VSLA 1JWZA 4X56A 3F1NA 2WYXA 3ZCZA 4UQIM 1CF0A 3EOIA 2V20A 2QWSA 1MKMA 4GJ4A 4H6JB 4S2NC 3B3XA 5CHUA 1ES4A 4KUKA 5AQ9A 4PAUA 2ZC6B 3TSGA 4DXBA 3LI9A 4WZ5A 2BG1A 2OV5A 2ZL1A 3A3FA 3PXPA 4DE3A 2EFUA 1LLBA 1MBLA 1XGJA 4NXEA 2DMWA 2ZQ9A 1ONGA 5IT5A 1YAXA 4DDSA 4EW7A 4DDYA 3EWKA 5AQBA 4LCLA 1XFQA 4Q0IA 4F3LA 1G28A 1MXOA 1YLPA 3AGFA 1N9BA 2ZQAA 1SKFA 5CX7A 3CI6A 3LICA 4GD6A 3A3DA 4GW9A 3GMWA 2ZD8A 2M7UA 3LR5A 2JE5A 1UWPX 4FD8A 3DAVA 3A0RA 2IWBA 2P9VA 1VEUA 3AGEA 5FQJA 1XJ6A 2HPBA 1Z6FA 3N8SA 5FA7A 4H8RA 3T1XA 1KGGA 4OOLA 3ZG5A 1K55C 3GDIA 1TS0A 1U60A 3V39A 2JKTI 4HP9A 3UB6A 3EGXC 3IXBA 5FQQA 1T18A 3C8CA 3BECA 3OPHA 3ZNYA 3HCYA 4RA7A 1IYPA 1GSWA 3E2LA 5JYPA 3N8LA 1JTGA 3UN7A 4JF4A 3H82B 3DTKA 2O0YA 3VFFA 4Y0UA 2FFFB 2V2FF 3OC2A 4ME4A 1H0MA 2PYRA 3UNWA 2A24B 3Q1FA 1PIOA 1K25A 1FR1A 3UPPA 2G2WA 2VGJA 3LIAA 3T4LA 2H5SA 2ZQDA 5HFOA 4C75A 4E6WA 3OZHA 4JBFA 3A3IA 4R23A 1Q2PA 3HLBA 1SCWA 4OLGA 3H9WA 1NY0A 3G35A 3MMHA 2K2NA 1RGYA 1QMFA 3I7JA 3BLMA 1Y4OA 1ZG6A 2J3TC 2EX9A 3DTEA 3UB9A 1F9IA 3F1OA 4IUKA 4K0WA 2ZOIA 4BBTA 4MN7A 2W1TA 5F5YA 5EM1A 2B95A 5DF7A 1HTZA 3ITAA 5FDHA 4CLCA 4K0XA 3M2JA 1O07A 1TS7A 1WE4A 4WEKA 4UEYA 4KZ7A 2D02A 2JKTM 2INWA 4JPMA 4IUHA 2QPNA 2WK0A 2JBFA 3LIDA 3TE8A 5FQMA 3LIBA 1SZVA 4DRTA 2QKPA 3T4JA 3EEHA 3UE3A 3JPUA 5DF8A 3L7HA 1D7EA 2XDMA 3GQZA 1FIKA 4GHIA 3FPWA 3N4IA 4MMNA 3W4QA 4YINA 1ACFA 4K91A 4UA7A 3OCNA 4N9KA 2ZLYA 2Q0OA 3GTCA 4OOMA 4BJPA 5FQIA 1I2SA 4N1XA 3S7PA 2VKSA 1FR6A 1K38A 4ID4A 3T4QA 3BEBA 3L9KA 5F69A 4QJGA 1KDWA 3F1PB 1XA1A 5HDDA 1NRFA 1FCNA 3K3CA 3ZGAB 3VP1A 4R3BA 1MWTA 2P74A 1PZOA 4WMCA 1BLHA 4H6JA 1ES2A 2WUQA 4DMZA 4S2LA 4HHDA 2PD7A 2VJWA 3KYQA 3KSHA 2VV6A 3RXXA 1P9WA 1PI4A 4UHUA 4BENA 2IA2A 2VZWA 3IX8A 2R78A 3MKFA 3G2YA 4L9FA 2M7VA 3HLGA 4EETB 2B18A 1FCMA 1XX2A 4R6LA 4I38A 2XRNA 5DJTA 3LEZA 4HESA 3PBNA 3SH7A 4Y5FA 1OT9A 1NXYA 3UB7A 5L10A 4GKUA 2UV0E 3ZYTA 4KQOA 3M2KA 4KZBA 2IWDA 4EU0A 4L9EA 3HUMA 1IKGA 3BYDA 1YQSA 1OJGA 3WS1A 4OH0A 3PBRA 3KYEA 5TGFA 3BFGA 4FOFA 3ITBA 2OWJA 4EESA 1NWZA 3BFEA 1YMXA 3MQ0A 4JXSA 3CZDA 2HV1A 3O5YA 4KQDA 4KZ9A 5GLAA 5HWVA 4XT2B 2E8IA 2I9VA 2J8YA 2V1AA 3MJQA 3IF5A 3NBLA 4GZBA 4E3MA 3GECA 4X1MA 5CEBA 1BSGA 4FSFA 3IWOA 3BW6A 3NY4A 1E4DA 4HY8A 4EEUA 4L9GA 1PWDA 1BT5A 4P6ZS 2HGVA 2HP5A 5TR7A 3HUOA 4RX3A 3KX0X 3PAEA 1BTLA 3ZQ5A 1NLZA 5HPIA 5AQ7A 4BD1A 3KSIA 1GHMA 3H82A 3WS2A 4DN0A 3MXSA 4E3KA 1IKIA 1T1AA 1YLZA 1L0DA 5DKKA 3FV7A 3ICYA 4S2KA 3UE0A 4NK3A 2A24A 1C3BA 3KYZA 3HLEA 5E43A 5F83A 2WKIA 4MBFA 1MY8A 3LYXA 3LY3A 4R0QA 1TDGA 5IU1A 4OQGA 2CC1A 2W0NA 2Y2MA 1PRQA 4JGOA 3AGDA 2W3FA 4GDNA 4WZ5C 3G34A 3S7OA 4QY6A 1L2SA 5KZHA 1K6SA 4IHQA 3JYIA 4S2OA 4KZ3A 4BLMA 2Y2LA 4DKIA 4PMAA 1S1YA 4ZJ3A 4Q0HA 4QPRA 1K54A 2XLNA 2EWWA 1PNEA 5FATA 1OTAA 2KOIA 5FASA 1CI8A 5CHJA 3LR0A 4JKTA 5JYOA 5FI7A 1PYYA 3UB5P 1CQAA 1F2KA 2OOLA
chains in the Genus database with same CATH topology
2FFYA 3PTEA 3Q07A 4BL3A 2Z2MB 1H8YA 4KG6A 1PWCA 3O86A 1NJ4A 2JE5A 3ISGA 4FD8A 5CTMA 3P98A 4GDBA 3V5MA 4LV1A 2IWBA 3ZG0A 2XD5A 4PM5A 2P9VA 2R9XA 2HDUA 3AGEA 5FQJA 4EBNA 2HPBA 4GOGA 4UA9A 1Z6FA 2Y91A 1IYOA 3N8SA 1BULA 1L0EA 1YLWA 5CGSA 5CGWA 3C4OA 3NC8A 4F94A 5FA7A 4H8RA 3HVFA 1M40A 3BFCA 3NDEA 1KGFA 3VOZA 1KGGA 4OOLA 1K55A 3ZG5A 1K55C 1W8QA 1ZKJA 2EX2A 1U60A 3V39A 5M18A 3WS0A 4JF5A 3S1YA 4MBHA 4KG5A 1M6KA 4RVAA 4MLLA 4EBPA 3FZCA 4IVKA 4LV2A 2JC7A 3IXBA 5FQQA 5HL1A 2X02A 4OPRA 4D2OA 4EWFA 1K57A 3OPRA 3BECA 1K57C 4OP5A 3OPHA 2Y2KA 3G32A 5EUAA 3ZNYA 1KE4A 4RA7A 1DJAA 1IYPA 2ZC7A 4WM9A 2HDQA 3E2LA 5JYPA 5A91A 3N8LA 1JTGA 3ZFZA 3UN7A 3IHAA 2Y2PA 4JF4A 1JWVA 1EROA 3EQVA 5CTNA 1IYSA 2Y55A 3V3RA 4E3NA 1SDNA 4Y0OA 4R4SA 2XK1A 3PBOA 3C5AA 3VFFA 3VP3A 4ZJ2A 3ZNTA 2A49A 4OONA 4B4XA 4Y0UA 3BFDA 3S22A 2XF3A 1ESIA 4S2MA 3S4XA 2FFFB 2V2FF 2PU4A 3OC2A 5HAIA 5HAPA 4E3OA 2Y2NA 3GVBA 1SDEA 2ZM2A 4PM6A 5DTTA 5FSRA 3ZDJA 1ES5A 3BRMA 3UNWA 2H10A 3Q1FA 1PIOA 4IBRA 1K25A 1LI0A 4YFMA 1FR1A 3UPPA 1PWGA 2G2WA 2VGJA 3HL9A 4LV0A 3W4PA 1K56D 2UWXA 2DRWA 4X6TA 1KVLA 2C6WB 3GRJA 1W8YA 3NI9A 4RX2A 5EE8A 4Y0TA 2V1ZA 3MXRA 1VM1A 2H5SA 2ZQDA 2HP6A 4DE2A 5HFOA 4U3TA 3G31A 4EQIA 5EVIC 3VP2A 4C75A 4E6WA 3OZHA 5FQKA 4LCMA 4JBFA 4Y7PA 2ZC3B 4Q8IA 3A3IA 3IF6A 2DCFA 3IXHA 2Y2HA 1BLSA 1Q2PA 3N6IA 4R23A 1XP4A 3HLBA 3SH8A 4OQHA 2XFSA 1W79A 4X69A 1SCWA 4OLGA 3HBRA 5GL9A 1N4OA 2H0TA 3IWQA 1NY0A 3G35A 4DF6A 4IEDA 1I5QA 2ZM0A 4OKPA 1RGYA 5GHXA 4JXGA 1QMFA 5CERA 3I7JA 4OOYA 3C7UA 2XFTA 3Q82A 3UPOA 2BLSA 3BLMA 4OPQA 1ZG6A 1K6RA 4XUZA 5EOOA 3Q7VB 2EX9A 1RP5A 1XPBA 4XUXA 5GHZA 1K56A 5A90A 5KSCA 1NYYA 4GN2A 1IELA 4LV3A 4K0WA 4X53A 5EPHA 5EECA 3CMZA 4GD8A 3TG9A 4PM7A 3CG5A 3W4OA 4JXWA 5CXWA 2Q9MA 4A5RA 4HBTA 1IYQA 5DF7A 1PZPA 4WBGA 3UO9A 1HTZA 3ITAA 4KZAA 5FDHA 2WKEA 2Y4AA 3MZEA 2WADA 3WWXA 5J8XA 4K0XA 3M2JA 1ERQA 1O07A 1WYBA 1WE4A 1K4FA 2Q9NA 3QHYA 4R3JA 4WEKA 5GLDA 4E6XA 4EV4A 4X68A 1DY6A 4KZ7A 4QD4A 2Y2GA 1ESUA 4OLDA 1CEGA 4S2JA 4JPMA 4XXRA 3BM6A 4E3LA 3HUNA 3IH9A 3N8RA 5E2HA 1GHPA 3HLDA 4P87A 4ZAMA 4EBLA 2QPNA 1H5XA 2P9VB 4UAAA 2WK0A 1KE0A 2JBFA 3VP0A 2WKHA 3FWLA 3VSKA 3ZHHA 1AXBA 5FQMA 4KZ8A 1MWSA 1IEMA 4DRTA 4WYYA 2GDNA 3UDXA 2EX8A 3SH9A 3UE3A 3O88A 5FAQA 2QZ6A 4N92A 1O7EA 5DF8A 5CGXA 4QB8A 1FOFA 2XDMA 4LENA 1E25A 1XXMA 2XH9A 3GQZA 4CPKA 3GR2A 3G2ZA 3DTMA 3N4IA 1E3UD 1TDLA 5FI2A 5HW3A 1H8ZA 4FH4A 4DE0A 1BLCA 1YLJA 2WGIA 3W4QA 4QU3A 1ES3A 4YINA 2XEPA 1FSWA 1LI9A 3RJUA 3FKVA 4K91A 3VOYA 2G2UA 4B88A 2XGNA 4UA7A 3OCNA 5FAPA 4N9KA 4EUZA 2ZLYA 2WAFA 4RYEA 2C5WB 3GTCA 4OVDA 1NZOA 1ZC2A 2ZM8A 4OOMA 3OPPA 4UA6A 5M19A 5GLCA 4WMCD 4BJPA 4KQRA 1I2SA 3IWIA 1KVMA 3IH8A 3OPLA 2Y2JA 3MFDA 4N1XA 5FQIA 5EVID 1KDSA 2Z2LB 2EX6A 1WYCA 1FR6A 1K38A 1S6RA 3MZDA 4ID4A 2EXAA 2HDRA 3BEBA 3NIAA 5GHYA 4KQQA 1E3UA 3LY4A 4QJGA 1VQQA 1KDWA 5U47A 5D3OA 5I94A 3P09A 1XA1A 3GSGA 5DTSA 1NRFA 3DWZA 3UY6A 1FCNA 4OP8A 3ZGAB 3VP1A 5FQ9A 3UDFA 1CI9A 4R3BA 5A92A 1MWUA 4P6BA 3ZVWA 1MWTA 2P74A 2ZQ7A 1PZOA 1GA9A 1HZOA 3G4PA 4WMCA 3FYZA 4P0MA 4S2PA 1BLHA 4DE1A 1Y54A 1ES2A 5EVIA 4IVIA 3IQAA 2WUQA 5E2FA 4S2LA 5DF9A 3ZVTA 2ZJ9A 1LL5A 1EWZA 3IF6B 1S0WA 2J9OA 2WAEA 3RXXA 4BD0A 4DXCA 1PI4A 4UHUA 4BENA 4C3QA 3UE1A 1I2WA 3RXWA 2OLVA 3MKFA 4ZDXA 4O7DA 3GV9A 1TVFA 5EVLA 5HX9A 3ZG8B 5E2EA 3G2YA 1YMSA 3ZG9B 3WRZA 5KMWA 3FKWA 5G18A 3HLGA 3M6BA 1NZUA 1TEMA 1LHYA 2EXBA 2A3UA 2DNSA 1RCJA 1FQGA 1FCMA 1XX2A 3PBQA 2JCHA 4S2IA 4WZ4A 1Q2QA 1ONHA 5IHVA 1QMEA 2VGKA 2J9PA 3A3EA 1L0GA 2WGWA 3Q81A 2WZXA 4KZ5A 3M6HA 3E2KA 2B5RA 3LEZA 4HESA 3PBNA 1XGIA 3SH7A 3DW0A 1NXYA 4OQ0A 3PAGA 1GA0A 4U0XA 1CK3A 4B4ZA 1OMEA 4BQMA 4GKUA 2WZZA 3SOIA 1K4EA 1YLTA 2EFXA 5FAOA 4KQOA 3WS5A 5HAQA 5M1AA 4CJNA 3IXDA 3PBSA 2Y2QA 2ZQ8A 3LCEA 3M2KA 4KZBA 3V50A 1MWRA 2IWDA 2RL3A 5F82A 4BL2A 3QNCA 3HUMA 1IKGA 1JWPA 2Y2OA 1YQSA 3BYDA 5F1GA 1L0FA 3MZFA 3WS1A 4OH0A 2ZQCA 3NCKA 4WELA 3PBRA 4HEFA 4HBUA 4L0LA 1NYMA 2I72A 4GB7A 5TGFA 3BFGA 5FI6A 4QHCA 5A93A 3TOIA 1FCOA 3ITBA 2ZC4B 5KSHA 1SHVA 2IWCA 1XA7A 1HD8A 4MBKA 1G6AA 3LO7A 2OLUA 1BLPA 4QY5A 1YLYA 1XKZA 2QMIA 2ZC5B 3BFEA 1YMXA 2PU2A 3IT9A 3MKEA 5CECA 3WS4A 5BOHA 1KE3A 1CEFA 2WGVA 4FCFA 4JXVA 1EI5A 4JXSA 3CZDA 4N9LA 3VFHA 4KZ4A 5F1FA 1W7FA 1RGZA 4KZ9A 5GLAA 4KENB 4P85A 2E8IA 2J8YA 4E3JA 2HP9A 3IF5A 1GCEA 3NBLA 4JLFA 2R9WA 5CHMA 1FSYA 5DVAA 4GZBA 4E3MA 4PM9A 5CEBA 3OCLA 1BSGA 2RCXA 3N7WA 4U0TA 1MKIA 3C7VA 3CJMA 4FSFA 3O87A 3IWOA 1BUEA 3NY4A 3UPNA 2XR0A 3VP4A 1E4DA 3HLWA 3HREA 1PWDA 5DTKA 2HDSA 1BT5A 3Q7ZA 4ZJ1A 2HP5A 4M3KA 4NETA 5TR7A 3SS4A 3EQUA 3WRTA 3HUOA 3PAEA 4RX3A 1DJBA 4Z9QA 1BTLA 3BFFA 1ALQA 2PBYA 1YM1A 4IBXA 4N1HA 4OPZA 1KGEA 3MBZA 5AQ7A 3VSLA 4BD1A 1JWZA 4X56A 5TFQA 4MEZA 3A3JA 1GHMA 2WYXA 1ERMA 3WS2A 3DWKA 1W5DA 3ZCZA 3HLCA 3IHBA 2H0YA 3MXSA 4E3KA 1IKIA 2V20A 3G30A 4PM8A 1YLZA 3O3VA 3PBTA 1L0DA 1ZG4A 4MNRA 3FV7A 1DJCA 4OQIA 4S2KA 3UE0A 4NK3A 1C3BA 1JVJA 4ZTKA 1PW1A 4S2NA 3HLEA 5E43A 1BZAA 4S2NC 5F83A 2WKIA 3B3XA 5CHUA 4MBFA 5EVIB 1ES4A 4GNUA 4PPRA 3IXGA 1MY8A 4X55A 3QNBA 3LY3A 4R0QA 1YT4A 1JTDA 4C6YA 2Y2IA 1TDGA 5AQ9A 4OQGA 2CC1A 2Y2MA 3SS3A 2XD1A 1PI5A 2ZC6B 3TSGA 4R4RA 3D4FA 3AGDA 4DXBA 5E2GA 4WZ5A 4GDNA 4WZ5C 2BG1A 4FH2A 5AQAA 1LL9A 3ZG7B 3G34A 2OV5A 3IF6C 4QY6A 3A3FA 1L2SA 5EOEA 2EFUA 4DE3A 1LLBA 1MBLA 1XGJA 5KZHA 1K6SA 3HLFA 3JYIA 1GHIA 2ZQ9A 1ONGA 4S2OA 5GLBA 3Q7VA 4OPYA 2WGWB 2X71A 4KZ3A 4BLMA 4DDSA 2J7VA 2XQZA 2Y2LA 3BLSA 5CRFA 4DDYA 5L2FA 2OSUA 2X01A 4DKIA 1HVBA 4PMAA 4ZJ3A 5AQBA 4LCLA 4WEJA 3V3SA 2XLNA 1K54A 3C4PA 5HARA 5FATA 1K54C 1MXOA 4JF6A 5FASA 1YLPA 1CI8A 3NDGA 3AGFA 1N9BA 2ZQAA 1SKFA 5CHJA 3UDIA 2ZMAA 4KG2A 4JKTA 4GD6A 5JYOA 4KZ6A 3A3DA 5FI7A 1PYYA 1J9MA 5CEDA 4R1GA 3W8KA 2Y59A 4E3IA 3SS5A 4ZBEA 3VMAA 1PW8A 3GMWA 1MPLA 1G68A 2ZD8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FFY A;  3PTE A;  3Q07 A;  4BL3 A;  2Z2M B;  1H8Y A;  4KG6 A;  1PWC A;  3O86 A;  1NJ4 A;  2JE5 A;  3ISG A;  4FD8 A;  5CTM A;  3P98 A;  4GDB A;  3V5M A;  4LV1 A;  2IWB A;  3ZG0 A;  2XD5 A;  4PM5 A;  2P9V A;  2R9X A;  2HDU A;  3AGE A;  5FQJ A;  4EBN A;  2HPB A;  4GOG A;  4UA9 A;  1Z6F A;  2Y91 A;  1IYO A;  3N8S A;  1BUL A;  1L0E A;  1YLW A;  5CGS A;  5CGW A;  3C4O A;  3NC8 A;  4F94 A;  5FA7 A;  4H8R A;  3HVF A;  1M40 A;  3BFC A;  3NDE A;  1KGF A;  3VOZ A;  1KGG A;  4OOL A;  1K55 A;  3ZG5 A;  1K55 C;  1W8Q A;  1ZKJ A;  2EX2 A;  1U60 A;  3V39 A;  5M18 A;  3WS0 A;  4JF5 A;  3S1Y A;  4MBH A;  4KG5 A;  1M6K A;  4RVA A;  4MLL A;  4EBP A;  3FZC A;  4IVK A;  4LV2 A;  2JC7 A;  3IXB A;  5FQQ A;  5HL1 A;  2X02 A;  4OPR A;  4D2O A;  4EWF A;  1K57 A;  3OPR A;  3BEC A;  1K57 C;  4OP5 A;  3OPH A;  2Y2K A;  3G32 A;  5EUA A;  3ZNY A;  1KE4 A;  4RA7 A;  1DJA A;  1IYP A;  2ZC7 A;  4WM9 A;  2HDQ A;  3E2L A;  5JYP A;  5A91 A;  3N8L A;  1JTG A;  3ZFZ A;  3UN7 A;  3IHA A;  2Y2P A;  4JF4 A;  1JWV A;  1ERO A;  3EQV A;  5CTN A;  1IYS A;  2Y55 A;  3V3R A;  4E3N A;  1SDN A;  4Y0O A;  4R4S A;  2XK1 A;  3PBO A;  3C5A A;  3VFF A;  3VP3 A;  4ZJ2 A;  3ZNT A;  2A49 A;  4OON A;  4B4X A;  4Y0U A;  3BFD A;  3S22 A;  2XF3 A;  1ESI A;  4S2M A;  3S4X A;  2FFF B;  2V2F F;  2PU4 A;  3OC2 A;  5HAI A;  5HAP A;  4E3O A;  2Y2N A;  3GVB A;  1SDE A;  2ZM2 A;  4PM6 A;  5DTT A;  5FSR A;  3ZDJ A;  1ES5 A;  3BRM A;  3UNW A;  2H10 A;  3Q1F A;  1PIO A;  4IBR A;  1K25 A;  1LI0 A;  4YFM A;  1FR1 A;  3UPP A;  1PWG A;  2G2W A;  2VGJ A;  3HL9 A;  4LV0 A;  3W4P A;  1K56 D;  2UWX A;  2DRW A;  4X6T A;  1KVL A;  2C6W B;  3GRJ A;  1W8Y A;  3NI9 A;  4RX2 A;  5EE8 A;  4Y0T A;  2V1Z A;  3MXR A;  1VM1 A;  2H5S A;  2ZQD A;  2HP6 A;  4DE2 A;  5HFO A;  4U3T A;  3G31 A;  4EQI A;  5EVI C;  3VP2 A;  4C75 A;  4E6W A;  3OZH A;  5FQK A;  4LCM A;  4JBF A;  4Y7P A;  2ZC3 B;  4Q8I A;  3A3I A;  3IF6 A;  2DCF A;  3IXH A;  2Y2H A;  1BLS A;  1Q2P A;  3N6I A;  4R23 A;  1XP4 A;  3HLB A;  3SH8 A;  4OQH A;  2XFS A;  1W79 A;  4X69 A;  1SCW A;  4OLG A;  3HBR A;  5GL9 A;  1N4O A;  2H0T A;  3IWQ A;  1NY0 A;  3G35 A;  4DF6 A;  4IED A;  1I5Q A;  2ZM0 A;  4OKP A;  1RGY A;  5GHX A;  4JXG A;  1QMF A;  5CER A;  3I7J A;  4OOY A;  3C7U A;  2XFT A;  3Q82 A;  3UPO A;  2BLS A;  3BLM A;  4OPQ A;  1ZG6 A;  1K6R A;  4XUZ A;  5EOO A;  3Q7V B;  2EX9 A;  1RP5 A;  1XPB A;  4XUX A;  5GHZ A;  1K56 A;  5A90 A;  5KSC A;  1NYY A;  4GN2 A;  1IEL A;  4LV3 A;  4K0W A;  4X53 A;  5EPH A;  5EEC A;  3CMZ A;  4GD8 A;  3TG9 A;  4PM7 A;  3CG5 A;  3W4O A;  4JXW A;  5CXW A;  2Q9M A;  4A5R A;  4HBT A;  1IYQ A;  5DF7 A;  1PZP A;  4WBG A;  3UO9 A;  1HTZ A;  3ITA A;  4KZA A;  5FDH A;  2WKE A;  2Y4A A;  3MZE A;  2WAD A;  3WWX A;  5J8X A;  4K0X A;  3M2J A;  1ERQ A;  1O07 A;  1WYB A;  1WE4 A;  1K4F A;  2Q9N A;  3QHY A;  4R3J A;  4WEK A;  5GLD A;  4E6X A;  4EV4 A;  4X68 A;  1DY6 A;  4KZ7 A;  4QD4 A;  2Y2G A;  1ESU A;  4OLD A;  1CEG A;  4S2J A;  4JPM A;  4XXR A;  3BM6 A;  4E3L A;  3HUN A;  3IH9 A;  3N8R A;  5E2H A;  1GHP A;  3HLD A;  4P87 A;  4ZAM A;  4EBL A;  2QPN A;  1H5X A;  2P9V B;  4UAA A;  2WK0 A;  1KE0 A;  2JBF A;  3VP0 A;  2WKH A;  3FWL A;  3VSK A;  3ZHH A;  1AXB A;  5FQM A;  4KZ8 A;  1MWS A;  1IEM A;  4DRT A;  4WYY A;  2GDN A;  3UDX A;  2EX8 A;  3SH9 A;  3UE3 A;  3O88 A;  5FAQ A;  2QZ6 A;  4N92 A;  1O7E A;  5DF8 A;  5CGX A;  4QB8 A;  1FOF A;  2XDM A;  4LEN A;  1E25 A;  1XXM A;  2XH9 A;  3GQZ A;  4CPK A;  3GR2 A;  3G2Z A;  3DTM A;  3N4I A;  1E3U D;  1TDL A;  5FI2 A;  5HW3 A;  1H8Z A;  4FH4 A;  4DE0 A;  1BLC A;  1YLJ A;  2WGI A;  3W4Q A;  4QU3 A;  1ES3 A;  4YIN A;  2XEP A;  1FSW A;  1LI9 A;  3RJU A;  3FKV A;  4K91 A;  3VOY A;  2G2U A;  4B88 A;  2XGN A;  4UA7 A;  3OCN A;  5FAP A;  4N9K A;  4EUZ A;  2ZLY A;  2WAF A;  4RYE A;  2C5W B;  3GTC A;  4OVD A;  1NZO A;  1ZC2 A;  2ZM8 A;  4OOM A;  3OPP A;  4UA6 A;  5M19 A;  5GLC A;  4WMC D;  4BJP A;  4KQR A;  1I2S A;  3IWI A;  1KVM A;  3IH8 A;  3OPL A;  2Y2J A;  3MFD A;  4N1X A;  5FQI A;  5EVI D;  1KDS A;  2Z2L B;  2EX6 A;  1WYC A;  1FR6 A;  1K38 A;  1S6R A;  3MZD A;  4ID4 A;  2EXA A;  2HDR A;  3BEB A;  3NIA A;  5GHY A;  4KQQ A;  1E3U A;  3LY4 A;  4QJG A;  1VQQ A;  1KDW A;  5U47 A;  5D3O A;  5I94 A;  3P09 A;  1XA1 A;  3GSG A;  5DTS A;  1NRF A;  3DWZ A;  3UY6 A;  1FCN A;  4OP8 A;  3ZGA B;  3VP1 A;  5FQ9 A;  3UDF A;  1CI9 A;  4R3B A;  5A92 A;  1MWU A;  4P6B A;  3ZVW A;  1MWT A;  2P74 A;  2ZQ7 A;  1PZO A;  1GA9 A;  1HZO A;  3G4P A;  4WMC A;  3FYZ A;  4P0M A;  4S2P A;  1BLH A;  4DE1 A;  1Y54 A;  1ES2 A;  5EVI A;  4IVI A;  3IQA A;  2WUQ A;  5E2F A;  4S2L A;  5DF9 A;  3ZVT A;  2ZJ9 A;  1LL5 A;  1EWZ A;  3IF6 B;  1S0W A;  2J9O A;  2WAE A;  3RXX A;  4BD0 A;  4DXC A;  1PI4 A;  4UHU A;  4BEN A;  4C3Q A;  3UE1 A;  1I2W A;  3RXW A;  2OLV A;  3MKF A;  4ZDX A;  4O7D A;  3GV9 A;  1TVF A;  5EVL A;  5HX9 A;  3ZG8 B;  5E2E A;  3G2Y A;  1YMS A;  3ZG9 B;  3WRZ A;  5KMW A;  3FKW A;  5G18 A;  3HLG A;  3M6B A;  1NZU A;  1TEM A;  1LHY A;  2EXB A;  2A3U A;  2DNS A;  1RCJ A;  1FQG A;  1FCM A;  1XX2 A;  3PBQ A;  2JCH A;  4S2I A;  4WZ4 A;  1Q2Q A;  1ONH A;  5IHV A;  1QME A;  2VGK A;  2J9P A;  3A3E A;  1L0G A;  2WGW A;  3Q81 A;  2WZX A;  4KZ5 A;  3M6H A;  3E2K A;  2B5R A;  3LEZ A;  4HES A;  3PBN A;  1XGI A;  3SH7 A;  3DW0 A;  1NXY A;  4OQ0 A;  3PAG A;  1GA0 A;  4U0X A;  1CK3 A;  4B4Z A;  1OME A;  4BQM A;  4GKU A;  2WZZ A;  3SOI A;  1K4E A;  1YLT A;  2EFX A;  5FAO A;  4KQO A;  3WS5 A;  5HAQ A;  5M1A A;  4CJN A;  3IXD A;  3PBS A;  2Y2Q A;  2ZQ8 A;  3LCE A;  3M2K A;  4KZB A;  3V50 A;  1MWR A;  2IWD A;  2RL3 A;  5F82 A;  4BL2 A;  3QNC A;  3HUM A;  1IKG A;  1JWP A;  2Y2O A;  1YQS A;  3BYD A;  5F1G A;  1L0F A;  3MZF A;  3WS1 A;  4OH0 A;  2ZQC A;  3NCK A;  4WEL A;  3PBR A;  4HEF A;  4HBU A;  4L0L A;  1NYM A;  2I72 A;  4GB7 A;  5TGF A;  3BFG A;  5FI6 A;  4QHC A;  5A93 A;  3TOI A;  1FCO A;  3ITB A;  2ZC4 B;  5KSH A;  1SHV A;  2IWC A;  1XA7 A;  1HD8 A;  4MBK A;  1G6A A;  3LO7 A;  2OLU A;  1BLP A;  4QY5 A;  1YLY A;  1XKZ A;  2QMI A;  2ZC5 B;  3BFE A;  1YMX A;  2PU2 A;  3IT9 A;  3MKE A;  5CEC A;  3WS4 A;  5BOH A;  1KE3 A;  1CEF A;  2WGV A;  4FCF A;  4JXV A;  1EI5 A;  4JXS A;  3CZD A;  4N9L A;  3VFH A;  4KZ4 A;  5F1F A;  1W7F A;  1RGZ A;  4KZ9 A;  5GLA A;  4KEN B;  4P85 A;  2E8I A;  2J8Y A;  4E3J A;  2HP9 A;  3IF5 A;  1GCE A;  3NBL A;  4JLF A;  2R9W A;  5CHM A;  1FSY A;  5DVA A;  4GZB A;  4E3M A;  4PM9 A;  5CEB A;  3OCL A;  1BSG A;  2RCX A;  3N7W A;  4U0T A;  1MKI A;  3C7V A;  3CJM A;  4FSF A;  3O87 A;  3IWO A;  1BUE A;  3NY4 A;  3UPN A;  2XR0 A;  3VP4 A;  1E4D A;  3HLW A;  3HRE A;  1PWD A;  5DTK A;  2HDS A;  1BT5 A;  3Q7Z A;  4ZJ1 A;  2HP5 A;  4M3K A;  4NET A;  5TR7 A;  3SS4 A;  3EQU A;  3WRT A;  3HUO A;  3PAE A;  4RX3 A;  1DJB A;  4Z9Q A;  1BTL A;  3BFF A;  1ALQ A;  2PBY A;  1YM1 A;  4IBX A;  4N1H A;  4OPZ A;  1KGE A;  3MBZ A;  5AQ7 A;  3VSL A;  4BD1 A;  1JWZ A;  4X56 A;  5TFQ A;  4MEZ A;  3A3J A;  1GHM A;  2WYX A;  1ERM A;  3WS2 A;  3DWK A;  1W5D A;  3ZCZ A;  3HLC A;  3IHB A;  2H0Y A;  3MXS A;  4E3K A;  1IKI A;  2V20 A;  3G30 A;  4PM8 A;  1YLZ A;  3O3V A;  3PBT A;  1L0D A;  1ZG4 A;  4MNR A;  3FV7 A;  1DJC A;  4OQI A;  4S2K A;  3UE0 A;  4NK3 A;  1C3B A;  1JVJ A;  4ZTK A;  1PW1 A;  4S2N A;  3HLE A;  5E43 A;  1BZA A;  4S2N C;  5F83 A;  2WKI A;  3B3X A;  5CHU A;  4MBF A;  5EVI B;  1ES4 A;  4GNU A;  4PPR A;  3IXG A;  1MY8 A;  4X55 A;  3QNB A;  3LY3 A;  4R0Q A;  1YT4 A;  1JTD A;  4C6Y A;  2Y2I A;  1TDG A;  5AQ9 A;  4OQG A;  2CC1 A;  2Y2M A;  3SS3 A;  2XD1 A;  1PI5 A;  2ZC6 B;  3TSG A;  4R4R A;  3D4F A;  3AGD A;  4DXB A;  5E2G A;  4WZ5 A;  4GDN A;  4WZ5 C;  2BG1 A;  4FH2 A;  5AQA A;  1LL9 A;  3ZG7 B;  3G34 A;  2OV5 A;  3IF6 C;  4QY6 A;  3A3F A;  1L2S A;  5EOE A;  2EFU A;  4DE3 A;  1LLB A;  1MBL A;  1XGJ A;  5KZH A;  1K6S A;  3HLF A;  3JYI A;  1GHI A;  2ZQ9 A;  1ONG A;  4S2O A;  5GLB A;  3Q7V A;  4OPY A;  2WGW B;  2X71 A;  4KZ3 A;  4BLM A;  4DDS A;  2J7V A;  2XQZ A;  2Y2L A;  3BLS A;  5CRF A;  4DDY A;  5L2F A;  2OSU A;  2X01 A;  4DKI A;  1HVB A;  4PMA A;  4ZJ3 A;  5AQB A;  4LCL A;  4WEJ A;  3V3S A;  2XLN A;  1K54 A;  3C4P A;  5HAR A;  5FAT A;  1K54 C;  1MXO A;  4JF6 A;  5FAS A;  1YLP A;  1CI8 A;  3NDG A;  3AGF A;  1N9B A;  2ZQA A;  1SKF A;  5CHJ A;  3UDI A;  2ZMA A;  4KG2 A;  4JKT A;  4GD6 A;  5JYO A;  4KZ6 A;  3A3D A;  5FI7 A;  1PYY A;  1J9M A;  5CED A;  4R1G A;  3W8K A;  2Y59 A;  4E3I A;  3SS5 A;  4ZBE A;  3VMA A;  1PW8 A;  3GMW A;  1MPL A;  1G68 A;  2ZD8 A; 
#chains in the Genus database with same CATH topology
 3H7W B;  2FFY A;  2Z2M B;  1H8Y A;  5CTM A;  4LV1 A;  3ZG0 A;  3T50 A;  2Y91 A;  3QP4 A;  5CGW A;  4R38 A;  3C4O A;  3NC8 A;  3HVF A;  2PR5 A;  5TBM B;  1M40 A;  5F6A A;  3VOZ A;  5HD3 A;  4JF5 A;  3S1Y A;  1V9Y A;  2GX5 A;  1YPR A;  3FZC A;  1XJ2 A;  5L09 A;  1P97 A;  4D2O A;  2KX6 A;  4EWF A;  3OPR A;  3G32 A;  5EUA A;  2W3D A;  4UQI S;  2HDQ A;  5C5K A;  5A91 A;  4M4X A;  3IHA A;  5CTN A;  1ERO A;  1IYS A;  2Y55 A;  3V3R A;  1ZTU A;  4R4S A;  3C5A A;  5FDS A;  4JGQ A;  3VP3 A;  2A49 A;  2K31 A;  2W3G A;  3F1P A;  2J3W A;  3K3D A;  4B4X A;  4FUW A;  3BFD A;  5DKL A;  4Y3I A;  1ESI A;  5HAI A;  5HAP A;  2Y2N A;  4HIA A;  5HDC A;  2ZM2 A;  4PM6 A;  3ZDJ A;  1YKD A;  2H10 A;  4IBR A;  3LIF A;  1LI0 A;  4YFM A;  4NXF A;  4LV0 A;  2UWX A;  3DBA A;  2L1M A;  4X6T A;  2C6W B;  3GRJ A;  3NI9 A;  2V1Z A;  3QP6 A;  3VV4 A;  4EQI A;  3VP2 A;  3SH8 A;  4OQH A;  1YSQ A;  3QP8 A;  3HBR A;  5GL9 A;  1N4O A;  2LB5 A;  4DF6 A;  1I5Q A;  5A8B A;  3BY8 A;  2BLS A;  1K6R A;  2VEA A;  3Q7V B;  1RP5 A;  1XPB A;  4MN5 A;  1NYY A;  4GN2 A;  2O9A A;  2VV7 A;  5EPH A;  3TG9 A;  3CMZ A;  4JXW A;  5CXW A;  5L8M A;  1IYQ A;  1PZP A;  3MS6 A;  5AVE A;  4WBG A;  1D1J A;  3BJN A;  2WKE A;  3WWX A;  4CLC C;  5J8X A;  1ERQ A;  1WYB A;  5GLD A;  4D60 A;  2W3E A;  3E4Q A;  4EER A;  3BM6 A;  3HUN A;  1GHP A;  3HLD A;  4Z1W A;  5HWW A;  1H5X A;  3PHY A;  1KE0 A;  3VP0 A;  2WKH A;  3ZHH A;  2V9A A;  1AXB A;  2XSS A;  4HI4 A;  1IEM A;  3R7W B;  4PHT A;  2EX8 A;  5HSQ A;  2QZ6 A;  1ODV A;  1O7E A;  1WA9 A;  4QB8 A;  4LPZ A;  4LEN A;  1E25 A;  2XH9 A;  4CPK A;  4YNR A;  1XJ3 A;  2Z6D A;  4HJ4 A;  1TDL A;  5HW3 A;  4FH4 A;  2WKQ A;  1BLC A;  1YLJ A;  2WGI A;  4DE0 A;  4QU3 A;  4XT2 A;  3P01 A;  3RJU A;  3IS2 B;  2G2U A;  2XGN A;  5FAP A;  4EUZ A;  2JKR I;  1VET B;  2O99 A;  2C5W B;  4OVD A;  2ZM8 A;  3IBR A;  3OPP A;  4UA6 A;  4KQR A;  2Y2J A;  5EVI D;  1MZU A;  2EX6 A;  2NUT C;  2HDR A;  4Y13 A;  1XFN A;  5MC7 A;  5I94 A;  3P09 A;  5DTS A;  1UGU A;  1LSW A;  5J3W A;  2YKH A;  4MCW A;  5FQ9 A;  3TJZ C;  1EW0 A;  1GA9 A;  1T19 A;  5F68 A;  4P0M A;  4S2P A;  4DE1 A;  2W27 A;  3D72 A;  5EM0 A;  4EEP A;  5DF9 A;  3E4O A;  4LGW A;  2ZJ9 A;  1LL5 A;  3V67 A;  2J9O A;  4C3Q A;  1S4R A;  1LSV A;  3UE1 A;  4AFI A;  4Y2F A;  1TVF A;  5EVL A;  5E2E A;  2JN7 A;  5G18 A;  2WKP A;  3M6B A;  1TEM A;  2EXB A;  2A3U A;  4WZ4 A;  3PBQ A;  1ONH A;  3T1S A;  1OTE A;  1L0G A;  3T4K A;  1F5M A;  1XGI A;  3DTI A;  4FTX A;  3E4P A;  3SOI A;  1YLT A;  5M1A A;  4CJN A;  1K0K A;  2ZQ8 A;  3LCE A;  2Y8H A;  1JWP A;  5F1G A;  3H7W A;  3NCK A;  2VGL S;  4HEF A;  5FEG A;  1S66 L;  4L0L A;  2I72 A;  2L0W A;  2PDR A;  2JKR M;  5A93 A;  1TF1 A;  4LRZ E;  4BMW A;  2IWC A;  1XA7 A;  2EWV A;  1LL8 A;  4MBK A;  1ZHH B;  3BQA A;  5TBM A;  1YLY A;  2QMI A;  2ZC5 B;  3NUL A;  5BOH A;  2WGV A;  4JXV A;  3VE4 A;  3NOT C;  3VFH A;  5FL3 A;  3U2A A;  2PYP A;  2VLG A;  1H8M A;  2OAQ 1;  3IX3 A;  5HZH A;  5CHM A;  2GJ3 A;  4WLA A;  4PM9 A;  2RCX A;  3N7W A;  1MKI A;  3C7V A;  3UE6 A;  1BUE A;  3TW8 A;  3UPN A;  3LEQ A;  2HDS A;  4ZJ1 A;  3SS4 A;  4Z9Q A;  1DJB A;  4G3V A;  3BFF A;  2PBY A;  4IBX A;  4N1H A;  3MBZ A;  3UME A;  4Y15 A;  3A3J A;  3DWK A;  3LGO A;  3HLC A;  3IHB A;  4EUV A;  5HWT A;  1DP8 A;  3G30 A;  4PM8 A;  3PBT A;  2XRO A;  1DJC A;  4OQI A;  4ZTK A;  3T4O A;  1BZA A;  3A0S A;  4NXG A;  5EVI B;  4PPR A;  3IXG A;  3QNB A;  2GZA A;  4C6Y A;  3QP1 A;  1OTB A;  1OJ5 A;  3S7N A;  3SS3 A;  1PI5 A;  4R4R A;  5E2G A;  2L4R A;  1P9R A;  3ZG7 B;  4ARZ B;  5EOE A;  1MC0 A;  3HLF A;  1GHI A;  5HDS A;  5GLB A;  3Q7V A;  2WGW B;  2XQZ A;  5CRF A;  5L2F A;  2X01 A;  1KOU A;  3LUQ A;  1OT6 A;  5HAR A;  3C4P A;  5FEF A;  5AJG A;  1K54 C;  3FG8 A;  4JF6 A;  5DJU A;  2VA0 A;  2GNX A;  3E0Y A;  2ZMA A;  3B33 A;  4KZ6 A;  3UMD A;  2Y59 A;  3SS5 A;  3VMA A;  3B42 A;  4Y0O A;  3DTM A;  1MPL A;  2W3H A;  3Q07 A;  4BL3 A;  5HD5 A;  1NJ4 A;  3ISG A;  4PM5 A;  2R9X A;  3G6O A;  4UA9 A;  1BUL A;  4QWO A;  4PKY A;  3R7W A;  4PKY G;  3NDE A;  1KGF A;  2PAV P;  2KDK A;  2QYB A;  1W8Q A;  4Q0J A;  2EX2 A;  5M18 A;  4MBH A;  2NUP C;  3PR6 A;  1M6K A;  4RVA A;  2P04 A;  4IVK A;  5HL1 A;  4OPR A;  4R70 A;  3IS2 A;  1K57 A;  2QJ7 A;  2D01 A;  1VET A;  2Y2K A;  1KE4 A;  2YKF A;  2HJE A;  2ZC7 A;  4ETZ A;  1UWN X;  4K08 A;  3ZFZ A;  5LBR A;  1JWV A;  3EQV A;  1SDN A;  3PBO A;  2KLI A;  2WKR A;  4BWI A;  4OON A;  4B9O A;  3S7Q A;  5L07 A;  3S22 A;  4S2M A;  1LT0 A;  2PU4 A;  4E3O A;  3GVB A;  1SDE A;  5FSR A;  4WF0 A;  3VOL A;  4CLC E;  3W4P A;  1K56 D;  3LFV A;  2ZMV A;  4NEE D;  4RX2 A;  1VM1 A;  4DE2 A;  4G3K A;  4U3T A;  3G31 A;  5EVI C;  4O01 A;  5FQK A;  3B47 A;  4LCM A;  4Y7P A;  2ZC3 B;  1BLS A;  3CUE A;  3MFX A;  2XFS A;  4X69 A;  3T4S A;  4OKP A;  5GHX A;  5CER A;  1S1Z A;  3C7U A;  3Q82 A;  2JHE A;  3BY9 A;  1P0Z A;  4OPQ A;  5EOO A;  4XUX A;  5A90 A;  5KSC A;  3NOP C;  4X53 A;  5EEC A;  3SW1 A;  4A5R A;  4HBT A;  3KO6 A;  3MXQ A;  4HP4 A;  3UO9 A;  3MZE A;  2WAD A;  3NJA A;  3QHY A;  2Q9N A;  4E6X A;  1K4F A;  4GS9 B;  5TJJ A;  1DY6 A;  4QD4 A;  2Y2G A;  2VX8 A;  2E8J A;  4S2J A;  3N8R A;  4P87 A;  2XA7 M;  4ZAM A;  4EBL A;  4UAA A;  3VSK A;  1S4S A;  3EGD C;  4WYY A;  2GDN A;  3SH9 A;  3O88 A;  5FAQ A;  3VE3 A;  3IBJ A;  1FOF A;  1XXM A;  1LSX A;  3MF0 A;  3GR2 A;  3G2Z A;  1GSV A;  3LR4 A;  4Y17 A;  1E3U D;  5G4Y A;  5EFW A;  5FI2 A;  1ES3 A;  2XEP A;  1FSW A;  1LI9 A;  3CPT B;  3FKV A;  1AWI A;  3ULF A;  1A0K A;  4DJ2 A;  4RYE A;  1NZO A;  5M19 A;  3NOU C;  4JGP A;  3IH8 A;  3MFD A;  2P08 A;  1S6R A;  1STZ A;  2EXA A;  3JVV A;  1X0O A;  3FC7 A;  1H3Q A;  1VQQ A;  2K7S A;  3GSG A;  3DWZ A;  3UY6 A;  4NG2 A;  2CMN A;  3UDF A;  5A92 A;  4P6B A;  1VHM A;  2ZQ7 A;  4X25 A;  1HZO A;  1TD5 A;  3C30 A;  3FYZ A;  3OBF A;  1IOU A;  5EVI A;  3IQA A;  2VK3 A;  3RTY A;  1EWZ A;  4GCZ A;  3IF6 B;  2WAE A;  4DXC A;  4BD0 A;  2W1R A;  1I2W A;  4GLQ A;  4ZDX A;  2H28 A;  4O7D A;  3ZG8 B;  3ZG9 B;  3WRZ A;  2PHY A;  4ARZ A;  1LHY A;  3KSG A;  3D9Y A;  2JCH A;  1Q2Q A;  5IHV A;  2VGK A;  2WGW A;  3Q81 A;  4KZ5 A;  3M6H A;  3UB8 A;  3E2K A;  4NXB A;  3LR3 A;  2V8F A;  1GA0 A;  1CK3 A;  4LRY C;  4BQM A;  1OME A;  2EFX A;  5HAQ A;  2O9B A;  2V0U A;  3V50 A;  2RL3 A;  1YSP A;  4BL2 A;  3MZF A;  2ZQC A;  5G4Z A;  1NYM A;  4GB7 A;  3JVU A;  5FI6 A;  1GSX A;  3MR0 A;  1N9O A;  1FCO A;  2ZC4 B;  1TS6 A;  3LO7 A;  1BLP A;  4QY5 A;  1G5U A;  2PU2 A;  3IT9 A;  5CEC A;  1CEF A;  5EVE A;  4N9L A;  4KZ4 A;  1W7F A;  3MQQ A;  1RGZ A;  4P85 A;  1GCE A;  2R9W A;  1FSY A;  1T1C A;  3C38 A;  5DVA A;  3OCL A;  3CJM A;  4IJG A;  1BYW A;  3O87 A;  4ETX A;  2XR0 A;  3VP4 A;  2V1B A;  3HRE A;  3MQO A;  5DTK A;  4EQ1 A;  4BBU A;  3Q7Z A;  4M3K A;  4NET A;  3EQU A;  3WRT A;  3EEA A;  2PT7 A;  4LLO B;  1ALQ A;  4OPZ A;  1KGE A;  3CIT A;  5TFQ A;  4MEZ A;  1ERM A;  1W5D A;  2H0Y A;  2OAP 1;  2PRF A;  3O3V A;  1ZG4 A;  1V9Z A;  2BAS A;  4MNR A;  1JVJ A;  1PW1 A;  4S2N A;  3TRC A;  4GNU A;  2FZ0 A;  4X55 A;  4WN5 A;  3KSF A;  1YT4 A;  1JTD A;  1SKO B;  2Y2I A;  4CQH A;  2XD1 A;  4DJ3 A;  3D4F A;  3R4K A;  1Y28 A;  4FH2 A;  5AQA A;  1LL9 A;  3IF6 C;  2HZ5 A;  1FIL A;  2V8C A;  1T1B A;  4OPY A;  2X71 A;  2J7V A;  3BLS A;  2OSU A;  5EV0 A;  1HVB A;  4WEJ A;  3V3S A;  3K2N A;  2O9C A;  3NDG A;  1J3W A;  3UDI A;  4KG2 A;  1J9M A;  1VB6 A;  5CED A;  4R1G A;  3W8K A;  3LIE A;  4GS9 A;  4E3I A;  4ZBE A;  1PW8 A;  1G68 A;  1TS8 A;  3PTE A;  4KG6 A;  1PWC A;  3O86 A;  3NEC A;  3V5M A;  3P98 A;  4GDB A;  1PFL A;  5IS1 A;  2XD5 A;  4EBN A;  2HDU A;  2OWH A;  4GOG A;  1IYO A;  1L0E A;  1YLW A;  5CGS A;  2M1C A;  4F94 A;  4MN6 A;  2Z6C A;  3BWL A;  3CHW P;  1L3L A;  3BFC A;  2Y79 A;  1N9L A;  1K55 A;  4R3A A;  1ZKJ A;  2QJ5 A;  3WS0 A;  4WUJ A;  4KG5 A;  2VGL M;  4MLL A;  4EBP A;  4LV2 A;  2JC7 A;  3E98 A;  2X02 A;  3CPT A;  4HQA A;  1K57 C;  4OP5 A;  1DJA A;  4WM9 A;  4WL9 A;  2Y2P A;  4E3N A;  3F1N B;  2XK1 A;  4ZJ2 A;  3ZNT A;  1S67 L;  2J80 A;  1HLU P;  2XF3 A;  3S4X A;  4YOF A;  3CWF A;  5DTT A;  1ES5 A;  3BRM A;  4MDZ A;  1D06 A;  1PWG A;  3HL9 A;  2DRW A;  1KVL A;  4Y0T A;  1CJF A;  1W8Y A;  5EE8 A;  3MXR A;  2HP6 A;  4JGR A;  4I3A A;  4Q8I A;  3IF6 A;  2DCF A;  3IXH A;  2Y2H A;  3N6I A;  1XP4 A;  3CUE C;  3T1Q B;  1OPX A;  1W79 A;  3D3O A;  1Z09 A;  3IWQ A;  2H0T A;  5HL6 A;  4CLC D;  2JKG A;  2ZL1 B;  4IED A;  2ZM0 A;  3RFB A;  4HNB A;  4JXG A;  4OOY A;  2XFT A;  3UPO A;  4XUZ A;  5GHZ A;  1K56 A;  2PR6 A;  3SZT A;  2V0W A;  3C2W A;  1IEL A;  4LFU A;  4LV3 A;  4GD8 A;  4PM7 A;  5DFY A;  4BBV A;  3BQ8 A;  3CG5 A;  3W4O A;  2Q9M A;  4F3L B;  3NHQ A;  1W63 Q;  4KZA A;  2Y4A A;  2B02 A;  4R3J A;  4EV4 A;  4X68 A;  3U4L P;  3OLO A;  5J4E A;  3RH8 B;  2HF6 A;  1ESU A;  4HH3 A;  4OLD A;  1CEG A;  4E3L A;  4XXR A;  3IH9 A;  5E2H A;  3IX4 A;  2P9V B;  1VEU B;  3FPV A;  1NRJ A;  3FWL A;  1DP6 A;  4E04 A;  4KZ8 A;  1MWS A;  4II7 A;  2ZOH A;  3A0V A;  3UDX A;  4N92 A;  4RQ9 A;  5CGX A;  2MJ6 A;  3QP5 A;  3OOV A;  4HOI A;  5KIZ A;  2PBD P;  1H8Z A;  4YWZ A;  2VV8 A;  3T1R A;  3VOY A;  4B88 A;  2WAF A;  5I5L A;  1OTD A;  1ZC2 A;  5J7E A;  3T12 B;  4O0P A;  5GLC A;  4WMC D;  2ACG A;  3IWI A;  1NLY A;  1KVM A;  2JKF A;  3OPL A;  5K5B A;  1N9N A;  1KDS A;  2Z2L B;  1WYC A;  3MZD A;  3PYP A;  2G7U A;  3NIA A;  4ZRR A;  3T4T A;  5GHY A;  4KQQ A;  1E3U A;  5DFX A;  4I5S A;  1G6O A;  3LY4 A;  3HJI A;  5U47 A;  5D3O A;  4P6Z M;  4OP8 A;  2J3T D;  3W2Z A;  4ESP A;  2HJ9 C;  1CI9 A;  1MWU A;  3ZVW A;  3G4P A;  4NKP A;  1DP9 A;  1Y54 A;  3CAX A;  5HPF A;  4IVI A;  5E2F A;  3MSH A;  1SKO A;  3ZVT A;  3QP2 A;  1S0W A;  1F98 A;  4I39 A;  1XJ4 A;  4HJ3 A;  3RXW A;  2OLV A;  2FH5 A;  3GV9 A;  5HX9 A;  3P7N A;  1YMS A;  5KMW A;  2EA9 A;  3FKW A;  1NZU A;  2DNS A;  1RCJ A;  1FQG A;  4S2I A;  4I3J A;  1QME A;  2J9P A;  3A3E A;  4I3I A;  2WZX A;  3F1O B;  2AVX A;  2B5R A;  4KUO A;  1JNU A;  2W1T B;  3DW0 A;  2BTF P;  4OQ0 A;  3PAG A;  4U0X A;  4B4Z A;  2WZZ A;  2XA7 S;  2P7J A;  4G3W A;  2LB9 A;  1K4E A;  4CLC B;  5FAO A;  4HJ6 A;  3WS5 A;  3IXD A;  3PBS A;  2Y2Q A;  1MWR A;  5F82 A;  2PD8 A;  3QNC A;  2Y2O A;  1L0F A;  2QHK A;  4B93 A;  4WEL A;  1IFQ A;  4HBU A;  2ZBB A;  4HH2 A;  4QHC A;  3TOI A;  5KSH A;  1SHV A;  1HD8 A;  4LRX C;  1G6A A;  2OLU A;  3LI8 A;  1XKZ A;  3MKE A;  3WS4 A;  4GHI B;  1KE3 A;  4FCF A;  1EI5 A;  2ZMF A;  5F1F A;  1W63 M;  1DRM A;  4KEN B;  4EXO A;  4E3J A;  2HP9 A;  5AVF A;  4JLF A;  4O8G A;  4U0T A;  4X1L A;  1OTI A;  3HLW A;  3HJK A;  3CLO A;  2A2L A;  1YM1 A;  3VSL A;  1JWZ A;  4X56 A;  3F1N A;  2WYX A;  3ZCZ A;  4UQI M;  1CF0 A;  3EOI A;  2V20 A;  2QWS A;  1MKM A;  4GJ4 A;  4H6J B;  4S2N C;  3B3X A;  5CHU A;  1ES4 A;  4KUK A;  5AQ9 A;  4PAU A;  2ZC6 B;  3TSG A;  4DXB A;  3LI9 A;  4WZ5 A;  2BG1 A;  2OV5 A;  2ZL1 A;  3A3F A;  3PXP A;  4DE3 A;  2EFU A;  1LLB A;  1MBL A;  1XGJ A;  4NXE A;  2DMW A;  2ZQ9 A;  1ONG A;  5IT5 A;  1YAX A;  4DDS A;  4EW7 A;  4DDY A;  3EWK A;  5AQB A;  4LCL A;  1XFQ A;  4Q0I A;  4F3L A;  1G28 A;  1MXO A;  1YLP A;  3AGF A;  1N9B A;  2ZQA A;  1SKF A;  5CX7 A;  3CI6 A;  3LIC A;  4GD6 A;  3A3D A;  4GW9 A;  3GMW A;  2ZD8 A;  2M7U A;  3LR5 A;  2JE5 A;  1UWP X;  4FD8 A;  3DAV A;  3A0R A;  2IWB A;  2P9V A;  1VEU A;  3AGE A;  5FQJ A;  1XJ6 A;  2HPB A;  1Z6F A;  3N8S A;  5FA7 A;  4H8R A;  3T1X A;  1KGG A;  4OOL A;  3ZG5 A;  1K55 C;  3GDI A;  1TS0 A;  1U60 A;  3V39 A;  2JKT I;  4HP9 A;  3UB6 A;  3EGX C;  3IXB A;  5FQQ A;  1T18 A;  3C8C A;  3BEC A;  3OPH A;  3ZNY A;  3HCY A;  4RA7 A;  1IYP A;  1GSW A;  3E2L A;  5JYP A;  3N8L A;  1JTG A;  3UN7 A;  4JF4 A;  3H82 B;  3DTK A;  2O0Y A;  3VFF A;  4Y0U A;  2FFF B;  2V2F F;  3OC2 A;  4ME4 A;  1H0M A;  2PYR A;  3UNW A;  2A24 B;  3Q1F A;  1PIO A;  1K25 A;  1FR1 A;  3UPP A;  2G2W A;  2VGJ A;  3LIA A;  3T4L A;  2H5S A;  2ZQD A;  5HFO A;  4C75 A;  4E6W A;  3OZH A;  4JBF A;  3A3I A;  4R23 A;  1Q2P A;  3HLB A;  1SCW A;  4OLG A;  3H9W A;  1NY0 A;  3G35 A;  3MMH A;  2K2N A;  1RGY A;  1QMF A;  3I7J A;  3BLM A;  1Y4O A;  1ZG6 A;  2J3T C;  2EX9 A;  3DTE A;  3UB9 A;  1F9I A;  3F1O A;  4IUK A;  4K0W A;  2ZOI A;  4BBT A;  4MN7 A;  2W1T A;  5F5Y A;  5EM1 A;  2B95 A;  5DF7 A;  1HTZ A;  3ITA A;  5FDH A;  4CLC A;  4K0X A;  3M2J A;  1O07 A;  1TS7 A;  1WE4 A;  4WEK A;  4UEY A;  4KZ7 A;  2D02 A;  2JKT M;  2INW A;  4JPM A;  4IUH A;  2QPN A;  2WK0 A;  2JBF A;  3LID A;  3TE8 A;  5FQM A;  3LIB A;  1SZV A;  4DRT A;  2QKP A;  3T4J A;  3EEH A;  3UE3 A;  3JPU A;  5DF8 A;  3L7H A;  1D7E A;  2XDM A;  3GQZ A;  1FIK A;  4GHI A;  3FPW A;  3N4I A;  4MMN A;  3W4Q A;  4YIN A;  1ACF A;  4K91 A;  4UA7 A;  3OCN A;  4N9K A;  2ZLY A;  2Q0O A;  3GTC A;  4OOM A;  4BJP A;  5FQI A;  1I2S A;  4N1X A;  3S7P A;  2VKS A;  1FR6 A;  1K38 A;  4ID4 A;  3T4Q A;  3BEB A;  3L9K A;  5F69 A;  4QJG A;  1KDW A;  3F1P B;  1XA1 A;  5HDD A;  1NRF A;  1FCN A;  3K3C A;  3ZGA B;  3VP1 A;  4R3B A;  1MWT A;  2P74 A;  1PZO A;  4WMC A;  1BLH A;  4H6J A;  1ES2 A;  2WUQ A;  4DMZ A;  4S2L A;  4HHD A;  2PD7 A;  2VJW A;  3KYQ A;  3KSH A;  2VV6 A;  3RXX A;  1P9W A;  1PI4 A;  4UHU A;  4BEN A;  2IA2 A;  2VZW A;  3IX8 A;  2R78 A;  3MKF A;  3G2Y A;  4L9F A;  2M7V A;  3HLG A;  4EET B;  2B18 A;  1FCM A;  1XX2 A;  4R6L A;  4I38 A;  2XRN A;  5DJT A;  3LEZ A;  4HES A;  3PBN A;  3SH7 A;  4Y5F A;  1OT9 A;  1NXY A;  3UB7 A;  5L10 A;  4GKU A;  2UV0 E;  3ZYT A;  4KQO A;  3M2K A;  4KZB A;  2IWD A;  4EU0 A;  4L9E A;  3HUM A;  1IKG A;  3BYD A;  1YQS A;  1OJG A;  3WS1 A;  4OH0 A;  3PBR A;  3KYE A;  5TGF A;  3BFG A;  4FOF A;  3ITB A;  2OWJ A;  4EES A;  1NWZ A;  3BFE A;  1YMX A;  3MQ0 A;  4JXS A;  3CZD A;  2HV1 A;  3O5Y A;  4KQD A;  4KZ9 A;  5GLA A;  5HWV A;  4XT2 B;  2E8I A;  2I9V A;  2J8Y A;  2V1A A;  3MJQ A;  3IF5 A;  3NBL A;  4GZB A;  4E3M A;  3GEC A;  4X1M A;  5CEB A;  1BSG A;  4FSF A;  3IWO A;  3BW6 A;  3NY4 A;  1E4D A;  4HY8 A;  4EEU A;  4L9G A;  1PWD A;  1BT5 A;  4P6Z S;  2HGV A;  2HP5 A;  5TR7 A;  3HUO A;  4RX3 A;  3KX0 X;  3PAE A;  1BTL A;  3ZQ5 A;  1NLZ A;  5HPI A;  5AQ7 A;  4BD1 A;  3KSI A;  1GHM A;  3H82 A;  3WS2 A;  4DN0 A;  3MXS A;  4E3K A;  1IKI A;  1T1A A;  1YLZ A;  1L0D A;  5DKK A;  3FV7 A;  3ICY A;  4S2K A;  3UE0 A;  4NK3 A;  2A24 A;  1C3B A;  3KYZ A;  3HLE A;  5E43 A;  5F83 A;  2WKI A;  4MBF A;  1MY8 A;  3LYX A;  3LY3 A;  4R0Q A;  1TDG A;  5IU1 A;  4OQG A;  2CC1 A;  2W0N A;  2Y2M A;  1PRQ A;  4JGO A;  3AGD A;  2W3F A;  4GDN A;  4WZ5 C;  3G34 A;  3S7O A;  4QY6 A;  1L2S A;  5KZH A;  1K6S A;  4IHQ A;  3JYI A;  4S2O A;  4KZ3 A;  4BLM A;  2Y2L A;  4DKI A;  4PMA A;  1S1Y A;  4ZJ3 A;  4Q0H A;  4QPR A;  1K54 A;  2XLN A;  2EWW A;  1PNE A;  5FAT A;  1OTA A;  2KOI A;  5FAS A;  1CI8 A;  5CHJ A;  3LR0 A;  4JKT A;  5JYO A;  5FI7 A;  1PYY A;  3UB5 P;  1CQA A;  1F2K A;  2OOL A; 
#chains in the Genus database with same CATH homology
 2FFY A;  3PTE A;  3Q07 A;  4BL3 A;  2Z2M B;  1H8Y A;  4KG6 A;  1PWC A;  3O86 A;  1NJ4 A;  2JE5 A;  3ISG A;  4FD8 A;  5CTM A;  3P98 A;  4GDB A;  3V5M A;  4LV1 A;  2IWB A;  3ZG0 A;  2XD5 A;  4PM5 A;  2P9V A;  2R9X A;  2HDU A;  3AGE A;  5FQJ A;  4EBN A;  2HPB A;  4GOG A;  4UA9 A;  1Z6F A;  2Y91 A;  1IYO A;  3N8S A;  1BUL A;  1L0E A;  1YLW A;  5CGS A;  5CGW A;  3C4O A;  3NC8 A;  4F94 A;  5FA7 A;  4H8R A;  3HVF A;  1M40 A;  3BFC A;  3NDE A;  1KGF A;  3VOZ A;  1KGG A;  4OOL A;  1K55 A;  3ZG5 A;  1K55 C;  1W8Q A;  1ZKJ A;  2EX2 A;  1U60 A;  3V39 A;  5M18 A;  3WS0 A;  4JF5 A;  3S1Y A;  4MBH A;  4KG5 A;  1M6K A;  4RVA A;  4MLL A;  4EBP A;  3FZC A;  4IVK A;  4LV2 A;  2JC7 A;  3IXB A;  5FQQ A;  5HL1 A;  2X02 A;  4OPR A;  4D2O A;  4EWF A;  1K57 A;  3OPR A;  3BEC A;  1K57 C;  4OP5 A;  3OPH A;  2Y2K A;  3G32 A;  5EUA A;  3ZNY A;  1KE4 A;  4RA7 A;  1DJA A;  1IYP A;  2ZC7 A;  4WM9 A;  2HDQ A;  3E2L A;  5JYP A;  5A91 A;  3N8L A;  1JTG A;  3ZFZ A;  3UN7 A;  3IHA A;  2Y2P A;  4JF4 A;  1JWV A;  1ERO A;  3EQV A;  5CTN A;  1IYS A;  2Y55 A;  3V3R A;  4E3N A;  1SDN A;  4Y0O A;  4R4S A;  2XK1 A;  3PBO A;  3C5A A;  3VFF A;  3VP3 A;  4ZJ2 A;  3ZNT A;  2A49 A;  4OON A;  4B4X A;  4Y0U A;  3BFD A;  3S22 A;  2XF3 A;  1ESI A;  4S2M A;  3S4X A;  2FFF B;  2V2F F;  2PU4 A;  3OC2 A;  5HAI A;  5HAP A;  4E3O A;  2Y2N A;  3GVB A;  1SDE A;  2ZM2 A;  4PM6 A;  5DTT A;  5FSR A;  3ZDJ A;  1ES5 A;  3BRM A;  3UNW A;  2H10 A;  3Q1F A;  1PIO A;  4IBR A;  1K25 A;  1LI0 A;  4YFM A;  1FR1 A;  3UPP A;  1PWG A;  2G2W A;  2VGJ A;  3HL9 A;  4LV0 A;  3W4P A;  1K56 D;  2UWX A;  2DRW A;  4X6T A;  1KVL A;  2C6W B;  3GRJ A;  1W8Y A;  3NI9 A;  4RX2 A;  5EE8 A;  4Y0T A;  2V1Z A;  3MXR A;  1VM1 A;  2H5S A;  2ZQD A;  2HP6 A;  4DE2 A;  5HFO A;  4U3T A;  3G31 A;  4EQI A;  5EVI C;  3VP2 A;  4C75 A;  4E6W A;  3OZH A;  5FQK A;  4LCM A;  4JBF A;  4Y7P A;  2ZC3 B;  4Q8I A;  3A3I A;  3IF6 A;  2DCF A;  3IXH A;  2Y2H A;  1BLS A;  1Q2P A;  3N6I A;  4R23 A;  1XP4 A;  3HLB A;  3SH8 A;  4OQH A;  2XFS A;  1W79 A;  4X69 A;  1SCW A;  4OLG A;  3HBR A;  5GL9 A;  1N4O A;  2H0T A;  3IWQ A;  1NY0 A;  3G35 A;  4DF6 A;  4IED A;  1I5Q A;  2ZM0 A;  4OKP A;  1RGY A;  5GHX A;  4JXG A;  1QMF A;  5CER A;  3I7J A;  4OOY A;  3C7U A;  2XFT A;  3Q82 A;  3UPO A;  2BLS A;  3BLM A;  4OPQ A;  1ZG6 A;  1K6R A;  4XUZ A;  5EOO A;  3Q7V B;  2EX9 A;  1RP5 A;  1XPB A;  4XUX A;  5GHZ A;  1K56 A;  5A90 A;  5KSC A;  1NYY A;  4GN2 A;  1IEL A;  4LV3 A;  4K0W A;  4X53 A;  5EPH A;  5EEC A;  3CMZ A;  4GD8 A;  3TG9 A;  4PM7 A;  3CG5 A;  3W4O A;  4JXW A;  5CXW A;  2Q9M A;  4A5R A;  4HBT A;  1IYQ A;  5DF7 A;  1PZP A;  4WBG A;  3UO9 A;  1HTZ A;  3ITA A;  4KZA A;  5FDH A;  2WKE A;  2Y4A A;  3MZE A;  2WAD A;  3WWX A;  5J8X A;  4K0X A;  3M2J A;  1ERQ A;  1O07 A;  1WYB A;  1WE4 A;  1K4F A;  2Q9N A;  3QHY A;  4R3J A;  4WEK A;  5GLD A;  4E6X A;  4EV4 A;  4X68 A;  1DY6 A;  4KZ7 A;  4QD4 A;  2Y2G A;  1ESU A;  4OLD A;  1CEG A;  4S2J A;  4JPM A;  4XXR A;  3BM6 A;  4E3L A;  3HUN A;  3IH9 A;  3N8R A;  5E2H A;  1GHP A;  3HLD A;  4P87 A;  4ZAM A;  4EBL A;  2QPN A;  1H5X A;  2P9V B;  4UAA A;  2WK0 A;  1KE0 A;  2JBF A;  3VP0 A;  2WKH A;  3FWL A;  3VSK A;  3ZHH A;  1AXB A;  5FQM A;  4KZ8 A;  1MWS A;  1IEM A;  4DRT A;  4WYY A;  2GDN A;  3UDX A;  2EX8 A;  3SH9 A;  3UE3 A;  3O88 A;  5FAQ A;  2QZ6 A;  4N92 A;  1O7E A;  5DF8 A;  5CGX A;  4QB8 A;  1FOF A;  2XDM A;  4LEN A;  1E25 A;  1XXM A;  2XH9 A;  3GQZ A;  4CPK A;  3GR2 A;  3G2Z A;  3DTM A;  3N4I A;  1E3U D;  1TDL A;  5FI2 A;  5HW3 A;  1H8Z A;  4FH4 A;  4DE0 A;  1BLC A;  1YLJ A;  2WGI A;  3W4Q A;  4QU3 A;  1ES3 A;  4YIN A;  2XEP A;  1FSW A;  1LI9 A;  3RJU A;  3FKV A;  4K91 A;  3VOY A;  2G2U A;  4B88 A;  2XGN A;  4UA7 A;  3OCN A;  5FAP A;  4N9K A;  4EUZ A;  2ZLY A;  2WAF A;  4RYE A;  2C5W B;  3GTC A;  4OVD A;  1NZO A;  1ZC2 A;  2ZM8 A;  4OOM A;  3OPP A;  4UA6 A;  5M19 A;  5GLC A;  4WMC D;  4BJP A;  4KQR A;  1I2S A;  3IWI A;  1KVM A;  3IH8 A;  3OPL A;  2Y2J A;  3MFD A;  4N1X A;  5FQI A;  5EVI D;  1KDS A;  2Z2L B;  2EX6 A;  1WYC A;  1FR6 A;  1K38 A;  1S6R A;  3MZD A;  4ID4 A;  2EXA A;  2HDR A;  3BEB A;  3NIA A;  5GHY A;  4KQQ A;  1E3U A;  3LY4 A;  4QJG A;  1VQQ A;  1KDW A;  5U47 A;  5D3O A;  5I94 A;  3P09 A;  1XA1 A;  3GSG A;  5DTS A;  1NRF A;  3DWZ A;  3UY6 A;  1FCN A;  4OP8 A;  3ZGA B;  3VP1 A;  5FQ9 A;  3UDF A;  1CI9 A;  4R3B A;  5A92 A;  1MWU A;  4P6B A;  3ZVW A;  1MWT A;  2P74 A;  2ZQ7 A;  1PZO A;  1GA9 A;  1HZO A;  3G4P A;  4WMC A;  3FYZ A;  4P0M A;  4S2P A;  1BLH A;  4DE1 A;  1Y54 A;  1ES2 A;  5EVI A;  4IVI A;  3IQA A;  2WUQ A;  5E2F A;  4S2L A;  5DF9 A;  3ZVT A;  2ZJ9 A;  1LL5 A;  1EWZ A;  3IF6 B;  1S0W A;  2J9O A;  2WAE A;  3RXX A;  4BD0 A;  4DXC A;  1PI4 A;  4UHU A;  4BEN A;  4C3Q A;  3UE1 A;  1I2W A;  3RXW A;  2OLV A;  3MKF A;  4ZDX A;  4O7D A;  3GV9 A;  1TVF A;  5EVL A;  5HX9 A;  3ZG8 B;  5E2E A;  3G2Y A;  1YMS A;  3ZG9 B;  3WRZ A;  5KMW A;  3FKW A;  5G18 A;  3HLG A;  3M6B A;  1NZU A;  1TEM A;  1LHY A;  2EXB A;  2A3U A;  2DNS A;  1RCJ A;  1FQG A;  1FCM A;  1XX2 A;  3PBQ A;  2JCH A;  4S2I A;  4WZ4 A;  1Q2Q A;  1ONH A;  5IHV A;  1QME A;  2VGK A;  2J9P A;  3A3E A;  1L0G A;  2WGW A;  3Q81 A;  2WZX A;  4KZ5 A;  3M6H A;  3E2K A;  2B5R A;  3LEZ A;  4HES A;  3PBN A;  1XGI A;  3SH7 A;  3DW0 A;  1NXY A;  4OQ0 A;  3PAG A;  1GA0 A;  4U0X A;  1CK3 A;  4B4Z A;  1OME A;  4BQM A;  4GKU A;  2WZZ A;  3SOI A;  1K4E A;  1YLT A;  2EFX A;  5FAO A;  4KQO A;  3WS5 A;  5HAQ A;  5M1A A;  4CJN A;  3IXD A;  3PBS A;  2Y2Q A;  2ZQ8 A;  3LCE A;  3M2K A;  4KZB A;  3V50 A;  1MWR A;  2IWD A;  2RL3 A;  5F82 A;  4BL2 A;  3QNC A;  3HUM A;  1IKG A;  1JWP A;  2Y2O A;  1YQS A;  3BYD A;  5F1G A;  1L0F A;  3MZF A;  3WS1 A;  4OH0 A;  2ZQC A;  3NCK A;  4WEL A;  3PBR A;  4HEF A;  4HBU A;  4L0L A;  1NYM A;  2I72 A;  4GB7 A;  5TGF A;  3BFG A;  5FI6 A;  4QHC A;  5A93 A;  3TOI A;  1FCO A;  3ITB A;  2ZC4 B;  5KSH A;  1SHV A;  2IWC A;  1XA7 A;  1HD8 A;  4MBK A;  1G6A A;  3LO7 A;  2OLU A;  1BLP A;  4QY5 A;  1YLY A;  1XKZ A;  2QMI A;  2ZC5 B;  3BFE A;  1YMX A;  2PU2 A;  3IT9 A;  3MKE A;  5CEC A;  3WS4 A;  5BOH A;  1KE3 A;  1CEF A;  2WGV A;  4FCF A;  4JXV A;  1EI5 A;  4JXS A;  3CZD A;  4N9L A;  3VFH A;  4KZ4 A;  5F1F A;  1W7F A;  1RGZ A;  4KZ9 A;  5GLA A;  4KEN B;  4P85 A;  2E8I A;  2J8Y A;  4E3J A;  2HP9 A;  3IF5 A;  1GCE A;  3NBL A;  4JLF A;  2R9W A;  5CHM A;  1FSY A;  5DVA A;  4GZB A;  4E3M A;  4PM9 A;  5CEB A;  3OCL A;  1BSG A;  2RCX A;  3N7W A;  4U0T A;  1MKI A;  3C7V A;  3CJM A;  4FSF A;  3O87 A;  3IWO A;  1BUE A;  3NY4 A;  3UPN A;  2XR0 A;  3VP4 A;  1E4D A;  3HLW A;  3HRE A;  1PWD A;  5DTK A;  2HDS A;  1BT5 A;  3Q7Z A;  4ZJ1 A;  2HP5 A;  4M3K A;  4NET A;  5TR7 A;  3SS4 A;  3EQU A;  3WRT A;  3HUO A;  3PAE A;  4RX3 A;  1DJB A;  4Z9Q A;  1BTL A;  3BFF A;  1ALQ A;  2PBY A;  1YM1 A;  4IBX A;  4N1H A;  4OPZ A;  1KGE A;  3MBZ A;  5AQ7 A;  3VSL A;  4BD1 A;  1JWZ A;  4X56 A;  5TFQ A;  4MEZ A;  3A3J A;  1GHM A;  2WYX A;  1ERM A;  3WS2 A;  3DWK A;  1W5D A;  3ZCZ A;  3HLC A;  3IHB A;  2H0Y A;  3MXS A;  4E3K A;  1IKI A;  2V20 A;  3G30 A;  4PM8 A;  1YLZ A;  3O3V A;  3PBT A;  1L0D A;  1ZG4 A;  4MNR A;  3FV7 A;  1DJC A;  4OQI A;  4S2K A;  3UE0 A;  4NK3 A;  1C3B A;  1JVJ A;  4ZTK A;  1PW1 A;  4S2N A;  3HLE A;  5E43 A;  1BZA A;  4S2N C;  5F83 A;  2WKI A;  3B3X A;  5CHU A;  4MBF A;  5EVI B;  1ES4 A;  4GNU A;  4PPR A;  3IXG A;  1MY8 A;  4X55 A;  3QNB A;  3LY3 A;  4R0Q A;  1YT4 A;  1JTD A;  4C6Y A;  2Y2I A;  1TDG A;  5AQ9 A;  4OQG A;  2CC1 A;  2Y2M A;  3SS3 A;  2XD1 A;  1PI5 A;  2ZC6 B;  3TSG A;  4R4R A;  3D4F A;  3AGD A;  4DXB A;  5E2G A;  4WZ5 A;  4GDN A;  4WZ5 C;  2BG1 A;  4FH2 A;  5AQA A;  1LL9 A;  3ZG7 B;  3G34 A;  2OV5 A;  3IF6 C;  4QY6 A;  3A3F A;  1L2S A;  5EOE A;  2EFU A;  4DE3 A;  1LLB A;  1MBL A;  1XGJ A;  5KZH A;  1K6S A;  3HLF A;  3JYI A;  1GHI A;  2ZQ9 A;  1ONG A;  4S2O A;  5GLB A;  3Q7V A;  4OPY A;  2WGW B;  2X71 A;  4KZ3 A;  4BLM A;  4DDS A;  2J7V A;  2XQZ A;  2Y2L A;  3BLS A;  5CRF A;  4DDY A;  5L2F A;  2OSU A;  2X01 A;  4DKI A;  1HVB A;  4PMA A;  4ZJ3 A;  5AQB A;  4LCL A;  4WEJ A;  3V3S A;  2XLN A;  1K54 A;  3C4P A;  5HAR A;  5FAT A;  1K54 C;  1MXO A;  4JF6 A;  5FAS A;  1YLP A;  1CI8 A;  3NDG A;  3AGF A;  1N9B A;  2ZQA A;  1SKF A;  5CHJ A;  3UDI A;  2ZMA A;  4KG2 A;  4JKT A;  4GD6 A;  5JYO A;  4KZ6 A;  3A3D A;  5FI7 A;  1PYY A;  1J9M A;  5CED A;  4R1G A;  3W8K A;  2Y59 A;  4E3I A;  3SS5 A;  4ZBE A;  3VMA A;  1PW8 A;  3GMW A;  1MPL A;  1G68 A;  2ZD8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...