3U2AA

Adaptor dependent degradation of a cell-cycle regulator reveals diversity in substrate architectures
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
112
structure length
111
Chain Sequence
IWDATATLEALGAADVALWIWEPETDRLRLNGAARALGLGPLAPECSSAAFRALALPQDRAQAEEVLKPREPGSEVVARFRVRGGETLWRGVWLEEGVRAAGVVAPETKFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GGDEF family protein
publication title Adaptor-dependent degradation of a cell-cycle regulator uses a unique substrate architecture.
pubmed doi rcsb
source organism Caulobacter vibrioides
molecule tags Hydrolase
total genus 32
structure length 111
sequence length 112
ec nomenclature ec 3.1.4.52: Cyclic-guanylate-specific phosphodiesterase.
pdb deposition date 2011-10-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.310 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3u2aA00
3U2AA
chains in the Genus database with same CATH superfamily
4OQ0A 4DE0A 1L2SA 4R38A 2ZC4B 1FIKA 3BY9A 2J9OA 4CLCD 1VQQA 5HD5A 3UNWA 1MWSA 4OOLA 4WL9A 4NXFA 5E43A 4Y13A 2Y4AA 5AQ9A 2B18A 2Q9NA 4UQIM 2JKGA 3LIFA 3S1YA 3DAVA 1W8QA 4HP4A 2A49A 1TS8A 4S2LA 1GHPA 2GX5A 1W5DA 3V3SA 3IX4A 5FI6A 1KE0A 2O9AA 3N4IA 3A0VA 2QZ6A 3C4OA 2PBDP 4A5RA 5FL3A 1VETA 4JXSA 1K0KA 4X25A 2ZL1A 2XR0A 3PBOA 4PM5A 1DJAA 2PD7A 2WYXA 1S6RA 4FCFA 2J7VA 4I3JA 5CERA 1W8YA 3B33A 4HEFA 3UDIA 5HPIA 4FTXA 4E04A 3NBLA 4DF6A 2PR5A 3MS6A 1F9IA 3G35A 2CC1A 2YKHA 4GD6A 4WEJA 1EWZA 1N9LA 4O01A 3MJQA 1ALQA 5EFWA 5L8MA 5HAPA 4YOFA 5GHZA 2M7UA 5U47A 2VX8A 4GCZA 1P9RA 3DWKA 3S7NA 2C5WB 3C8CA 2XD1A 5DF7A 1TDGA 3OPLA 3V50A 1SCWA 1I5QA 4HH3A 1FCOA 4L0LA 2ZC7A 1DY6A 3FYZA 2X02A 4JPMA 1KDSA 4ZBEA 5EVIC 2R9WA 3TE8A 2ZQCA 2ZLYA 5CGXA 4ETZA 3QP5A 1K56D 4MBHA 4R4SA 1CEFA 5FAQA 1S4SA 5KZHA 4EEUA 2HZ5A 3S22A 4II7A 2XFTA 3RFBA 2FFYA 3IHAA 4F94A 1PWGA 3ZG5A 3ZG9B 5FASA 3ITAA 2IWDA 4LV1A 4EUVA 1LHYA 3Q7ZA 3W2ZA 1K54C 4BL2A 5HDCA 2PYRA 3UB6A 2K7SA 1AWIA 4Y15A 5GLBA 3I7JA 2Y2IA 1NXYA 3G32A 3UY6A 3HUMA 1D7EA 2XQZA 4L9FA 1ERMA 1G6AA 5GLCA 3LIEA 3LCEA 5F68A 4FUWA 4JGOA 3BRMA 2W0NA 4YNRA 2WKHA 4R3BA 2H5SA 4PKYG 3FG8A 4UHUA 3T4OA 5E2EA 3JVVA 5FA7A 3G31A 3GTCA 1FILA 3C7UA 5DFYA 3ZNTA 1IEMA 2H10A 4KZ6A 3NY4A 1YLZA 3ZVWA 3IF6B 3V3RA 1XA7A 1JTGA 3UDXA 4X68A 4NXEA 4GS9B 2Y2OA 1MWRA 2B02A 1N9OA 3D9YA 4MEZA 4HI4A 4IHQA 3FZCA 3OLOA 2DMWA 2GNXA 1ODVA 2DCFA 1S1ZA 1LLBA 2V8CA 4Y2FA 1FSWA 2O0YA 3GV9A 5FQQA 2Q9MA 3W8KA 3PBNA 1K25A 2QHKA 4R1GA 5FQIA 3MQQA 5HW3A 5D3OA 5EUAA 5HWWA 4RVAA 3T1SA 1NJ4A 4E3KA 3ULFA 1IYQA 4S2PA 3KSGA 3UMEA 4XXRA 2GJ3A 3IHBA 4JXVA 3NOPC 3L7HA 1MC0A 4WM9A 2ZC6B 4KQQA 4ZJ2A 2L4RA 4PM7A 1OMEA 2OV5A 4WELA 1K6RA 3CHWP 1XKZA 3KYQA 4CQHA 3B3XA 3IXDA 4E3OA 2Y2JA 1ESIA 1P97A 2Y79A 4ZJ1A 4WMCA 1G5UA 2IWCA 1L3LA 4E3MA 2Y2HA 2ZQAA 3IWIA 2WAFA 4OONA 4DKIA 3NIAA 1KGEA 1SDNA 2VZWA 3GDIA 5DF9A 3EGDC 3A3JA 1H3QA 1EROA 1V9ZA 4WBGA 5A91A 5M1AA 4Y17A 3K2NA 1T1AA 2J9PA 4K08A 4DDYA 1W79A 1HVBA 3T4QA 1Q2QA 4B4XA 3F1PB 2HJEA 1O07A 4NK3A 2PDRA 1ONGA 4MLLA 2J3TD 5CRFA 4JGPA 4N92A 2OLUA 3F1NB 2OLVA 2Y2LA 4CLCC 2GDNA 4JBFA 2EA9A 4JXWA 3IX3A 1Z09A 3MQ0A 2ZC5B 1F2KA 2YKFA 3NHQA 4S2MA 1ZTUA 1MWUA 2XH9A 1K55A 3MFDA 2MJ6A 1HZOA 1X0OA 2ZC3B 3BEBA 4LV2A 1BUEA 1KGGA 4NXBA 1HLUP 4IBXA 2EFXA 3NDEA 1T1CA 1H0MA 3E4QA 3VV4A 5TJJA 3VFHA 4IVIA 5L09A 2DNSA 3NC8A 3D72A 2EX2A 1OJGA 3ZFZA 4MDZA 3BY8A 1H5XA 5DTSA 2VKSA 3UN7A 1NRJA 1CEGA 4DMZA 5DTTA 1G68A 2IWBA 3LO7A 5C5KA 2IA2A 2XEPA 4FD8A 4LRYC 4HH2A 3OPRA 4GHIA 4OLDA 1OTAA 5A8BA 3LY4A 4ARZA 4DXCA 2HGVA 3IS2A 1TD5A 1P0ZA 4HBUA 3HLCA 4QB8A 1EW0A 3S7OA 1YKDA 4NETA 5HZHA 5F69A 3D4FA 2D02A 1GHIA 4BBVA 1ES2A 4BD1A 1NZOA 3R7WA 3FKVA 3SZTA 3ISGA 2QMIA 3OCNA 4KZ8A 1P9WA 2EXAA 1L0DA 4JKTA 5HL1A 4OQGA 3EOIA 2V8FA 2W3GA 2A3UA 1T19A 3E4PA 3ICYA 5AVFA 2HP9A 3KO6A 4FH4A 5K5BA 2ZJ9A 2FZ0A 3PHYA 2Y2NA 2XF3A 5EVIA 1C3BA 4I3IA 2O9BA 2LB9A 4BL3A 2VJWA 4XUZA 3SW1A 3CAXA 1BULA 2PD8A 2WKRA 4KZ7A 2H0TA 2JN7A 3G4PA 3UE1A 2Y2PA 2J8YA 4X1MA 3JVUA 2GZAA 4ETXA 3L9KA 4LV0A 3HVFA 1VEUB 1IOUA 3WWXA 3KSFA 5FI2A 3CG5A 5TR7A 3W4QA 2EFUA 4KENB 4X69A 4KZ3A 3UE6A 1TEMA 3T1XA 3LICA 5FSRA 2ZQ8A 4X56A 3PTEA 2BLSA 2AVXA 1GSVA 4ZJ3A 1GSWA 3G34A 4HHDA 1STZA 4O7DA 1K38A 1K57C 4M3KA 1IYOA 3LY3A 1BLCA 1XJ2A 3ZDJA 3QP8A 3N8LA 3MZFA 2Y2MA 3IH8A 1FR1A 1GSXA 2HF6A 5AQ7A 1Y28A 2WKQA 4OP5A 2PYPA 1NWZA 5FDHA 5HD3A 3QNBA 3D3OA 4I39A 2EX8A 2NUTC 1L0GA 4GHIB 3C5AA 2ZOHA 3IF5A 4KQOA 1PFLA 1T1BA 5EVEA 2XFSA 1SZVA 3BYDA 2W1TA 5JYOA 5F6AA 4PM9A 1LSXA 1FQGA 4EQIA 3A3FA 3DBAA 2VV6A 2ZM2A 4JLFA 1CQAA 3KSIA 2XA7S 3RTYA 1LL9A 3O5YA 1AXBA 3ZHHA 4ZTKA 5CHUA 3PBSA 1JVJA 3T50A 1UGUA 1XJ3A 1PRQA 1VB6A 1MWTA 2P08A 4YFMA 1FR6A 5J3WA 1SHVA 1MBLA 5HPFA 5G4ZA 5FEGA 2W3EA 2QYBA 5EE8A 1IFQA 2Y2GA 3MSHA 3K3CA 1ES3A 4E6XA 3H7WA 2HDQA 3KSHA 1SKOA 2HPBA 2EWWA 4GKUA 1ZG6A 4E3IA 3PBRA 5DF8A 5I94A 1PWDA 3P09A 5DTKA 3HCYA 5F1FA 1WYCA 2QJ7A 3JYIA 5IU1A 4EU0A 2I9VA 4U0TA 3BLMA 5GHXA 5KSCA 1BSGA 5J8XA 1LI9A 2BASA 5GHYA 3NOTC 1A0KA 4GOGA 3MZDA 3SS5A 2VGLS 3HLBA 4WZ5C 1ACFA 3WS4A 1YPRA 5M18A 2PAVP 4R23A 5F82A 3QNCA 1NLYA 1YLPA 1LSVA 3S7PA 3FC7A 3BFEA 1NY0A 1ZKJA 1LSWA 2OAQ1 3HLFA 2K2NA 3CZDA 3EQUA 2BTFP 3VP0A 3IX8A 2DRWA 5FQKA 4LRXC 1S0WA 4OPYA 1SDEA 2Y2QA 2C6WB 1LL8A 5A92A 4BJPA 4IEDA 5HDSA 3A0SA 1YMSA 3N7WA 4EESA 1OJ5A 3V5MA 4WYYA 2WGWA 3JPUA 4QU3A 2WGIA 1MKMA 3GR2A 5TFQA 2OOLA 2XDMA 3CPTA 1VETB 2VGLM 1I2SA 4NG2A 4D2OA 4LCLA 4PHTA 2ZL1B 1PW1A 1GA9A 2FFFB 4PAUA 4HJ4A 3PYPA 3M6HA 1TDLA 1SKFA 3BECA 4GD8A 1KE3A 5HARA 1CI9A 5FAPA 3W4OA 3P98A 3UDFA 3NJAA 5HX9A 3Q7VA 4PMAA 3ZG8B 5GLDA 3UO9A 4GW9A 2PRFA 2VV7A 2W3HA 4Y7PA 1JWVA 5DJUA 5HAIA 3PXPA 4H8RA 4Y5FA 5CECA 3EWKA 4HOIA 4UAAA 2P9VA 5FQMA 5CTNA 5GLAA 2QPNA 5IS1A 4LENA 1LI0A 4LV3A 3HREA 2JKRI 3QP1A 1YM1A 2Y91A 3O3VA 4Y0UA 2M7VA 1JTDA 1H8YA 4Q0HA 4ZAMA 1QMEA 1CF0A 2WZZA 3E2LA 3SS3A 2HP6A 4UA9A 1J3WA 4HBTA 3MR0A 1MXOA 5FAOA 4KZAA 4JXGA 4OPZA 4HY8A 3ZG7B 3CLOA 3Q81A 4PPRA 1N9BA 1Z6FA 3C2WA 1KGFA 3KYZA 3IF6C 3TOIA 1XJ4A 3OZHA 4MBKA 5CHJA 3MFXA 4DN0A 1MY8A 3BFCA 4GDNA 2J3WA 1O7EA 5HFOA 3WRTA 3BW6A 4EBLA 3LEZA 5CX7A 4S2NC 4HQAA 2V1AA 2JKFA 4L9EA 5LBRA 3VSKA 4K91A 2A24A 2OSUA 4EBNA 1E25A 1BTLA 1IYSA 1D1JA 1WYBA 4BLMA 4AFIA 3HLGA 1L0FA 2KDKA 3IH9A 4RX3A 2WUQA 1H8MA 2WAEA 3ZCZA 1ONHA 2Z6CA 1L0EA 1ESUA 3H82A 3TRCA 2VGJA 4WF0A 3MF0A 5L2FA 3LUQA 4Q0JA 5AQBA 5EVID 3FPVA 3SH7A 1OTEA 3UPOA 4OQHA 4BBUA 4QJGA 3T1RA 3ZG0A 3RJUA 1PI4A 3LIDA 2ZMAA 4HESA 1J9MA 4QWOA 1YQSA 3M2KA 4EXOA 4HIAA 3FWLA 2V1ZA 5FQJA 4DDSA 3LR0A 2ZM0A 3CUEC 3HUNA 1BZAA 3LI9A 4Z9QA 1PZPA 1DP9A 2XD5A 5EM1A 4Y0TA 5CEBA 2VV8A 4E6WA 1K6SA 1GHMA 2EX9A 4B4ZA 2QWSA 2H28A 1NRFA 2ZQ7A 4OVDA 3BJNA 1UWNX 1JWZA 4OP8A 3N8SA 4QY5A 1ZHHB 5L10A 4QD4A 3LR3A 5MC7A 4O8GA 4P6ZS 5TBMA 3RH8B 1OTIA 1YAXA 1F5MA 4BMWA 1LL5A 4XT2A 3IWQA 1ZC2A 1KVLA 3PAGA 3DTEA 4JF5A 1YSPA 2JBFA 2PU2A 1XA1A 3MKFA 2H0YA 5J4EA 2P7JA 2X01A 3LYXA 5A90A 4KZ4A 3WS5A 4Y0OA 2XRNA 1G28A 2R9XA 4LPZA 4MN6A 4MMNA 3M6BA 2HP5A 1W63Q 2KOIA 1XXMA 4G3KA 1PI5A 4B88A 4QY6A 1JNUA 4E3LA 1VHMA 4OLGA 4P6ZM 2WGVA 3E0YA 1GA0A 2ZQ9A 2UWXA 3O88A 2WZXA 3OPPA 3WS1A 2CMNA 4DJ2A 1HTZA 1M6KA 3U4LP 3T4SA 2ZMVA 4WZ5A 3OBFA 4D60A 2HDRA 2P74A 4OPRA 3KX0X 3CWFA 1K54A 4JF6A 4FSFA 4CLCE 1E3UA 3WRZA 3G30A 3C4PA 1ES4A 4OQIA 1CK3A 4P0MA 4OOYA 1IELA 1NYMA 3NI9A 3V39A 1D06A 4K0WA 4WLAA 3RXXA 3NECA 3ZYTA 3GECA 5DJTA 4DXBA 3A3DA 3NOUC 3BFGA 5AVEA 2XGNA 3B47A 4MN7A 1KE4A 2W3FA 1IKGA 4KG6A 1V9YA 4B93A 4LFUA 4PM8A 2HDUA 3QP4A 5EM0A 3IXHA 4UEYA 3IBRA 3MXQA 3NULA 4RX2A 1HD8A 4KG2A 1S67L 2LB5A 3LFVA 3DTIA 4G3VA 1DP6A 1RCJA 4R4RA 3GRJA 1TVFA 3LIBA 3VFFA 2V0WA 4Q0IA 2PT7A 5IHVA 3CMZA 3VOZA 1K55C 1YSQA 3AGDA 2ZBBA 5F5YA 3E98A 4ARZB 5L07A 4ZRRA 3VOLA 3IS2B 3UB8A 4EERA 3R4KA 1G6OA 1NLZA 5KMWA 2WK0A 3G2YA 4GDBA 5HAQA 3HLEA 2WKPA 3LR5A 3P7NA 3GSGA 3IXGA 4N9KA 1OT6A 4UA6A 2VGKA 3R7WB 2VLGA 4BWIA 1ERQA 3VSLA 3PR6A 2BG1A 4R3AA 3F1OA 4BENA 1TS0A 2Y2KA 3N8RA 5BOHA 3PAEA 3C7VA 2V20A 3BWLA 5EVIB 3GQZA 4U0XA 3TSGA 1PNEA 3IF6A 3DTKA 5HSQA 2Z2MB 3QP2A 1Y4OA 5AJGA 4GS9A 1YLYA 1FSYA 4C75A 3UB5P 2R78A 2JKTM 1T18A 1EI5A 2JHEA 3P01A 3OC2A 3UB9A 1MPLA 4S2NA 4E3NA 2OAP1 1PYYA 3GVBA 1XFNA 2EXBA 3O86A 4Q8IA 2XA7M 3ZGAB 3BQAA 1WE4A 3V67A 2V2FF 2O99A 4EEPA 3S7QA 2EX6A 4P85A 3VP2A 3QHYA 1XJ6A 4Y3IA 3MQOA 4DE2A 4OOMA 2XK1A 5FATA 4O0PA 2OWHA 5DKLA 3BFFA 3BLSA 4H6JA 4X1LA 4R3JA 2J3TC 3VP3A 3PBTA 4IBRA 5FQ9A 1DP8A 4S2IA 1BT5A 4IUKA 5F83A 4NEED 1TS7A 4CLCA 3O87A 4EQ1A 3HBRA 2E8IA 4X53A 4HJ3A 4LGWA 4UA7A 2Y59A 4LRZE 3IWOA 2V0UA 3E2KA 2EWVA 4HP9A 3OOVA 3CJMA 4KQRA 1RGZA 3CUEA 1VM1A 5M19A 4I5SA 1OTDA 4WMCD 3Q82A 5HWVA 5FI7A 2RCXA 4F3LA 4G3WA 1DRMA 5A93A 5J7EA 2E8JA 2XSSA 1FCMA 2W3DA 4BD0A 3B42A 2W1TB 4OPQA 3UPPA 3LGOA 4LCMA 3UMDA 1K4EA 2ACGA 4IVKA 2I72A 1BYWA 5EOEA 3DTMA 3F1PA 2INWA 3WS0A 1S66L 1RP5A 2ZMFA 1S1YA 2KLIA 2XLNA 3F1OB 4JGQA 3F1NA 4N1HA 3EEAA 5CEDA 4OH0A 4DJ3A 3TJZC 4C3QA 4QPRA 3RXWA 4FH2A 1Y54A 3EEHA 5HWTA 3VP1A 2L0WA 4WZ4A 3IXBA 3UE0A 3S4XA 4BBTA 2W27A 1IKIA 4YINA 3UPNA 1YT4A 4NXGA 2QKPA 1BLSA 2PR6A 3H7WB 3TW8A 2RL3A 1SKOB 4JGRA 3ITBA 3ZVTA 4GZBA 3SH8A 1YLWA 5AQAA 2V9AA 3EQVA 2XROA 4KQDA 3A3EA 2QJ5A 1S4RA 3IBJA 4WN5A 2B5RA 4OKPA 2O9CA 5JYPA 1F98A 2JCHA 4DE3A 2VA0A 2WKEA 1Q2PA 1YLJA 1K56A 1I2WA 4P6BA 1N9NA 2JE5A 4S2KA 3VMAA 2L1MA 4H6JB 1DJCA 3E4OA 2K31A 4PM6A 5E2HA 1PIOA 1YMXA 3QP6A 3DW0A 1TF1A 2G2WA 3C38A 4WUJA 2VK3A 1ES5A 1WA9A 1PW8A 1JWPA 1XGJA 4JF4A 2ZQDA 2HJ9C 3NCKA 3C30A 1H8ZA 4CLCB 3LIAA 4S2JA 5CHMA 3SH9A 2Z2LB 4KZ5A 4S2OA 3T4LA 1W63M 3M2JA 3UE3A 3LR4A 4CJNA 3T4KA 4K0XA 1K4FA 2ZOIA 3OPHA 1U60A 3N6IA 2B95A 4F3LB 3HLDA 5EPHA 2WGWB 4I38A 3ZNYA 4EETB 3AGEA 4RQ9A 1XPBA 3IQAA 3CPTB 4ZDXA 4BQMA 4EW7A 2WADA 2Y8HA 4IJGA 5I5LA 4RA7A 3NDGA 5HDDA 2W1RA 2PHYA 1N4OA 5CTMA 1K57A 2FH5A 1BLPA 1KVMA 1CJFA 2HV1A 2J80A 4EV4A 2JC7A 4GNUA 3MMHA 1YLTA 3OCLA 4KUKA 3VE3A 4ESPA 3K3DA 3Q7VB 3VOYA 2Y55A 3BM6A 1PWCA 3ZQ5A 4B9OA 4XUXA 1GCEA 2HDSA 3T4JA 2D01A 3HLWA 1NYYA 1E3UD 2P9VB 3Q07A 5EVLA 3U2AA 1VEUA 1IYPA 3T1QB 2OWJA 4P87A 3T12B 1M40A 1ZG4A 5E2GA 4R70A 1QMFA 5G18A 5DFXA 5FDSA 4GN2A 4HNBA 2PBYA 3A0RA 4IUHA 2JKTI 3MBZA 2UV0E 4HJ6A 1MZUA 4Z1WA 3SS4A 5EECA 4GLQA 1XP4A 3KYEA 5CGWA 1OPXA 3HUOA 2M1CA 4KZ9A 2Z6DA 4YWZA 1FCNA 3FKWA 3CI6A 4RYEA 4DE1A 1CI8A 4GJ4A 4N9LA 3AGFA 4U3TA 3EGXC 1LT0A 4X55A 4WEKA 4DRTA 3MZEA 1OT9A 2V1BA 1BLHA 2WKIA 2NUPC 4KUOA 3BQ8A 3VP4A 4L9GA 5HL6A 4M4XA 2ZM8A 5IT5A 1XGIA 2A24B 5F1GA 4LLOB 5FEFA 4MCWA 4KG5A 4EWFA 3G2ZA 4CPKA 1XX2A 2ZD8A 3BFDA 1OTBA 1FOFA 3CITA 4EBPA 1RGYA 1DJBA 4NKPA 4R0QA 2G2UA 3H82B 5EV0A 3HL9A 3Q1FA 1TS6A 4PKYA 4X6TA 1KOUA 2Q0OA 5EOOA 4MNRA 2PU4A 3HJIA 3MXRA 4MN5A 1XFQA 3IT9A 3W4PA 1W7FA 3VE4A 4MBFA 3DWZA 2P04A 3LEQA 2JKRM 3PBQA 4ID4A 4ME4A 4FOFA 3SOIA 3FPWA 5DVAA 4R6LA 3H9WA 5G4YA 4I3AA 3TG9A 5CGSA 3T4TA 4C6YA 1UWPX 4GB7A 5TGFA 4UQIS 1KDWA 2KX6A 5KIZA 5GL9A 3MXSA 1E4DA 3WS2A 4E3JA 5DKKA 5E2FA 2G7UA 3HJKA 3A3IA 3LI8A 4N1XA 3FV7A 4QHCA 4KZBA 3GMWA 3UB7A 2X71A 1PZOA 4EUZA 3G6OA 5TBMB 1MKIA 2A2LA 1NZUA 5CXWA 3MKEA 4XT2B 5KSHA 2VEAA
chains in the Genus database with same CATH topology
4DN0A 4R38A 5C5KA 2IA2A 3BY9A 2J3WA 4IUKA 4CLCD 5HD5A 4LRYC 4NEED 1TS7A 4HH2A 4CLCA 3BW6A 4GHIA 4OOLA 4EQ1A 5CX7A 4WL9A 4NXFA 4HJ3A 1OTAA 5A8BA 4ARZA 4HQAA 2V1AA 4LRZE 4L9EA 2V0UA 5LBRA 2EWVA 2HGVA 4HP9A 2B18A 3IS2A 1TD5A 1P0ZA 4UQIM 3LIFA 3OOVA 2A24A 3CUEA 4I5SA 1OTDA 1EW0A 3S7OA 1YKDA 4HP4A 5HWVA 5HZHA 1TS8A 5F69A 2GX5A 2D02A 4F3LA 4BBVA 4AFIA 4G3WA 1DRMA 5J7EA 2O9AA 2KDKA 2XSSA 2W3DA 3R7WA 3B42A 2W1TB 3A0VA 5FL3A 1H8MA 3OCNA 3UMDA 1P9WA 2Z6CA 3H82A 3EOIA 3PBOA 2W3GA 3TRCA 2PD7A 1T19A 1BYWA 3E4PA 3ICYA 4WF0A 5AVFA 3MF0A 3LUQA 4Q0JA 3KO6A 5K5BA 3FPVA 2FZ0A 3F1PA 4I3JA 3PHYA 2INWA 3B33A 1OTEA 1S66L 4I3IA 5HPIA 2O9BA 2LB9A 4E04A 2ZMFA 1S1YA 2KLIA 2VJWA 4BBUA 3F1OB 4JGQA 2PR5A 3F1NA 3SW1A 3LIDA 3EEAA 1F9IA 3CAXA 2PD8A 2WKRA 2YKHA 4WEJA 2JN7A 1N9LA 4O01A 4EXOA 3MJQA 4HIAA 4DJ3A 5EFWA 5L8MA 4YOFA 2M7UA 3TJZC 3LR0A 3CUEC 4QPRA 3JVUA 2VX8A 3LI9A 3EEHA 4GCZA 1P9RA 2GZAA 5HWTA 4ETXA 1DP9A 3S7NA 2L0WA 3C8CA 2VV8A 4BBTA 1IOUA 2W27A 3KSFA 4NXGA 2QWSA 2H28A 2QKPA 2PR6A 3H7WB 3TW8A 4HH3A 3BJNA 1UWNX 4JGRA 3UE6A 4L0LA 3LICA 2V9AA 3EQVA 2XROA 4KQDA 1ZHHB 2QJ5A 1S4RA 3IBJA 4WN5A 3LR3A 1GSVA 3TE8A 2O9CA 5MC7A 4O8GA 4P6ZS 5TBMA 3RH8B 1F98A 4ETZA 1OTIA 1YAXA 2VA0A 1F5MA 4BMWA 1GSWA 4HHDA 1STZA 4XT2A 1S4SA 4EEUA 1N9NA 4II7A 2L1MA 3RFBA 1XJ2A 4H6JB 3E4OA 1YSPA 2K31A 5J4EA 2P7JA 1TF1A 1GSXA 3C38A 4WUJA 2HF6A 1Y28A 2WKQA 3LYXA 4EUVA 1WA9A 2PYPA 1NWZA 3W2ZA 2HJ9C 5HDCA 5HD3A 3C30A 2PYRA 3D3OA 3LIAA 4I39A 2NUTC 4CLCB 3UB6A 2K7SA 2XRNA 4GHIB 1G28A 2ZOHA 3T4LA 4LPZA 4MN6A 4MMNA 4KQOA 1W63M 1W63Q 2KOIA 1T1BA 3UE3A 3LR4A 3T4KA 2W1TA 4G3KA 5F6AA 1LSXA 2ZOIA 1JNUA 1VHMA 1D7EA 4L9FA 3DBAA 4P6ZM 3LIEA 4F3LB 5F68A 4JGOA 2VV6A 2W0NA 4I38A 3E0YA 4YNRA 4EETB 4RQ9A 4PKYG 3KSIA 2XA7S 3FG8A 3RTYA 3O5YA 3T4OA 3JVVA 4EW7A 2Y8HA 2CMNA 4IJGA 5I5LA 4DJ2A 3PBSA 5HDDA 2W1RA 2PHYA 3T50A 1UGUA 5DFYA 3T4SA 2FH5A 2HV1A 2J80A 3MMHA 2ZMVA 3OCLA 4KUKA 3VE3A 1XJ3A 3K3DA 3OBFA 1VB6A 4NXEA 2P08A 4GS9B 3ZQ5A 2B02A 4B9OA 5J3WA 1N9OA 3KX0X 3T4JA 5HPFA 5G4ZA 2D01A 3CWFA 4FSFA 4CLCE 2W3EA 4HI4A 3U2AA 2QYBA 1IFQA 4IHQA 3OLOA 2DMWA 2OWJA 2GNXA 1ODVA 3K3CA 4R70A 3H7WA 1S1ZA 5DFXA 3KSHA 1D06A 4HNBA 2EWWA 4WLAA 4Y2FA 2O0YA 3ZYTA 3A0RA 3GECA 3PBRA 4IUHA 2JKTI 5DJTA 4HJ6A 3NOUC 3HCYA 5AVEA 3PBNA 3B47A 2QHKA 4MN7A 1MZUA 2QJ7A 5IU1A 4Z1WA 4EU0A 2I9VA 2W3FA 4GLQA 1V9YA 3MQQA 4B93A 1OPXA 2BASA 3NOTC 2M1CA 5HWWA 2Z6DA 4UEYA 4YWZA 2VGLS 3IBRA 3ULFA 3MXQA 3CI6A 3KSGA 3UMEA 2GJ3A 4GJ4A 1S67L 2LB5A 3NOPC 3LFVA 3EGXC 4G3VA 1LT0A 1MC0A 4WEKA 1DP6A 1NLYA 1LSVA 2L4RA 3S7PA 1OT9A 3FC7A 3LIBA 2V1BA 2V0WA 4Q0IA 4WELA 1LSWA 2OAQ1 2PT7A 2NUPC 4KUOA 2K2NA 3BQ8A 1YSQA 4L9GA 2ZBBA 3KYQA 5F5YA 3E98A 4CQHA 3EQUA 5HL6A 4ARZB 4ZRRA 4M4XA 4LRXC 3VOLA 3IS2B 3UB8A 4EERA 5IT5A 3R4KA 2A24B 4LLOB 1G6OA 1P97A 1NLZA 2Y79A 4MCWA 1LL8A 4BJPA 5HDSA 3A0SA 2WKPA 3LR5A 3P7NA 4EESA 1OJ5A 1OT6A 1OTBA 3CITA 3R7WB 1MKMA 2VLGA 4BWIA 2OOLA 2VZWA 2VGLM 3GDIA 4NKPA 5DF9A 3PR6A 3EGDC 1H3QA 4PHTA 3H82B 1V9ZA 4R3AA 3F1OA 1TS0A 4PAUA 4HJ4A 3K2NA 3PYPA 1T1AA 4K08A 1TS6A 3BWLA 3T4QA 4PKYA 1KOUA 3F1PB 3HJIA 2HJEA 4MN5A 2PDRA 1XFQA 2J3TD 3NJAA 3VE4A 5HSQA 4JGPA 4GW9A 2P04A 2VV7A 2W3HA 3F1NB 5AJGA 4GS9A 4CLCC 2EA9A 2JKRM 3PBQA 5DJUA 3PXPA 4ME4A 4Y5FA 3MQ0A 3EWKA 4FOFA 3NHQA 2YKFA 3FPWA 4HOIA 4R6LA 1ZTUA 3H9WA 2R78A 2JKTM 5G4YA 5IS1A 1T18A 4I3AA 2MJ6A 2JHEA 1X0OA 2JKRI 3P01A 3OC2A 3UB9A 2OAP1 4NXBA 3T4TA 1UWPX 1XFNA 2M7VA 4UQIS 2KX6A 2XA7M 4Q0HA 1T1CA 5KIZA 3BQAA 3E4QA 3VV4A 5TJJA 3V67A 2O99A 4EEPA 3S7QA 5DKKA 3D72A 2G7UA 1OJGA 3HJKA 3MR0A 3LI8A 1XJ6A 4Y3IA 4MDZA 3MQOA 4OOMA 3BY8A 4O0PA 2OWHA 5DKLA 3UB7A 4HY8A 4H6JA 3G6OA 5TBMB 2VKSA 2A2LA 3CLOA 1NRJA 2J3TC 3C2WA 3KYZA 3PBTA 4DMZA 1XJ4A 4XT2B 1DP8A 5KSHA 2VEAA 3MFXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U2A A; 
#chains in the Genus database with same CATH topology
 4OQ0 A;  4DE0 A;  1L2S A;  4R38 A;  2ZC4 B;  1FIK A;  3BY9 A;  2J9O A;  4CLC D;  1VQQ A;  5HD5 A;  3UNW A;  1MWS A;  4OOL A;  4WL9 A;  4NXF A;  5E43 A;  4Y13 A;  2Y4A A;  5AQ9 A;  2B18 A;  2Q9N A;  4UQI M;  2JKG A;  3LIF A;  3S1Y A;  3DAV A;  1W8Q A;  4HP4 A;  2A49 A;  1TS8 A;  4S2L A;  1GHP A;  2GX5 A;  1W5D A;  3V3S A;  3IX4 A;  5FI6 A;  1KE0 A;  2O9A A;  3N4I A;  3A0V A;  2QZ6 A;  3C4O A;  2PBD P;  4A5R A;  5FL3 A;  1VET A;  4JXS A;  1K0K A;  4X25 A;  2ZL1 A;  2XR0 A;  3PBO A;  4PM5 A;  1DJA A;  2PD7 A;  2WYX A;  1S6R A;  4FCF A;  2J7V A;  4I3J A;  5CER A;  1W8Y A;  3B33 A;  4HEF A;  3UDI A;  5HPI A;  4FTX A;  4E04 A;  3NBL A;  4DF6 A;  2PR5 A;  3MS6 A;  1F9I A;  3G35 A;  2CC1 A;  2YKH A;  4GD6 A;  4WEJ A;  1EWZ A;  1N9L A;  4O01 A;  3MJQ A;  1ALQ A;  5EFW A;  5L8M A;  5HAP A;  4YOF A;  5GHZ A;  2M7U A;  5U47 A;  2VX8 A;  4GCZ A;  1P9R A;  3DWK A;  3S7N A;  2C5W B;  3C8C A;  2XD1 A;  5DF7 A;  1TDG A;  3OPL A;  3V50 A;  1SCW A;  1I5Q A;  4HH3 A;  1FCO A;  4L0L A;  2ZC7 A;  1DY6 A;  3FYZ A;  2X02 A;  4JPM A;  1KDS A;  4ZBE A;  5EVI C;  2R9W A;  3TE8 A;  2ZQC A;  2ZLY A;  5CGX A;  4ETZ A;  3QP5 A;  1K56 D;  4MBH A;  4R4S A;  1CEF A;  5FAQ A;  1S4S A;  5KZH A;  4EEU A;  2HZ5 A;  3S22 A;  4II7 A;  2XFT A;  3RFB A;  2FFY A;  3IHA A;  4F94 A;  1PWG A;  3ZG5 A;  3ZG9 B;  5FAS A;  3ITA A;  2IWD A;  4LV1 A;  4EUV A;  1LHY A;  3Q7Z A;  3W2Z A;  1K54 C;  4BL2 A;  5HDC A;  2PYR A;  3UB6 A;  2K7S A;  1AWI A;  4Y15 A;  5GLB A;  3I7J A;  2Y2I A;  1NXY A;  3G32 A;  3UY6 A;  3HUM A;  1D7E A;  2XQZ A;  4L9F A;  1ERM A;  1G6A A;  5GLC A;  3LIE A;  3LCE A;  5F68 A;  4FUW A;  4JGO A;  3BRM A;  2W0N A;  4YNR A;  2WKH A;  4R3B A;  2H5S A;  4PKY G;  3FG8 A;  4UHU A;  3T4O A;  5E2E A;  3JVV A;  5FA7 A;  3G31 A;  3GTC A;  1FIL A;  3C7U A;  5DFY A;  3ZNT A;  1IEM A;  2H10 A;  4KZ6 A;  3NY4 A;  1YLZ A;  3ZVW A;  3IF6 B;  3V3R A;  1XA7 A;  1JTG A;  3UDX A;  4X68 A;  4NXE A;  4GS9 B;  2Y2O A;  1MWR A;  2B02 A;  1N9O A;  3D9Y A;  4MEZ A;  4HI4 A;  4IHQ A;  3FZC A;  3OLO A;  2DMW A;  2GNX A;  1ODV A;  2DCF A;  1S1Z A;  1LLB A;  2V8C A;  4Y2F A;  1FSW A;  2O0Y A;  3GV9 A;  5FQQ A;  2Q9M A;  3W8K A;  3PBN A;  1K25 A;  2QHK A;  4R1G A;  5FQI A;  3MQQ A;  5HW3 A;  5D3O A;  5EUA A;  5HWW A;  4RVA A;  3T1S A;  1NJ4 A;  4E3K A;  3ULF A;  1IYQ A;  4S2P A;  3KSG A;  3UME A;  4XXR A;  2GJ3 A;  3IHB A;  4JXV A;  3NOP C;  3L7H A;  1MC0 A;  4WM9 A;  2ZC6 B;  4KQQ A;  4ZJ2 A;  2L4R A;  4PM7 A;  1OME A;  2OV5 A;  4WEL A;  1K6R A;  3CHW P;  1XKZ A;  3KYQ A;  4CQH A;  3B3X A;  3IXD A;  4E3O A;  2Y2J A;  1ESI A;  1P97 A;  2Y79 A;  4ZJ1 A;  4WMC A;  1G5U A;  2IWC A;  1L3L A;  4E3M A;  2Y2H A;  2ZQA A;  3IWI A;  2WAF A;  4OON A;  4DKI A;  3NIA A;  1KGE A;  1SDN A;  2VZW A;  3GDI A;  5DF9 A;  3EGD C;  3A3J A;  1H3Q A;  1ERO A;  1V9Z A;  4WBG A;  5A91 A;  5M1A A;  4Y17 A;  3K2N A;  1T1A A;  2J9P A;  4K08 A;  4DDY A;  1W79 A;  1HVB A;  3T4Q A;  1Q2Q A;  4B4X A;  3F1P B;  2HJE A;  1O07 A;  4NK3 A;  2PDR A;  1ONG A;  4MLL A;  2J3T D;  5CRF A;  4JGP A;  4N92 A;  2OLU A;  3F1N B;  2OLV A;  2Y2L A;  4CLC C;  2GDN A;  4JBF A;  2EA9 A;  4JXW A;  3IX3 A;  1Z09 A;  3MQ0 A;  2ZC5 B;  1F2K A;  2YKF A;  3NHQ A;  4S2M A;  1ZTU A;  1MWU A;  2XH9 A;  1K55 A;  3MFD A;  2MJ6 A;  1HZO A;  1X0O A;  2ZC3 B;  3BEB A;  4LV2 A;  1BUE A;  1KGG A;  4NXB A;  1HLU P;  4IBX A;  2EFX A;  3NDE A;  1T1C A;  1H0M A;  3E4Q A;  3VV4 A;  5TJJ A;  3VFH A;  4IVI A;  5L09 A;  2DNS A;  3NC8 A;  3D72 A;  2EX2 A;  1OJG A;  3ZFZ A;  4MDZ A;  3BY8 A;  1H5X A;  5DTS A;  2VKS A;  3UN7 A;  1NRJ A;  1CEG A;  4DMZ A;  5DTT A;  1G68 A;  2IWB A;  3LO7 A;  5C5K A;  2IA2 A;  2XEP A;  4FD8 A;  4LRY C;  4HH2 A;  3OPR A;  4GHI A;  4OLD A;  1OTA A;  5A8B A;  3LY4 A;  4ARZ A;  4DXC A;  2HGV A;  3IS2 A;  1TD5 A;  1P0Z A;  4HBU A;  3HLC A;  4QB8 A;  1EW0 A;  3S7O A;  1YKD A;  4NET A;  5HZH A;  5F69 A;  3D4F A;  2D02 A;  1GHI A;  4BBV A;  1ES2 A;  4BD1 A;  1NZO A;  3R7W A;  3FKV A;  3SZT A;  3ISG A;  2QMI A;  3OCN A;  4KZ8 A;  1P9W A;  2EXA A;  1L0D A;  4JKT A;  5HL1 A;  4OQG A;  3EOI A;  2V8F A;  2W3G A;  2A3U A;  1T19 A;  3E4P A;  3ICY A;  5AVF A;  2HP9 A;  3KO6 A;  4FH4 A;  5K5B A;  2ZJ9 A;  2FZ0 A;  3PHY A;  2Y2N A;  2XF3 A;  5EVI A;  1C3B A;  4I3I A;  2O9B A;  2LB9 A;  4BL3 A;  2VJW A;  4XUZ A;  3SW1 A;  3CAX A;  1BUL A;  2PD8 A;  2WKR A;  4KZ7 A;  2H0T A;  2JN7 A;  3G4P A;  3UE1 A;  2Y2P A;  2J8Y A;  4X1M A;  3JVU A;  2GZA A;  4ETX A;  3L9K A;  4LV0 A;  3HVF A;  1VEU B;  1IOU A;  3WWX A;  3KSF A;  5FI2 A;  3CG5 A;  5TR7 A;  3W4Q A;  2EFU A;  4KEN B;  4X69 A;  4KZ3 A;  3UE6 A;  1TEM A;  3T1X A;  3LIC A;  5FSR A;  2ZQ8 A;  4X56 A;  3PTE A;  2BLS A;  2AVX A;  1GSV A;  4ZJ3 A;  1GSW A;  3G34 A;  4HHD A;  1STZ A;  4O7D A;  1K38 A;  1K57 C;  4M3K A;  1IYO A;  3LY3 A;  1BLC A;  1XJ2 A;  3ZDJ A;  3QP8 A;  3N8L A;  3MZF A;  2Y2M A;  3IH8 A;  1FR1 A;  1GSX A;  2HF6 A;  5AQ7 A;  1Y28 A;  2WKQ A;  4OP5 A;  2PYP A;  1NWZ A;  5FDH A;  5HD3 A;  3QNB A;  3D3O A;  4I39 A;  2EX8 A;  2NUT C;  1L0G A;  4GHI B;  3C5A A;  2ZOH A;  3IF5 A;  4KQO A;  1PFL A;  1T1B A;  5EVE A;  2XFS A;  1SZV A;  3BYD A;  2W1T A;  5JYO A;  5F6A A;  4PM9 A;  1LSX A;  1FQG A;  4EQI A;  3A3F A;  3DBA A;  2VV6 A;  2ZM2 A;  4JLF A;  1CQA A;  3KSI A;  2XA7 S;  3RTY A;  1LL9 A;  3O5Y A;  1AXB A;  3ZHH A;  4ZTK A;  5CHU A;  3PBS A;  1JVJ A;  3T50 A;  1UGU A;  1XJ3 A;  1PRQ A;  1VB6 A;  1MWT A;  2P08 A;  4YFM A;  1FR6 A;  5J3W A;  1SHV A;  1MBL A;  5HPF A;  5G4Z A;  5FEG A;  2W3E A;  2QYB A;  5EE8 A;  1IFQ A;  2Y2G A;  3MSH A;  3K3C A;  1ES3 A;  4E6X A;  3H7W A;  2HDQ A;  3KSH A;  1SKO A;  2HPB A;  2EWW A;  4GKU A;  1ZG6 A;  4E3I A;  3PBR A;  5DF8 A;  5I94 A;  1PWD A;  3P09 A;  5DTK A;  3HCY A;  5F1F A;  1WYC A;  2QJ7 A;  3JYI A;  5IU1 A;  4EU0 A;  2I9V A;  4U0T A;  3BLM A;  5GHX A;  5KSC A;  1BSG A;  5J8X A;  1LI9 A;  2BAS A;  5GHY A;  3NOT C;  1A0K A;  4GOG A;  3MZD A;  3SS5 A;  2VGL S;  3HLB A;  4WZ5 C;  1ACF A;  3WS4 A;  1YPR A;  5M18 A;  2PAV P;  4R23 A;  5F82 A;  3QNC A;  1NLY A;  1YLP A;  1LSV A;  3S7P A;  3FC7 A;  3BFE A;  1NY0 A;  1ZKJ A;  1LSW A;  2OAQ 1;  3HLF A;  2K2N A;  3CZD A;  3EQU A;  2BTF P;  3VP0 A;  3IX8 A;  2DRW A;  5FQK A;  4LRX C;  1S0W A;  4OPY A;  1SDE A;  2Y2Q A;  2C6W B;  1LL8 A;  5A92 A;  4BJP A;  4IED A;  5HDS A;  3A0S A;  1YMS A;  3N7W A;  4EES A;  1OJ5 A;  3V5M A;  4WYY A;  2WGW A;  3JPU A;  4QU3 A;  2WGI A;  1MKM A;  3GR2 A;  5TFQ A;  2OOL A;  2XDM A;  3CPT A;  1VET B;  2VGL M;  1I2S A;  4NG2 A;  4D2O A;  4LCL A;  4PHT A;  2ZL1 B;  1PW1 A;  1GA9 A;  2FFF B;  4PAU A;  4HJ4 A;  3PYP A;  3M6H A;  1TDL A;  1SKF A;  3BEC A;  4GD8 A;  1KE3 A;  5HAR A;  1CI9 A;  5FAP A;  3W4O A;  3P98 A;  3UDF A;  3NJA A;  5HX9 A;  3Q7V A;  4PMA A;  3ZG8 B;  5GLD A;  3UO9 A;  4GW9 A;  2PRF A;  2VV7 A;  2W3H A;  4Y7P A;  1JWV A;  5DJU A;  5HAI A;  3PXP A;  4H8R A;  4Y5F A;  5CEC A;  3EWK A;  4HOI A;  4UAA A;  2P9V A;  5FQM A;  5CTN A;  5GLA A;  2QPN A;  5IS1 A;  4LEN A;  1LI0 A;  4LV3 A;  3HRE A;  2JKR I;  3QP1 A;  1YM1 A;  2Y91 A;  3O3V A;  4Y0U A;  2M7V A;  1JTD A;  1H8Y A;  4Q0H A;  4ZAM A;  1QME A;  1CF0 A;  2WZZ A;  3E2L A;  3SS3 A;  2HP6 A;  4UA9 A;  1J3W A;  4HBT A;  3MR0 A;  1MXO A;  5FAO A;  4KZA A;  4JXG A;  4OPZ A;  4HY8 A;  3ZG7 B;  3CLO A;  3Q81 A;  4PPR A;  1N9B A;  1Z6F A;  3C2W A;  1KGF A;  3KYZ A;  3IF6 C;  3TOI A;  1XJ4 A;  3OZH A;  4MBK A;  5CHJ A;  3MFX A;  4DN0 A;  1MY8 A;  3BFC A;  4GDN A;  2J3W A;  1O7E A;  5HFO A;  3WRT A;  3BW6 A;  4EBL A;  3LEZ A;  5CX7 A;  4S2N C;  4HQA A;  2V1A A;  2JKF A;  4L9E A;  5LBR A;  3VSK A;  4K91 A;  2A24 A;  2OSU A;  4EBN A;  1E25 A;  1BTL A;  1IYS A;  1D1J A;  1WYB A;  4BLM A;  4AFI A;  3HLG A;  1L0F A;  2KDK A;  3IH9 A;  4RX3 A;  2WUQ A;  1H8M A;  2WAE A;  3ZCZ A;  1ONH A;  2Z6C A;  1L0E A;  1ESU A;  3H82 A;  3TRC A;  2VGJ A;  4WF0 A;  3MF0 A;  5L2F A;  3LUQ A;  4Q0J A;  5AQB A;  5EVI D;  3FPV A;  3SH7 A;  1OTE A;  3UPO A;  4OQH A;  4BBU A;  4QJG A;  3T1R A;  3ZG0 A;  3RJU A;  1PI4 A;  3LID A;  2ZMA A;  4HES A;  1J9M A;  4QWO A;  1YQS A;  3M2K A;  4EXO A;  4HIA A;  3FWL A;  2V1Z A;  5FQJ A;  4DDS A;  3LR0 A;  2ZM0 A;  3CUE C;  3HUN A;  1BZA A;  3LI9 A;  4Z9Q A;  1PZP A;  1DP9 A;  2XD5 A;  5EM1 A;  4Y0T A;  5CEB A;  2VV8 A;  4E6W A;  1K6S A;  1GHM A;  2EX9 A;  4B4Z A;  2QWS A;  2H28 A;  1NRF A;  2ZQ7 A;  4OVD A;  3BJN A;  1UWN X;  1JWZ A;  4OP8 A;  3N8S A;  4QY5 A;  1ZHH B;  5L10 A;  4QD4 A;  3LR3 A;  5MC7 A;  4O8G A;  4P6Z S;  5TBM A;  3RH8 B;  1OTI A;  1YAX A;  1F5M A;  4BMW A;  1LL5 A;  4XT2 A;  3IWQ A;  1ZC2 A;  1KVL A;  3PAG A;  3DTE A;  4JF5 A;  1YSP A;  2JBF A;  2PU2 A;  1XA1 A;  3MKF A;  2H0Y A;  5J4E A;  2P7J A;  2X01 A;  3LYX A;  5A90 A;  4KZ4 A;  3WS5 A;  4Y0O A;  2XRN A;  1G28 A;  2R9X A;  4LPZ A;  4MN6 A;  4MMN A;  3M6B A;  2HP5 A;  1W63 Q;  2KOI A;  1XXM A;  4G3K A;  1PI5 A;  4B88 A;  4QY6 A;  1JNU A;  4E3L A;  1VHM A;  4OLG A;  4P6Z M;  2WGV A;  3E0Y A;  1GA0 A;  2ZQ9 A;  2UWX A;  3O88 A;  2WZX A;  3OPP A;  3WS1 A;  2CMN A;  4DJ2 A;  1HTZ A;  1M6K A;  3U4L P;  3T4S A;  2ZMV A;  4WZ5 A;  3OBF A;  4D60 A;  2HDR A;  2P74 A;  4OPR A;  3KX0 X;  3CWF A;  1K54 A;  4JF6 A;  4FSF A;  4CLC E;  1E3U A;  3WRZ A;  3G30 A;  3C4P A;  1ES4 A;  4OQI A;  1CK3 A;  4P0M A;  4OOY A;  1IEL A;  1NYM A;  3NI9 A;  3V39 A;  1D06 A;  4K0W A;  4WLA A;  3RXX A;  3NEC A;  3ZYT A;  3GEC A;  5DJT A;  4DXB A;  3A3D A;  3NOU C;  3BFG A;  5AVE A;  2XGN A;  3B47 A;  4MN7 A;  1KE4 A;  2W3F A;  1IKG A;  4KG6 A;  1V9Y A;  4B93 A;  4LFU A;  4PM8 A;  2HDU A;  3QP4 A;  5EM0 A;  3IXH A;  4UEY A;  3IBR A;  3MXQ A;  3NUL A;  4RX2 A;  1HD8 A;  4KG2 A;  1S67 L;  2LB5 A;  3LFV A;  3DTI A;  4G3V A;  1DP6 A;  1RCJ A;  4R4R A;  3GRJ A;  1TVF A;  3LIB A;  3VFF A;  2V0W A;  4Q0I A;  2PT7 A;  5IHV A;  3CMZ A;  3VOZ A;  1K55 C;  1YSQ A;  3AGD A;  2ZBB A;  5F5Y A;  3E98 A;  4ARZ B;  5L07 A;  4ZRR A;  3VOL A;  3IS2 B;  3UB8 A;  4EER A;  3R4K A;  1G6O A;  1NLZ A;  5KMW A;  2WK0 A;  3G2Y A;  4GDB A;  5HAQ A;  3HLE A;  2WKP A;  3LR5 A;  3P7N A;  3GSG A;  3IXG A;  4N9K A;  1OT6 A;  4UA6 A;  2VGK A;  3R7W B;  2VLG A;  4BWI A;  1ERQ A;  3VSL A;  3PR6 A;  2BG1 A;  4R3A A;  3F1O A;  4BEN A;  1TS0 A;  2Y2K A;  3N8R A;  5BOH A;  3PAE A;  3C7V A;  2V20 A;  3BWL A;  5EVI B;  3GQZ A;  4U0X A;  3TSG A;  1PNE A;  3IF6 A;  3DTK A;  5HSQ A;  2Z2M B;  3QP2 A;  1Y4O A;  5AJG A;  4GS9 A;  1YLY A;  1FSY A;  4C75 A;  3UB5 P;  2R78 A;  2JKT M;  1T18 A;  1EI5 A;  2JHE A;  3P01 A;  3OC2 A;  3UB9 A;  1MPL A;  4S2N A;  4E3N A;  2OAP 1;  1PYY A;  3GVB A;  1XFN A;  2EXB A;  3O86 A;  4Q8I A;  2XA7 M;  3ZGA B;  3BQA A;  1WE4 A;  3V67 A;  2V2F F;  2O99 A;  4EEP A;  3S7Q A;  2EX6 A;  4P85 A;  3VP2 A;  3QHY A;  1XJ6 A;  4Y3I A;  3MQO A;  4DE2 A;  4OOM A;  2XK1 A;  5FAT A;  4O0P A;  2OWH A;  5DKL A;  3BFF A;  3BLS A;  4H6J A;  4X1L A;  4R3J A;  2J3T C;  3VP3 A;  3PBT A;  4IBR A;  5FQ9 A;  1DP8 A;  4S2I A;  1BT5 A;  4IUK A;  5F83 A;  4NEE D;  1TS7 A;  4CLC A;  3O87 A;  4EQ1 A;  3HBR A;  2E8I A;  4X53 A;  4HJ3 A;  4LGW A;  4UA7 A;  2Y59 A;  4LRZ E;  3IWO A;  2V0U A;  3E2K A;  2EWV A;  4HP9 A;  3OOV A;  3CJM A;  4KQR A;  1RGZ A;  3CUE A;  1VM1 A;  5M19 A;  4I5S A;  1OTD A;  4WMC D;  3Q82 A;  5HWV A;  5FI7 A;  2RCX A;  4F3L A;  4G3W A;  1DRM A;  5A93 A;  5J7E A;  2E8J A;  2XSS A;  1FCM A;  2W3D A;  4BD0 A;  3B42 A;  2W1T B;  4OPQ A;  3UPP A;  3LGO A;  4LCM A;  3UMD A;  1K4E A;  2ACG A;  4IVK A;  2I72 A;  1BYW A;  5EOE A;  3DTM A;  3F1P A;  2INW A;  3WS0 A;  1S66 L;  1RP5 A;  2ZMF A;  1S1Y A;  2KLI A;  2XLN A;  3F1O B;  4JGQ A;  3F1N A;  4N1H A;  3EEA A;  5CED A;  4OH0 A;  4DJ3 A;  3TJZ C;  4C3Q A;  4QPR A;  3RXW A;  4FH2 A;  1Y54 A;  3EEH A;  5HWT A;  3VP1 A;  2L0W A;  4WZ4 A;  3IXB A;  3UE0 A;  3S4X A;  4BBT A;  2W27 A;  1IKI A;  4YIN A;  3UPN A;  1YT4 A;  4NXG A;  2QKP A;  1BLS A;  2PR6 A;  3H7W B;  3TW8 A;  2RL3 A;  1SKO B;  4JGR A;  3ITB A;  3ZVT A;  4GZB A;  3SH8 A;  1YLW A;  5AQA A;  2V9A A;  3EQV A;  2XRO A;  4KQD A;  3A3E A;  2QJ5 A;  1S4R A;  3IBJ A;  4WN5 A;  2B5R A;  4OKP A;  2O9C A;  5JYP A;  1F98 A;  2JCH A;  4DE3 A;  2VA0 A;  2WKE A;  1Q2P A;  1YLJ A;  1K56 A;  1I2W A;  4P6B A;  1N9N A;  2JE5 A;  4S2K A;  3VMA A;  2L1M A;  4H6J B;  1DJC A;  3E4O A;  2K31 A;  4PM6 A;  5E2H A;  1PIO A;  1YMX A;  3QP6 A;  3DW0 A;  1TF1 A;  2G2W A;  3C38 A;  4WUJ A;  2VK3 A;  1ES5 A;  1WA9 A;  1PW8 A;  1JWP A;  1XGJ A;  4JF4 A;  2ZQD A;  2HJ9 C;  3NCK A;  3C30 A;  1H8Z A;  4CLC B;  3LIA A;  4S2J A;  5CHM A;  3SH9 A;  2Z2L B;  4KZ5 A;  4S2O A;  3T4L A;  1W63 M;  3M2J A;  3UE3 A;  3LR4 A;  4CJN A;  3T4K A;  4K0X A;  1K4F A;  2ZOI A;  3OPH A;  1U60 A;  3N6I A;  2B95 A;  4F3L B;  3HLD A;  5EPH A;  2WGW B;  4I38 A;  3ZNY A;  4EET B;  3AGE A;  4RQ9 A;  1XPB A;  3IQA A;  3CPT B;  4ZDX A;  4BQM A;  4EW7 A;  2WAD A;  2Y8H A;  4IJG A;  5I5L A;  4RA7 A;  3NDG A;  5HDD A;  2W1R A;  2PHY A;  1N4O A;  5CTM A;  1K57 A;  2FH5 A;  1BLP A;  1KVM A;  1CJF A;  2HV1 A;  2J80 A;  4EV4 A;  2JC7 A;  4GNU A;  3MMH A;  1YLT A;  3OCL A;  4KUK A;  3VE3 A;  4ESP A;  3K3D A;  3Q7V B;  3VOY A;  2Y55 A;  3BM6 A;  1PWC A;  3ZQ5 A;  4B9O A;  4XUX A;  1GCE A;  2HDS A;  3T4J A;  2D01 A;  3HLW A;  1NYY A;  1E3U D;  2P9V B;  3Q07 A;  5EVL A;  3U2A A;  1VEU A;  1IYP A;  3T1Q B;  2OWJ A;  4P87 A;  3T12 B;  1M40 A;  1ZG4 A;  5E2G A;  4R70 A;  1QMF A;  5G18 A;  5DFX A;  5FDS A;  4GN2 A;  4HNB A;  2PBY A;  3A0R A;  4IUH A;  2JKT I;  3MBZ A;  2UV0 E;  4HJ6 A;  1MZU A;  4Z1W A;  3SS4 A;  5EEC A;  4GLQ A;  1XP4 A;  3KYE A;  5CGW A;  1OPX A;  3HUO A;  2M1C A;  4KZ9 A;  2Z6D A;  4YWZ A;  1FCN A;  3FKW A;  3CI6 A;  4RYE A;  4DE1 A;  1CI8 A;  4GJ4 A;  4N9L A;  3AGF A;  4U3T A;  3EGX C;  1LT0 A;  4X55 A;  4WEK A;  4DRT A;  3MZE A;  1OT9 A;  2V1B A;  1BLH A;  2WKI A;  2NUP C;  4KUO A;  3BQ8 A;  3VP4 A;  4L9G A;  5HL6 A;  4M4X A;  2ZM8 A;  5IT5 A;  1XGI A;  2A24 B;  5F1G A;  4LLO B;  5FEF A;  4MCW A;  4KG5 A;  4EWF A;  3G2Z A;  4CPK A;  1XX2 A;  2ZD8 A;  3BFD A;  1OTB A;  1FOF A;  3CIT A;  4EBP A;  1RGY A;  1DJB A;  4NKP A;  4R0Q A;  2G2U A;  3H82 B;  5EV0 A;  3HL9 A;  3Q1F A;  1TS6 A;  4PKY A;  4X6T A;  1KOU A;  2Q0O A;  5EOO A;  4MNR A;  2PU4 A;  3HJI A;  3MXR A;  4MN5 A;  1XFQ A;  3IT9 A;  3W4P A;  1W7F A;  3VE4 A;  4MBF A;  3DWZ A;  2P04 A;  3LEQ A;  2JKR M;  3PBQ A;  4ID4 A;  4ME4 A;  4FOF A;  3SOI A;  3FPW A;  5DVA A;  4R6L A;  3H9W A;  5G4Y A;  4I3A A;  3TG9 A;  5CGS A;  3T4T A;  4C6Y A;  1UWP X;  4GB7 A;  5TGF A;  4UQI S;  1KDW A;  2KX6 A;  5KIZ A;  5GL9 A;  3MXS A;  1E4D A;  3WS2 A;  4E3J A;  5DKK A;  5E2F A;  2G7U A;  3HJK A;  3A3I A;  3LI8 A;  4N1X A;  3FV7 A;  4QHC A;  4KZB A;  3GMW A;  3UB7 A;  2X71 A;  1PZO A;  4EUZ A;  3G6O A;  5TBM B;  1MKI A;  2A2L A;  1NZU A;  5CXW A;  3MKE A;  4XT2 B;  5KSH A;  2VEA A; 
#chains in the Genus database with same CATH homology
 4DN0 A;  4R38 A;  5C5K A;  2IA2 A;  3BY9 A;  2J3W A;  4IUK A;  4CLC D;  5HD5 A;  4LRY C;  4NEE D;  1TS7 A;  4HH2 A;  4CLC A;  3BW6 A;  4GHI A;  4OOL A;  4EQ1 A;  5CX7 A;  4WL9 A;  4NXF A;  4HJ3 A;  1OTA A;  5A8B A;  4ARZ A;  4HQA A;  2V1A A;  4LRZ E;  4L9E A;  2V0U A;  5LBR A;  2EWV A;  2HGV A;  4HP9 A;  2B18 A;  3IS2 A;  1TD5 A;  1P0Z A;  4UQI M;  3LIF A;  3OOV A;  2A24 A;  3CUE A;  4I5S A;  1OTD A;  1EW0 A;  3S7O A;  1YKD A;  4HP4 A;  5HWV A;  5HZH A;  1TS8 A;  5F69 A;  2GX5 A;  2D02 A;  4F3L A;  4BBV A;  4AFI A;  4G3W A;  1DRM A;  5J7E A;  2O9A A;  2KDK A;  2XSS A;  2W3D A;  3R7W A;  3B42 A;  2W1T B;  3A0V A;  5FL3 A;  1H8M A;  3OCN A;  3UMD A;  1P9W A;  2Z6C A;  3H82 A;  3EOI A;  3PBO A;  2W3G A;  3TRC A;  2PD7 A;  1T19 A;  1BYW A;  3E4P A;  3ICY A;  4WF0 A;  5AVF A;  3MF0 A;  3LUQ A;  4Q0J A;  3KO6 A;  5K5B A;  3FPV A;  2FZ0 A;  3F1P A;  4I3J A;  3PHY A;  2INW A;  3B33 A;  1OTE A;  1S66 L;  4I3I A;  5HPI A;  2O9B A;  2LB9 A;  4E04 A;  2ZMF A;  1S1Y A;  2KLI A;  2VJW A;  4BBU A;  3F1O B;  4JGQ A;  2PR5 A;  3F1N A;  3SW1 A;  3LID A;  3EEA A;  1F9I A;  3CAX A;  2PD8 A;  2WKR A;  2YKH A;  4WEJ A;  2JN7 A;  1N9L A;  4O01 A;  4EXO A;  3MJQ A;  4HIA A;  4DJ3 A;  5EFW A;  5L8M A;  4YOF A;  2M7U A;  3TJZ C;  3LR0 A;  3CUE C;  4QPR A;  3JVU A;  2VX8 A;  3LI9 A;  3EEH A;  4GCZ A;  1P9R A;  2GZA A;  5HWT A;  4ETX A;  1DP9 A;  3S7N A;  2L0W A;  3C8C A;  2VV8 A;  4BBT A;  1IOU A;  2W27 A;  3KSF A;  4NXG A;  2QWS A;  2H28 A;  2QKP A;  2PR6 A;  3H7W B;  3TW8 A;  4HH3 A;  3BJN A;  1UWN X;  4JGR A;  3UE6 A;  4L0L A;  3LIC A;  2V9A A;  3EQV A;  2XRO A;  4KQD A;  1ZHH B;  2QJ5 A;  1S4R A;  3IBJ A;  4WN5 A;  3LR3 A;  1GSV A;  3TE8 A;  2O9C A;  5MC7 A;  4O8G A;  4P6Z S;  5TBM A;  3RH8 B;  1F98 A;  4ETZ A;  1OTI A;  1YAX A;  2VA0 A;  1F5M A;  4BMW A;  1GSW A;  4HHD A;  1STZ A;  4XT2 A;  1S4S A;  4EEU A;  1N9N A;  4II7 A;  2L1M A;  3RFB A;  1XJ2 A;  4H6J B;  3E4O A;  1YSP A;  2K31 A;  5J4E A;  2P7J A;  1TF1 A;  1GSX A;  3C38 A;  4WUJ A;  2HF6 A;  1Y28 A;  2WKQ A;  3LYX A;  4EUV A;  1WA9 A;  2PYP A;  1NWZ A;  3W2Z A;  2HJ9 C;  5HDC A;  5HD3 A;  3C30 A;  2PYR A;  3D3O A;  3LIA A;  4I39 A;  2NUT C;  4CLC B;  3UB6 A;  2K7S A;  2XRN A;  4GHI B;  1G28 A;  2ZOH A;  3T4L A;  4LPZ A;  4MN6 A;  4MMN A;  4KQO A;  1W63 M;  1W63 Q;  2KOI A;  1T1B A;  3UE3 A;  3LR4 A;  3T4K A;  2W1T A;  4G3K A;  5F6A A;  1LSX A;  2ZOI A;  1JNU A;  1VHM A;  1D7E A;  4L9F A;  3DBA A;  4P6Z M;  3LIE A;  4F3L B;  5F68 A;  4JGO A;  2VV6 A;  2W0N A;  4I38 A;  3E0Y A;  4YNR A;  4EET B;  4RQ9 A;  4PKY G;  3KSI A;  2XA7 S;  3FG8 A;  3RTY A;  3O5Y A;  3T4O A;  3JVV A;  4EW7 A;  2Y8H A;  2CMN A;  4IJG A;  5I5L A;  4DJ2 A;  3PBS A;  5HDD A;  2W1R A;  2PHY A;  3T50 A;  1UGU A;  5DFY A;  3T4S A;  2FH5 A;  2HV1 A;  2J80 A;  3MMH A;  2ZMV A;  3OCL A;  4KUK A;  3VE3 A;  1XJ3 A;  3K3D A;  3OBF A;  1VB6 A;  4NXE A;  2P08 A;  4GS9 B;  3ZQ5 A;  2B02 A;  4B9O A;  5J3W A;  1N9O A;  3KX0 X;  3T4J A;  5HPF A;  5G4Z A;  2D01 A;  3CWF A;  4FSF A;  4CLC E;  2W3E A;  4HI4 A;  3U2A A;  2QYB A;  1IFQ A;  4IHQ A;  3OLO A;  2DMW A;  2OWJ A;  2GNX A;  1ODV A;  3K3C A;  4R70 A;  3H7W A;  1S1Z A;  5DFX A;  3KSH A;  1D06 A;  4HNB A;  2EWW A;  4WLA A;  4Y2F A;  2O0Y A;  3ZYT A;  3A0R A;  3GEC A;  3PBR A;  4IUH A;  2JKT I;  5DJT A;  4HJ6 A;  3NOU C;  3HCY A;  5AVE A;  3PBN A;  3B47 A;  2QHK A;  4MN7 A;  1MZU A;  2QJ7 A;  5IU1 A;  4Z1W A;  4EU0 A;  2I9V A;  2W3F A;  4GLQ A;  1V9Y A;  3MQQ A;  4B93 A;  1OPX A;  2BAS A;  3NOT C;  2M1C A;  5HWW A;  2Z6D A;  4UEY A;  4YWZ A;  2VGL S;  3IBR A;  3ULF A;  3MXQ A;  3CI6 A;  3KSG A;  3UME A;  2GJ3 A;  4GJ4 A;  1S67 L;  2LB5 A;  3NOP C;  3LFV A;  3EGX C;  4G3V A;  1LT0 A;  1MC0 A;  4WEK A;  1DP6 A;  1NLY A;  1LSV A;  2L4R A;  3S7P A;  1OT9 A;  3FC7 A;  3LIB A;  2V1B A;  2V0W A;  4Q0I A;  4WEL A;  1LSW A;  2OAQ 1;  2PT7 A;  2NUP C;  4KUO A;  2K2N A;  3BQ8 A;  1YSQ A;  4L9G A;  2ZBB A;  3KYQ A;  5F5Y A;  3E98 A;  4CQH A;  3EQU A;  5HL6 A;  4ARZ B;  4ZRR A;  4M4X A;  4LRX C;  3VOL A;  3IS2 B;  3UB8 A;  4EER A;  5IT5 A;  3R4K A;  2A24 B;  4LLO B;  1G6O A;  1P97 A;  1NLZ A;  2Y79 A;  4MCW A;  1LL8 A;  4BJP A;  5HDS A;  3A0S A;  2WKP A;  3LR5 A;  3P7N A;  4EES A;  1OJ5 A;  1OT6 A;  1OTB A;  3CIT A;  3R7W B;  1MKM A;  2VLG A;  4BWI A;  2OOL A;  2VZW A;  2VGL M;  3GDI A;  4NKP A;  5DF9 A;  3PR6 A;  3EGD C;  1H3Q A;  4PHT A;  3H82 B;  1V9Z A;  4R3A A;  3F1O A;  1TS0 A;  4PAU A;  4HJ4 A;  3K2N A;  3PYP A;  1T1A A;  4K08 A;  1TS6 A;  3BWL A;  3T4Q A;  4PKY A;  1KOU A;  3F1P B;  3HJI A;  2HJE A;  4MN5 A;  2PDR A;  1XFQ A;  2J3T D;  3NJA A;  3VE4 A;  5HSQ A;  4JGP A;  4GW9 A;  2P04 A;  2VV7 A;  2W3H A;  3F1N B;  5AJG A;  4GS9 A;  4CLC C;  2EA9 A;  2JKR M;  3PBQ A;  5DJU A;  3PXP A;  4ME4 A;  4Y5F A;  3MQ0 A;  3EWK A;  4FOF A;  3NHQ A;  2YKF A;  3FPW A;  4HOI A;  4R6L A;  1ZTU A;  3H9W A;  2R78 A;  2JKT M;  5G4Y A;  5IS1 A;  1T18 A;  4I3A A;  2MJ6 A;  2JHE A;  1X0O A;  2JKR I;  3P01 A;  3OC2 A;  3UB9 A;  2OAP 1;  4NXB A;  3T4T A;  1UWP X;  1XFN A;  2M7V A;  4UQI S;  2KX6 A;  2XA7 M;  4Q0H A;  1T1C A;  5KIZ A;  3BQA A;  3E4Q A;  3VV4 A;  5TJJ A;  3V67 A;  2O99 A;  4EEP A;  3S7Q A;  5DKK A;  3D72 A;  2G7U A;  1OJG A;  3HJK A;  3MR0 A;  3LI8 A;  1XJ6 A;  4Y3I A;  4MDZ A;  3MQO A;  4OOM A;  3BY8 A;  4O0P A;  2OWH A;  5DKL A;  3UB7 A;  4HY8 A;  4H6J A;  3G6O A;  5TBM B;  2VKS A;  2A2L A;  3CLO A;  1NRJ A;  2J3T C;  3C2W A;  3KYZ A;  3PBT A;  4DMZ A;  1XJ4 A;  4XT2 B;  1DP8 A;  5KSH A;  2VEA A;  3MFX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...