3U2AA

Adaptor dependent degradation of a cell-cycle regulator reveals diversity in substrate architectures
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
112
structure length
111
Chain Sequence
IWDATATLEALGAADVALWIWEPETDRLRLNGAARALGLGPLAPECSSAAFRALALPQDRAQAEEVLKPREPGSEVVARFRVRGGETLWRGVWLEEGVRAAGVVAPETKFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords GGDEF family protein
publication title Adaptor-dependent degradation of a cell-cycle regulator uses a unique substrate architecture.
pubmed doi rcsb
source organism Caulobacter vibrioides
total genus 32
structure length 111
sequence length 112
ec nomenclature ec 3.1.4.52: Cyclic-guanylate-specific phosphodiesterase.
pdb deposition date 2011-10-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.310 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3u2aA00
3U2AA
chains in the Genus database with same CATH superfamily
3IF6A 1ESIA 3NDEA 4NXEA 4Y13A 3BJNA 1YMXA 4Y7PA 1XJ4A 3T4SA 2J3WA 4JXWA 4EESA 3WS0A 4B88A 1NY0A 2Y2IA 1K57C 4OQGA 1BZAA 3H7WA 3WRZA 1E3UA 3NBLA 4B4ZA 4ZDXA 3S7OA 2B95A 3VP1A 3O3VA 3CHWP 4O8GA 5AQ9A 4HBTA 3NOPC 2H0YA 4S2NA 4I38A 1LSVA 3E4OA 4LV2A 1DY6A 3QP6A 4LFUA 3DBAA 2QPNA 3G34A 2ZM2A 1MC0A 4GS9A 1FR6A 3ZFZA 3PBRA 2EFUA 4YOFA 3VV4A 1CQAA 1WE4A 1D06A 4HY8A 4Y0TA 1WYCA 2Y91A 3K2NA 4BJPA 3FZCA 5DJUA 5EUAA 2B5RA 4RYEA 3E2KA 4GDNA 3LY4A 2GZAA 2P08A 1MKIA 3C7VA 1J3WA 5AVFA 4MN7A 5F68A 4HBUA 1H0MA 1AXBA 3HLCA 4B93A 3FC7A 5AVEA 5TGFA 4EWFA 2C6WB 1L0EA 1ES4A 3JYIA 2B18A 4X1LA 1K54A 3L9KA 4E3JA 2Y2GA 4HH2A 3UE6A 5FQ9A 3CPTA 4DXBA 2PR5A 4CQHA 4I5SA 3UN7A 4B9OA 1YT4A 4CPKA 3ZG0A 2ZLYA 4HJ4A 4EQ1A 2WAEA 4BLMA 3MBZA 3TOIA 1KVLA 3HCYA 4K91A 4BL2A 3PBTA 5EM1A 2OLVA 2VV6A 2W3DA 5G4YA 3OBFA 5GLAA 3SH9A 4DKIA 2D01A 1D1JA 2A49A 2PYRA 5G18A 3G32A 1ONGA 5CEBA 3GSGA 3IXGA 3MKEA 4LGWA 3SZTA 2Y2LA 3LO7A 1MKMA 3EEHA 4CLCC 3IHAA 4ZJ2A 3BWLA 4HIAA 1CF0A 2ZBBA 2O0YA 4QY6A 1XX2A 3O5YA 3EWKA 4ID4A 1L0DA 4KG6A 4P0MA 1Y4OA 4MMNA 3IH9A 3CUEA 1KDWA 1LT0A 2FFYA 3VFHA 1IYQA 2QMIA 4D2OA 1IOUA 3KYQA 5CHMA 4E3OA 1BLPA 1QMFA 2XGNA 1GA0A 2HPBA 2V9AA 3O87A 5JYPA 1TF1A 5KSHA 4KZ8A 3ZG8B 3IQAA 1YLPA 2JBFA 2W1RA 4GHIB 5HAPA 5HZHA 4DRTA 1JVJA 2PU2A 4MBHA 4KZ4A 3BLSA 3N8RA 2ZQ7A 1IEMA 4L9GA 1Z6FA 5DFXA 5FQKA 1BLHA 3HLFA 2E8JA 3G4PA 3V3SA 1NXYA 2OWHA 2W3GA 3RFBA 1KDSA 1K57A 3B47A 2O99A 1K55C 1YQSA 3QP2A 4C6YA 3FYZA 4S2JA 4GJ4A 3VSKA 3VOZA 4LPZA 2V0UA 4QB8A 1CEGA 1YAXA 2Y2JA 4JXVA 1GSXA 4WN5A 5GL9A 4JXSA 4PHTA 1N9BA 2Z6DA 3VOYA 1DP9A 1JWVA 3G2YA 3DWKA 2WGWB 4CLCE 5HFOA 4EBNA 4DDSA 4WL9A 1HVBA 2JKRM 3E2LA 4QJGA 1DJAA 2M1CA 5CGXA 3NHQA 4K0WA 2Y2OA 1ZTUA 1FILA 1U60A 3M6BA 3C2WA 4OQIA 2DRWA 4DJ2A 3GR2A 2RL3A 3QNCA 2KLIA 1XA1A 1M40A 2EX8A 5HWVA 5L8MA 5KMWA 1TS0A 3LUQA 5M1AA 2HJEA 4MN5A 2L1MA 3LR3A 3V3RA 5E2FA 2X71A 1OT6A 3NC8A 2D02A 5CERA 5HWTA 4KZ7A 1KGFA 1EWZA 2Y2KA 1D7EA 4OPYA 5CGSA 4GHIA 1JTDA 1RCJA 3AGEA 5DF9A 4P6BA 1J9MA 1TS6A 1UWPX 5IHVA 3OZHA 4YWZA 1W63Q 1OTBA 5DVAA 3T1XA 4DXCA 4G3VA 1NRJA 2EXAA 3FWLA 1PW1A 4DDYA 3A3IA 5J3WA 4E6WA 2JKGA 4X68A 2WUQA 4GD8A 3CZDA 5FAQA 1TVFA 3BFFA 3IS2B 3ZQ5A 1BYWA 3LCEA 1ZHHB 1H3QA 1TEMA 4FSFA 4MCWA 2ZQCA 2XEPA 4G3KA 3SS4A 3HUMA 3WS4A 1K0KA 3DW0A 4CLCA 2WADA 3F1PA 2W3FA 2PR6A 4M4XA 2BASA 2XH9A 3LEZA 2JN7A 3Q7VB 3WWXA 5EVIC 2ZQAA 2K7SA 3T4JA 5E43A 4CJNA 2PBYA 4C75A 3F1NB 3FV7A 4X55A 4UQIM 1DP8A 3T4TA 4KENB 4S2OA 4JGRA 5HW3A 4KQDA 2WGVA 3T1SA 1P9RA 3A0SA 3ICYA 4KZ5A 3SH7A 4ETZA 2GNXA 2H28A 2Z2MB 2PHYA 3UE3A 3LR4A 1EROA 3LI9A 4P87A 2VV8A 4G3WA 3S1YA 3O86A 2VGLM 2FFFB 4JXGA 1KE4A 5EFWA 4ZJ1A 1TDGA 4JGPA 1WA9A 1EI5A 1K55A 3MQQA 3SOIA 1ES3A 2ZL1B 2W1TB 1VETA 3NECA 2EWWA 5HDCA 5GHZA 4R4SA 3IS2A 1HTZA 1I5QA 2OV5A 5FI6A 3MKFA 3IXDA 3S7PA 1FCOA 3IHBA 2XFTA 2A3UA 2G2WA 2W27A 4HI4A 3E98A 1CK3A 1H8YA 1T18A 3S7QA 4LV3A 3D4FA 5I94A 3UPPA 3D72A 3IF6B 1YSQA 1MXOA 3QP4A 3E4QA 3V67A 1GHMA 2Y2QA 5A91A 4IBRA 4MNRA 4UA7A 2XSSA 3H7WB 1YM1A 1XJ2A 4ARZB 5FQJA 1LL5A 2WKQA 4FTXA 3M6HA 1CI8A 3I7JA 3A0VA 4U3TA 2PAVP 1ERMA 4YFMA 5HSQA 2LB5A 1ONHA 3EGXC 3NCKA 5HD5A 1NLZA 1DJBA 4GKUA 1E4DA 4C3QA 2QJ5A 3QP5A 3HLDA 5GLBA 2P74A 1TS8A 4WMCD 3VP3A 4OOLA 4GS9B 4R0QA 3DAVA 3KSIA 3N7WA 4HOIA 1IFQA 3OLOA 1SDNA 3R7WA 3IX3A 3P09A 3U4LP 4JKTA 3RXXA 2I9VA 3HUNA 1TD5A 3KSFA 5FATA 1T1CA 3G31A 4OH0A 1G5UA 4Y2FA 3CI6A 3W4OA 3BQAA 3DTIA 4KZ6A 3UPOA 4R3AA 1GSWA 2J3TC 1E3UD 3E4PA 1OT9A 3D3OA 5TBMA 4F94A 4KQOA 2Q9MA 3EEAA 4HH3A 4WEJA 3TRCA 3CPTB 2GJ3A 5A90A 1NRFA 3T1QB 2ZOHA 5DJTA 3LY3A 1M6KA 3PAEA 1PYYA 2A2LA 2ZMFA 4QHCA 1IYPA 1C3BA 5J7EA 1L3LA 2HDQA 4BMWA 2NUPC 5AQBA 2QHKA 2XA7M 4ARZA 3G35A 3ITAA 3MSHA 3UE1A 2WKHA 1SZVA 1XJ6A 1PI5A 2IWDA 4X56A 3BFEA 4O0PA 4NK3A 4HJ6A 1W8QA 4PMAA 2G7UA 4GLQA 3TSGA 2A24A 3MF0A 2HP9A 3UB6A 5L07A 3JVUA 2BLSA 3MQOA 2OSUA 2ZC7A 1Y28A 3CJMA 1ZKJA 3AGFA 3P98A 2AVXA 2M7UA 1BTLA 4MN6A 5HL6A 4N1XA 4PAUA 4KZBA 3ZGAB 2O9CA 4HNBA 1YLWA 2EFXA 2K2NA 4UA6A 2V1AA 5HAIA 1OTDA 2NUTC 2PT7A 3GDIA 3KO6A 2Z6CA 4WZ4A 3C7UA 4Z1WA 1S4SA 3V5MA 4X69A 1MWUA 2EWVA 2ZC6B 4F3LA 1K25A 3ZDJA 2ZC4B 2LB9A 2ZC5B 1N9NA 1OJ5A 2BTFP 2C5WB 5L10A 1RGYA 3LEQA 4N92A 3UDFA 5CECA 1VEUA 3LYXA 4E3MA 2JKRI 5CTMA 1G6OA 5L09A 3T4KA 1T19A 4LCLA 3SW1A 4FCFA 3LR5A 4S2MA 4N1HA 3DTEA 4BBVA 1JNUA 5DFYA 2OWJA 3NI9A 3GECA 3C4PA 3PXPA 4R6LA 4RX2A 5BOHA 2JCHA 4OPZA 3IX4A 3TJZC 3IWIA 1SDEA 5F6AA 5TR7A 2VKSA 2GX5A 3OC2A 2XDMA 1PFLA 3VOLA 4NXBA 4GDBA 4UHUA 3EGDC 1BT5A 3IF5A 1S1YA 2V8FA 4DE2A 2QKPA 1JWPA 2R9XA 1H5XA 4UQIS 4O7DA 1XKZA 2HGVA 1H8ZA 3KSHA 1W63M 3IWOA 5AQ7A 4WZ5A 3WS2A 3EQVA 1OTEA 3CITA 1QMEA 2XLNA 3UB7A 1O7EA 3ULFA 4M3KA 2P9VA 5FEFA 5GHXA 2OAQ1 2UWXA 3UO9A 1A0KA 3OPLA 4H8RA 4KG2A 3GVBA 1IYSA 1ESUA 5CX7A 5HPFA 4ESPA 3WRTA 3Q82A 4KG5A 3P01A 4XUXA 4I3JA 1ERQA 1W7FA 3G30A 4XUZA 1YKDA 3LIDA 4MDZA 4IJGA 3W4PA 2V1BA 5FDSA 4EBPA 4RA7A 3E0YA 1AWIA 1UGUA 3GQZA 5EM0A 4D60A 1ES2A 3CG5A 5KSCA 5F1GA 3UNWA 3U2AA 4NEED 1YLYA 2HV1A 4U0TA 4GB7A 2VV7A 3MXRA 4Y3IA 2X01A 4ETXA 1PW8A 4CLCB 4JF6A 4X53A 1XFNA 3F1PB 4PPRA 1NWZA 3UB8A 1LL9A 3VE4A 4Q0JA 3GMWA 1HD8A 3ZNTA 2EX6A 3RJUA 1RGZA 3A0RA 2INWA 1BSGA 3SS5A 3BLMA 2FZ0A 4JGQA 3PAGA 3W2ZA 1LHYA 4HJ3A 4MBFA 4UEYA 1WYBA 3NOUC 2B02A 2VJWA 1ES5A 3VE3A 4X1MA 4E3IA 4IEDA 2WKPA 3KYEA 2WKRA 3RTYA 1PWGA 4IVKA 1UWNX 5CGWA 4CLCD 2V20A 2YKHA 3NIAA 1XP4A 5CEDA 1K38A 1YPRA 1L0FA 1VETB 5GLDA 3W8KA 4QD4A 3OPPA 3RXWA 4P6ZS 4OLGA 1MY8A 1YSPA 1F9IA 3IBRA 3UE0A 2WGIA 1LSXA 1CJFA 3A3JA 1XGIA 3BFDA 1I2WA 4ZJ3A 1H8MA 3BFGA 1N4OA 1DJCA 1S6RA 2HJ9C 2X02A 5GHYA 3PBSA 3NDGA 2GDNA 5FAOA 2E8IA 4Z9QA 4GOGA 4FD8A 2ZQ8A 3MXQA 2XA7S 5HARA 1K56A 3Q1FA 4JF4A 3TE8A 1N9OA 5FASA 4PM8A 2ZQDA 2ZD8A 2V2FF 3ISGA 4KZ9A 4DE3A 1GCEA 3CLOA 5HD3A 2ZMAA 3LR0A 4DE1A 3FKWA 3T4QA 3S4XA 3KSGA 2PDRA 1SKFA 3NY4A 3BRMA 3UMEA 3OPRA 5FSRA 4K08A 3EQUA 3HLGA 1ALQA 3MZDA 3V50A 4ME4A 3ZG7B 1PNEA 1Z09A 4OKPA 2V1ZA 3R7WB 1PZPA 3K3DA 4FH2A 4Q0IA 2IA2A 3LIBA 4NETA 1P97A 4GD6A 3MJQA 5EOOA 3RH8B 2YKFA 3TW8A 3WS5A 3C38A 1P9WA 3LIFA 1TS7A 2V8CA 4DJ3A 1KVMA 1DP6A 3B3XA 5TBMB 3BECA 4N9KA 2JKTI 1Q2QA 2Y59A 1GHIA 4KZAA 2XFSA 1SKOA 1K54C 4BENA 3LIEA 2ZQ9A 1KE0A 3C30A 1LSWA 2IWBA 4I3IA 4EEUA 4IUHA 5J4EA 5FQIA 5E2HA 3DTMA 3SS3A 1PRQA 3C4OA 2DNSA 4DF6A 2WK0A 3MR0A 1X0OA 3UY6A 2EXBA 4DN0A 3L7HA 5HL1A 1DRMA 4OQHA 1OTIA 2P04A 3QHYA 3IBJA 2A24B 2Y2MA 5E2GA 5F69A 1HLUP 4WYYA 5J8XA 3A3FA 3HLBA 2Z2LB 1XXMA 4XT2A 5D3OA 2JKFA 2XD1A 3F1OB 2I72A 3LI8A 5IS1A 1RP5A 2FH5A 5F83A 5FAPA 2VGJA 1VM1A 3ITBA 4BD1A 1S0WA 2XROA 1Q2PA 2V0WA 2PBDP 3BM6A 5TFQA 5U47A 2WKIA 5FQMA 1NZUA 2R9WA 4LV1A 1K6SA 4IVIA 2KOIA 2WZXA 3OCNA 2VA0A 5C5KA 3CUEC 4F3LB 4PM7A 3FPVA 1XFQA 3LFVA 2MJ6A 1IELA 3PBQA 4E3NA 5CHJA 3B42A 2PU4A 5EVEA 5EVIA 5LBRA 3K3CA 3UB5P 1VEUB 1FSWA 2JHEA 4GNUA 1NYMA 2G2UA 2XR0A 1CEFA 5DTSA 3LIAA 3ZCZA 2W3HA 1GSVA 1MPLA 1ZC2A 2ZM8A 3W4QA 4S2PA 3VMAA 2J8YA 1FCNA 1NYYA 3MXSA 1JWZA 3ZHHA 2QYBA 5DTKA 2PRFA 4I39A 2VZWA 4KUOA 5DTTA 5M18A 4L9FA 1LL8A 3ZNYA 1LI9A 3KX0X 2JKTM 1SCWA 2Y8HA 1S4RA 2Y2HA 3HBRA 1ODVA 3HL9A 2DCFA 1KGEA 2J9OA 3PYPA 4LV0A 3F1OA 4MLLA 3B33A 1N9LA 4LCMA 5FEGA 3VP4A 2VEAA 3V39A 4KQQA 1S67L 1BUEA 2QZ6A 3IXBA 3GTCA 5FA7A 3QNBA 2WZZA 2OLUA 2XD5A 4PKYA 4OOMA 4O01A 4E6XA 4HHDA 4IBXA 2JE5A 2P9VB 3FKVA 2Q0OA 3N8SA 5CHUA 4LRZE 3VP0A 1FCMA 4EERA 5HX9A 1OMEA 4OQ0A 1EW0A 1IKGA 2ZMVA 3T4OA 1MWRA 2XK1A 4BWIA 2J7VA 1XPBA 4ZBEA 2VX8A 2Y2NA 4YINA 1FR1A 4NKPA 2J80A 3UPNA 4R4RA 1K4FA 1E25A 1K6RA 2HDRA 3C8CA 5JYOA 4WBGA 1K4EA 1PWDA 3PHYA 3MMHA 5CTNA 3A3EA 1VQQA 4GCZA 4HP4A 2J3TD 3PBNA 1NJ4A 3VP2A 2EX9A 4EXOA 2H0TA 3S7NA 2DMWA 5AJGA 3H9WA 3PBOA 3PR6A 1ACFA 3N6IA 1W5DA 4LENA 3MQ0A 4HQAA 5HDSA 4L0LA 1GA9A 3FG8A 3IH8A 4WLAA 3VFFA 4S2KA 1G68A 4BL3A 1O07A 4DE0A 4YNRA 2M7VA 5TJJA 1S66L 4HESA 4A5RA 2VGLS 4OVDA 4R23A 4BQMA 3UDXA 1BULA 4PM9A 4FUWA 3HUOA 4Y0OA 3TG9A 2WAFA 5DKLA 4FOFA 4IUKA 5F1FA 4R1GA 3BEBA 1F5MA 1MWSA 4ZRRA 3S22A 1MBLA 4IHQA 5EV0A 2P7JA 4QU3A 3BQ8A 4X25A 4EETB 3HVFA 4OPRA 1W79A 2WYXA 1GHPA 4GZBA 1OPXA 2ZOIA 5A8BA 2J9PA 4WUJA 2HDUA 2EX2A 3G6OA 3HJIA 1G28A 2XRNA 5AQAA 1G6AA 1YLTA 1Y54A 4EV4A 4JBFA 4X6TA 5GLCA 3MZFA 3OCLA 4ZTKA 4DMZA 1PI4A 1V9YA 1KE3A 2CC1A 3N8LA 1MWTA 2HP5A 2PD7A 4GW9A 4N9LA 4Q8IA 3OOVA 4GN2A 1NLYA 2XF3A 3SH8A 1ZG4A 4S2IA 5IU1A 2O9BA 4KQRA 4LRXC 2QJ7A 5EE8A 3A3DA 5HWWA 4OP5A 1T1AA 5DKKA 2XQZA 4R38A 3HREA 1IKIA 5EPHA 4JF5A 2VGKA 4R70A 5KZHA 2Y55A 2K31A 4RX3A 1FOFA 1F2KA 3R4KA 2OAP1 1S1ZA 4WM9A 3DTKA 4OLDA 4RQ9A 2PYPA 2L0WA 3QP8A 2IWCA 4E3KA 4QPRA 4QY5A 1HZOA 5F5YA 4E04A 3CWFA 5CXWA 3HLWA 3Q7ZA 4K0XA 1K56D 3EOIA 4LRYC 4Y15A 1IYOA 2EA9A 1OTAA 2CMNA 4HP9A 2ACGA 3MS6A 3CMZA 3KYZA 4E3LA 3PTEA 3G2ZA 3GV9A 4KUKA 2BG1A 4JLFA 4MEZA 2WGWA 2Y4AA 4MBKA 1OJGA 2ZJ9A 3NJAA 4OOYA 1SKOB 4OP8A 4OONA 1BLCA 3T50A 3CAXA 5I5LA 4H6JB 2VLGA 3IF6C 4EBLA 4EQIA 3UDIA 5L2FA 3BW6A 5FI2A 2KX6A 5DF7A 2H5SA 4UAAA 1YLJA 2HF6A 1XA7A 3MFDA 3JPUA 4Y5FA 1V9ZA 5KIZA 4FH4A 5MC7A 1SHVA 4II7A 4P85A 1TDLA 1ZG6A 3UB9A 3JVVA 5E2EA 4S2NC 1FIKA 4KZ3A 4EEPA 1LLBA 2W3EA 2OOLA 1FQGA 4NG2A 3ZVTA 3BY9A 4R3JA 3T1RA 4XT2B 5A93A 5FL3A 5EECA 2UV0E 3OPHA 4Y0UA 1KGGA 4WF0A 3HJKA 3IX8A 4WELA 3N4IA 5G4ZA 4L9EA 4Y17A 4RVAA 3VSLA 2W0NA 2WKEA 4B4XA 3UMDA 4I3AA 3ZVWA 3ZG5A 5EOEA 1L0GA 1XJ3A 4PM5A 5FI7A 4JGOA 4ZAMA 3FPWA 5EVIB 2O9AA 1VB6A 2Y79A 3T12B 5FQQA 5F82A 3H82B 2JC7A 4H6JA 1KOUA 1XGJA 3Q7VA 4QWOA 4EUVA 3O88A 2ZC3B 4LLOB 2VK3A 5EVLA 1I2SA 1VHMA 3Q81A 5HAQA 3DWZA 3C5AA 4S2LA 5A92A 1L2SA 4UA9A 3F1NA 3IWQA 4R3BA 3T4LA 3GRJA 1BLSA 3WS1A 2KDKA 4WEKA 2PD8A 4HEFA 3BFCA 1NZOA 2L4RA 3M2JA 5CRFA 4U0XA 3HLEA 2RCXA 2ZM0A 2R78A 5DF8A 3ZG9B 3ZYTA 3LICA 1LI0A 3NOTC 4AFIA 4PKYG 3QP1A 3AGDA 5FDHA 5EVID 1PWCA 2HZ5A 3BYDA 4OPQA 4PM6A 4EW7A 4NXFA 4BBTA 3LGOA 3MZEA 1W8YA 4EU0A 1STZA 2HDSA 2ZL1A 1YLZA 3IT9A 1P0ZA 1T1BA 2W1TA 3BY8A 3NULA 3D9YA 4JPMA 4WZ5C 1YMSA 3MFXA 4BBUA 2QWSA 1MZUA 5K5BA 4NXGA 3M2KA 1JTGA 3Q07A 2Y2PA 1PZOA 3IXHA 3P7NA 4XXRA 1F98A 2H10A 4BD0A 3H82A 4WMCA 5HDDA 5IT5A 2Q9NA 5M19A 4P6ZM 1PIOA 2HP6A 1CI9A 5HPIA 4Q0HA 4EUZA 1FSYA
chains in the Genus database with same CATH topology
3MQQA 2J3TD 4UEYA 3PBNA 2W1TB 4NXEA 3NOUC 2B02A 2VJWA 3BJNA 2EWWA 1XJ4A 5HDCA 3T4SA 4EXOA 3VE3A 2J3WA 3S7NA 3IS2A 2DMWA 5AJGA 4EESA 3H9WA 3PBOA 2WKPA 3PR6A 3S7PA 2WKRA 3H7WA 3RTYA 1UWNX 4CLCD 2YKHA 3MQ0A 4HQAA 2W27A 5HDSA 4L0LA 3S7OA 4HI4A 4O8GA 3FG8A 4WLAA 3E98A 3NOPC 1T18A 4GCZA 4HP4A 3S7QA 4YNRA 2M7VA 4I38A 5TJJA 1S66L 3D72A 1LSVA 3E4OA 1YSQA 3E4QA 3DBAA 2VGLS 3V67A 4P6ZS 1MC0A 4GS9A 1YSPA 1F9IA 3IBRA 3PBRA 2XSSA 1LSXA 3H7WB 4YOFA 3VV4A 1XJ2A 4ARZB 1D06A 4HY8A 5DKLA 2WKQA 3K2NA 4BJPA 1H8MA 4FOFA 5DJUA 4IUKA 3A0VA 2HJ9C 5HSQA 2GZAA 2P08A 1F5MA 2LB5A 3PBSA 3EGXC 4ZRRA 5HD5A 1NLZA 5AVFA 4MN7A 5F68A 3MXQA 2QJ5A 4IHQA 2XA7S 2P7JA 4B93A 3FC7A 5AVEA 1TS8A 3BQ8A 4OOLA 4EETB 4GS9B 2B18A 3TE8A 3KSIA 1N9OA 4HOIA 1IFQA 3OLOA 4HH2A 3UE6A 1OPXA 2ZOIA 2PR5A 5A8BA 3R7WA 4CQHA 4I5SA 4B9OA 3CLOA 5HD3A 4WUJA 2I9VA 4HJ4A 4EQ1A 1TD5A 3LR0A 3KSFA 3G6OA 1T1CA 3HCYA 3HJIA 3T4QA 1G28A 4Y2FA 2XRNA 3CI6A 3KSGA 2PDRA 3BQAA 3PBTA 2VV6A 3UMEA 4R3AA 1GSWA 2W3DA 4K08A 3EQUA 5G4YA 2J3TC 3E4PA 3OBFA 3OCLA 4DMZA 1OT9A 3D3OA 1V9YA 2D01A 5TBMA 4KQOA 4ME4A 3EEAA 4HH3A 2PYRA 4WEJA 2PD7A 4GW9A 3TRCA 3OOVA 2GJ3A 1NLYA 3R7WB 4Q0IA 3K3DA 2IA2A 3LIBA 5IU1A 2ZOHA 1MKMA 2O9BA 5DJTA 1P97A 3EEHA 4CLCC 2A2LA 4LRXC 3MJQA 2ZMFA 2QJ7A 3RH8B 2YKFA 5HWWA 3TW8A 5J7EA 3BWLA 1T1AA 5DKKA 4HIAA 4R38A 3C38A 4BMWA 2ZBBA 1P9WA 3LIFA 2O0YA 1TS7A 3O5YA 3EWKA 4R70A 2NUPC 4DJ3A 2QHKA 2XA7M 4ARZA 2K31A 1DP6A 3R4KA 2OAP1 1S1ZA 5TBMB 1XJ6A 2JKTI 4MMNA 4O0PA 3CUEA 4RQ9A 2PYPA 1LT0A 2L0WA 4HJ6A 2G7UA 4GLQA 2A24A 3LIEA 4QPRA 1IOUA 3MF0A 5F5YA 3C30A 3UB6A 1LSWA 3KYQA 3CWFA 4I3IA 4E04A 3JVUA 3EOIA 4LRYC 3MQOA 4EEUA 4IUHA 1Y28A 2EA9A 5J4EA 1OTAA 2CMNA 4HP9A 2V9AA 1TF1A 5KSHA 2M7UA 4MN6A 3KYZA 2W1RA 4GHIB 5HZHA 5HL6A 4PAUA 2O9CA 4HNBA 4KUKA 4L9GA 2K2NA 3MR0A 2V1AA 1OJGA 1X0OA 5DFXA 4DN0A 1DRMA 1OTDA 3NJAA 2NUTC 2PT7A 1OTIA 3GDIA 2P04A 2Z6CA 3KO6A 2OWHA 2W3GA 3IBJA 2A24B 3RFBA 4Z1WA 1S4SA 3T50A 3B47A 3CAXA 5I5LA 5F69A 2O99A 4H6JB 2EWVA 2VLGA 4F3LA 3BW6A 4GJ4A 4XT2A 2LB9A 3LI8A 3F1OB 2KX6A 4LPZA 2V0UA 5IS1A 1N9NA 1OJ5A 1YAXA 2FH5A 2HF6A 1GSXA 4WN5A 4Y5FA 1V9ZA 4PHTA 2Z6DA 5KIZA 2XROA 3LYXA 1DP9A 2JKRI 2V0WA 5MC7A 1G6OA 3T4KA 1T19A 4CLCE 4II7A 3SW1A 3LR5A 3UB9A 4WL9A 2JKRM 3JVVA 4BBVA 2KOIA 4EEPA 1JNUA 3OCNA 2M1CA 2W3EA 5DFYA 2OOLA 3NHQA 2VA0A 5C5KA 2OWJA 3BY9A 3CUEC 4F3LB 1ZTUA 3FPVA 4XT2B 1XFQA 3C2WA 5FL3A 3LFVA 2MJ6A 3GECA 3PBQA 4DJ2A 3PXPA 4R6LA 3B42A 2KLIA 4WF0A 3K3CA 5LBRA 3HJKA 5HWVA 4WELA 3TJZC 5L8MA 2JHEA 5F6AA 5G4ZA 1TS0A 3LUQA 4L9EA 2VKSA 2HJEA 4MN5A 2L1MA 2GX5A 3OC2A 3LR3A 3VOLA 2W0NA 1OT6A 2D02A 3LIAA 4NXBA 2W3HA 3EGDC 3UMDA 5HWTA 1GSVA 4I3AA 1S1YA 2QKPA 1D7EA 4GHIA 4UQIS 1XJ3A 2QYBA 2HGVA 3KSHA 5DF9A 1W63M 1TS6A 4I39A 2VZWA 4JGOA 4KUOA 3FPWA 1UWPX 4L9FA 4YWZA 1LL8A 2O9AA 1VB6A 1OTEA 1W63Q 3CITA 3EQVA 1OTBA 2Y79A 3KX0X 3UB7A 3ULFA 3H82B 1NRJA 2JKTM 4G3VA 2Y8HA 1S4RA 4H6JA 1ODVA 1KOUA 2OAQ1 4EUVA 3PYPA 4LLOB 5J3WA 3F1OA 1VHMA 3B33A 1N9LA 2VEAA 5CX7A 5HPFA 3F1NA 1S67L 3P01A 3IS2B 3ZQ5A 1BYWA 3T4LA 1ZHHB 1H3QA 4I3JA 4FSFA 4MCWA 4G3KA 4PKYA 2KDKA 4OOMA 4WEKA 4CLCA 1YKDA 2PD8A 3LIDA 4O01A 4MDZA 4IJGA 2L4RA 4HHDA 2V1BA 3F1PA 2W3FA 2PR6A 4M4XA 2BASA 3E0YA 2JN7A 2R78A 1UGUA 2K7SA 4LRZE 3T4JA 3ZYTA 3LICA 3U2AA 4NEED 3NOTC 2HV1A 4AFIA 4PKYG 4EERA 2VV7A 3F1NB 4Y3IA 1EW0A 4UQIM 1DP8A 3T4TA 4EW7A 4JGRA 4ETXA 4NXFA 4KQDA 4BBTA 2ZMVA 3T4OA 1P9RA 4EU0A 4CLCB 3A0SA 3ICYA 4BWIA 1STZA 1P0ZA 1T1BA 4ETZA 3F1PB 1XFNA 2W1TA 3BY8A 1NWZA 3UB8A 2GNXA 3VE4A 2H28A 2VX8A 4Q0JA 2PHYA 3UE3A 3LR4A 4NKPA 3MFXA 2J80A 4BBUA 2QWSA 1MZUA 5K5BA 3A0RA 4NXGA 3LI9A 2INWA 2VV8A 3C8CA 4G3WA 3P7NA 1F98A 2FZ0A 2VGLM 3H82A 5HDDA 5IT5A 4JGQA 5EFWA 3PHYA 3W2ZA 4P6ZM 3MMHA 4JGPA 5HPIA 4HJ3A 4Q0HA 1WA9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U2A A; 
#chains in the Genus database with same CATH topology
 3IF6 A;  1ESI A;  3NDE A;  4NXE A;  4Y13 A;  3BJN A;  1YMX A;  4Y7P A;  1XJ4 A;  3T4S A;  2J3W A;  4JXW A;  4EES A;  3WS0 A;  4B88 A;  1NY0 A;  2Y2I A;  1K57 C;  4OQG A;  1BZA A;  3H7W A;  3WRZ A;  1E3U A;  3NBL A;  4B4Z A;  4ZDX A;  3S7O A;  2B95 A;  3VP1 A;  3O3V A;  3CHW P;  4O8G A;  5AQ9 A;  4HBT A;  3NOP C;  2H0Y A;  4S2N A;  4I38 A;  1LSV A;  3E4O A;  4LV2 A;  1DY6 A;  3QP6 A;  4LFU A;  3DBA A;  2QPN A;  3G34 A;  2ZM2 A;  1MC0 A;  4GS9 A;  1FR6 A;  3ZFZ A;  3PBR A;  2EFU A;  4YOF A;  3VV4 A;  1CQA A;  1WE4 A;  1D06 A;  4HY8 A;  4Y0T A;  1WYC A;  2Y91 A;  3K2N A;  4BJP A;  3FZC A;  5DJU A;  5EUA A;  2B5R A;  4RYE A;  3E2K A;  4GDN A;  3LY4 A;  2GZA A;  2P08 A;  1MKI A;  3C7V A;  1J3W A;  5AVF A;  4MN7 A;  5F68 A;  4HBU A;  1H0M A;  1AXB A;  3HLC A;  4B93 A;  3FC7 A;  5AVE A;  5TGF A;  4EWF A;  2C6W B;  1L0E A;  1ES4 A;  3JYI A;  2B18 A;  4X1L A;  1K54 A;  3L9K A;  4E3J A;  2Y2G A;  4HH2 A;  3UE6 A;  5FQ9 A;  3CPT A;  4DXB A;  2PR5 A;  4CQH A;  4I5S A;  3UN7 A;  4B9O A;  1YT4 A;  4CPK A;  3ZG0 A;  2ZLY A;  4HJ4 A;  4EQ1 A;  2WAE A;  4BLM A;  3MBZ A;  3TOI A;  1KVL A;  3HCY A;  4K91 A;  4BL2 A;  3PBT A;  5EM1 A;  2OLV A;  2VV6 A;  2W3D A;  5G4Y A;  3OBF A;  5GLA A;  3SH9 A;  4DKI A;  2D01 A;  1D1J A;  2A49 A;  2PYR A;  5G18 A;  3G32 A;  1ONG A;  5CEB A;  3GSG A;  3IXG A;  3MKE A;  4LGW A;  3SZT A;  2Y2L A;  3LO7 A;  1MKM A;  3EEH A;  4CLC C;  3IHA A;  4ZJ2 A;  3BWL A;  4HIA A;  1CF0 A;  2ZBB A;  2O0Y A;  4QY6 A;  1XX2 A;  3O5Y A;  3EWK A;  4ID4 A;  1L0D A;  4KG6 A;  4P0M A;  1Y4O A;  4MMN A;  3IH9 A;  3CUE A;  1KDW A;  1LT0 A;  2FFY A;  3VFH A;  1IYQ A;  2QMI A;  4D2O A;  1IOU A;  3KYQ A;  5CHM A;  4E3O A;  1BLP A;  1QMF A;  2XGN A;  1GA0 A;  2HPB A;  2V9A A;  3O87 A;  5JYP A;  1TF1 A;  5KSH A;  4KZ8 A;  3ZG8 B;  3IQA A;  1YLP A;  2JBF A;  2W1R A;  4GHI B;  5HAP A;  5HZH A;  4DRT A;  1JVJ A;  2PU2 A;  4MBH A;  4KZ4 A;  3BLS A;  3N8R A;  2ZQ7 A;  1IEM A;  4L9G A;  1Z6F A;  5DFX A;  5FQK A;  1BLH A;  3HLF A;  2E8J A;  3G4P A;  3V3S A;  1NXY A;  2OWH A;  2W3G A;  3RFB A;  1KDS A;  1K57 A;  3B47 A;  2O99 A;  1K55 C;  1YQS A;  3QP2 A;  4C6Y A;  3FYZ A;  4S2J A;  4GJ4 A;  3VSK A;  3VOZ A;  4LPZ A;  2V0U A;  4QB8 A;  1CEG A;  1YAX A;  2Y2J A;  4JXV A;  1GSX A;  4WN5 A;  5GL9 A;  4JXS A;  4PHT A;  1N9B A;  2Z6D A;  3VOY A;  1DP9 A;  1JWV A;  3G2Y A;  3DWK A;  2WGW B;  4CLC E;  5HFO A;  4EBN A;  4DDS A;  4WL9 A;  1HVB A;  2JKR M;  3E2L A;  4QJG A;  1DJA A;  2M1C A;  5CGX A;  3NHQ A;  4K0W A;  2Y2O A;  1ZTU A;  1FIL A;  1U60 A;  3M6B A;  3C2W A;  4OQI A;  2DRW A;  4DJ2 A;  3GR2 A;  2RL3 A;  3QNC A;  2KLI A;  1XA1 A;  1M40 A;  2EX8 A;  5HWV A;  5L8M A;  5KMW A;  1TS0 A;  3LUQ A;  5M1A A;  2HJE A;  4MN5 A;  2L1M A;  3LR3 A;  3V3R A;  5E2F A;  2X71 A;  1OT6 A;  3NC8 A;  2D02 A;  5CER A;  5HWT A;  4KZ7 A;  1KGF A;  1EWZ A;  2Y2K A;  1D7E A;  4OPY A;  5CGS A;  4GHI A;  1JTD A;  1RCJ A;  3AGE A;  5DF9 A;  4P6B A;  1J9M A;  1TS6 A;  1UWP X;  5IHV A;  3OZH A;  4YWZ A;  1W63 Q;  1OTB A;  5DVA A;  3T1X A;  4DXC A;  4G3V A;  1NRJ A;  2EXA A;  3FWL A;  1PW1 A;  4DDY A;  3A3I A;  5J3W A;  4E6W A;  2JKG A;  4X68 A;  2WUQ A;  4GD8 A;  3CZD A;  5FAQ A;  1TVF A;  3BFF A;  3IS2 B;  3ZQ5 A;  1BYW A;  3LCE A;  1ZHH B;  1H3Q A;  1TEM A;  4FSF A;  4MCW A;  2ZQC A;  2XEP A;  4G3K A;  3SS4 A;  3HUM A;  3WS4 A;  1K0K A;  3DW0 A;  4CLC A;  2WAD A;  3F1P A;  2W3F A;  2PR6 A;  4M4X A;  2BAS A;  2XH9 A;  3LEZ A;  2JN7 A;  3Q7V B;  3WWX A;  5EVI C;  2ZQA A;  2K7S A;  3T4J A;  5E43 A;  4CJN A;  2PBY A;  4C75 A;  3F1N B;  3FV7 A;  4X55 A;  4UQI M;  1DP8 A;  3T4T A;  4KEN B;  4S2O A;  4JGR A;  5HW3 A;  4KQD A;  2WGV A;  3T1S A;  1P9R A;  3A0S A;  3ICY A;  4KZ5 A;  3SH7 A;  4ETZ A;  2GNX A;  2H28 A;  2Z2M B;  2PHY A;  3UE3 A;  3LR4 A;  1ERO A;  3LI9 A;  4P87 A;  2VV8 A;  4G3W A;  3S1Y A;  3O86 A;  2VGL M;  2FFF B;  4JXG A;  1KE4 A;  5EFW A;  4ZJ1 A;  1TDG A;  4JGP A;  1WA9 A;  1EI5 A;  1K55 A;  3MQQ A;  3SOI A;  1ES3 A;  2ZL1 B;  2W1T B;  1VET A;  3NEC A;  2EWW A;  5HDC A;  5GHZ A;  4R4S A;  3IS2 A;  1HTZ A;  1I5Q A;  2OV5 A;  5FI6 A;  3MKF A;  3IXD A;  3S7P A;  1FCO A;  3IHB A;  2XFT A;  2A3U A;  2G2W A;  2W27 A;  4HI4 A;  3E98 A;  1CK3 A;  1H8Y A;  1T18 A;  3S7Q A;  4LV3 A;  3D4F A;  5I94 A;  3UPP A;  3D72 A;  3IF6 B;  1YSQ A;  1MXO A;  3QP4 A;  3E4Q A;  3V67 A;  1GHM A;  2Y2Q A;  5A91 A;  4IBR A;  4MNR A;  4UA7 A;  2XSS A;  3H7W B;  1YM1 A;  1XJ2 A;  4ARZ B;  5FQJ A;  1LL5 A;  2WKQ A;  4FTX A;  3M6H A;  1CI8 A;  3I7J A;  3A0V A;  4U3T A;  2PAV P;  1ERM A;  4YFM A;  5HSQ A;  2LB5 A;  1ONH A;  3EGX C;  3NCK A;  5HD5 A;  1NLZ A;  1DJB A;  4GKU A;  1E4D A;  4C3Q A;  2QJ5 A;  3QP5 A;  3HLD A;  5GLB A;  2P74 A;  1TS8 A;  4WMC D;  3VP3 A;  4OOL A;  4GS9 B;  4R0Q A;  3DAV A;  3KSI A;  3N7W A;  4HOI A;  1IFQ A;  3OLO A;  1SDN A;  3R7W A;  3IX3 A;  3P09 A;  3U4L P;  4JKT A;  3RXX A;  2I9V A;  3HUN A;  1TD5 A;  3KSF A;  5FAT A;  1T1C A;  3G31 A;  4OH0 A;  1G5U A;  4Y2F A;  3CI6 A;  3W4O A;  3BQA A;  3DTI A;  4KZ6 A;  3UPO A;  4R3A A;  1GSW A;  2J3T C;  1E3U D;  3E4P A;  1OT9 A;  3D3O A;  5TBM A;  4F94 A;  4KQO A;  2Q9M A;  3EEA A;  4HH3 A;  4WEJ A;  3TRC A;  3CPT B;  2GJ3 A;  5A90 A;  1NRF A;  3T1Q B;  2ZOH A;  5DJT A;  3LY3 A;  1M6K A;  3PAE A;  1PYY A;  2A2L A;  2ZMF A;  4QHC A;  1IYP A;  1C3B A;  5J7E A;  1L3L A;  2HDQ A;  4BMW A;  2NUP C;  5AQB A;  2QHK A;  2XA7 M;  4ARZ A;  3G35 A;  3ITA A;  3MSH A;  3UE1 A;  2WKH A;  1SZV A;  1XJ6 A;  1PI5 A;  2IWD A;  4X56 A;  3BFE A;  4O0P A;  4NK3 A;  4HJ6 A;  1W8Q A;  4PMA A;  2G7U A;  4GLQ A;  3TSG A;  2A24 A;  3MF0 A;  2HP9 A;  3UB6 A;  5L07 A;  3JVU A;  2BLS A;  3MQO A;  2OSU A;  2ZC7 A;  1Y28 A;  3CJM A;  1ZKJ A;  3AGF A;  3P98 A;  2AVX A;  2M7U A;  1BTL A;  4MN6 A;  5HL6 A;  4N1X A;  4PAU A;  4KZB A;  3ZGA B;  2O9C A;  4HNB A;  1YLW A;  2EFX A;  2K2N A;  4UA6 A;  2V1A A;  5HAI A;  1OTD A;  2NUT C;  2PT7 A;  3GDI A;  3KO6 A;  2Z6C A;  4WZ4 A;  3C7U A;  4Z1W A;  1S4S A;  3V5M A;  4X69 A;  1MWU A;  2EWV A;  2ZC6 B;  4F3L A;  1K25 A;  3ZDJ A;  2ZC4 B;  2LB9 A;  2ZC5 B;  1N9N A;  1OJ5 A;  2BTF P;  2C5W B;  5L10 A;  1RGY A;  3LEQ A;  4N92 A;  3UDF A;  5CEC A;  1VEU A;  3LYX A;  4E3M A;  2JKR I;  5CTM A;  1G6O A;  5L09 A;  3T4K A;  1T19 A;  4LCL A;  3SW1 A;  4FCF A;  3LR5 A;  4S2M A;  4N1H A;  3DTE A;  4BBV A;  1JNU A;  5DFY A;  2OWJ A;  3NI9 A;  3GEC A;  3C4P A;  3PXP A;  4R6L A;  4RX2 A;  5BOH A;  2JCH A;  4OPZ A;  3IX4 A;  3TJZ C;  3IWI A;  1SDE A;  5F6A A;  5TR7 A;  2VKS A;  2GX5 A;  3OC2 A;  2XDM A;  1PFL A;  3VOL A;  4NXB A;  4GDB A;  4UHU A;  3EGD C;  1BT5 A;  3IF5 A;  1S1Y A;  2V8F A;  4DE2 A;  2QKP A;  1JWP A;  2R9X A;  1H5X A;  4UQI S;  4O7D A;  1XKZ A;  2HGV A;  1H8Z A;  3KSH A;  1W63 M;  3IWO A;  5AQ7 A;  4WZ5 A;  3WS2 A;  3EQV A;  1OTE A;  3CIT A;  1QME A;  2XLN A;  3UB7 A;  1O7E A;  3ULF A;  4M3K A;  2P9V A;  5FEF A;  5GHX A;  2OAQ 1;  2UWX A;  3UO9 A;  1A0K A;  3OPL A;  4H8R A;  4KG2 A;  3GVB A;  1IYS A;  1ESU A;  5CX7 A;  5HPF A;  4ESP A;  3WRT A;  3Q82 A;  4KG5 A;  3P01 A;  4XUX A;  4I3J A;  1ERQ A;  1W7F A;  3G30 A;  4XUZ A;  1YKD A;  3LID A;  4MDZ A;  4IJG A;  3W4P A;  2V1B A;  5FDS A;  4EBP A;  4RA7 A;  3E0Y A;  1AWI A;  1UGU A;  3GQZ A;  5EM0 A;  4D60 A;  1ES2 A;  3CG5 A;  5KSC A;  5F1G A;  3UNW A;  3U2A A;  4NEE D;  1YLY A;  2HV1 A;  4U0T A;  4GB7 A;  2VV7 A;  3MXR A;  4Y3I A;  2X01 A;  4ETX A;  1PW8 A;  4CLC B;  4JF6 A;  4X53 A;  1XFN A;  3F1P B;  4PPR A;  1NWZ A;  3UB8 A;  1LL9 A;  3VE4 A;  4Q0J A;  3GMW A;  1HD8 A;  3ZNT A;  2EX6 A;  3RJU A;  1RGZ A;  3A0R A;  2INW A;  1BSG A;  3SS5 A;  3BLM A;  2FZ0 A;  4JGQ A;  3PAG A;  3W2Z A;  1LHY A;  4HJ3 A;  4MBF A;  4UEY A;  1WYB A;  3NOU C;  2B02 A;  2VJW A;  1ES5 A;  3VE3 A;  4X1M A;  4E3I A;  4IED A;  2WKP A;  3KYE A;  2WKR A;  3RTY A;  1PWG A;  4IVK A;  1UWN X;  5CGW A;  4CLC D;  2V20 A;  2YKH A;  3NIA A;  1XP4 A;  5CED A;  1K38 A;  1YPR A;  1L0F A;  1VET B;  5GLD A;  3W8K A;  4QD4 A;  3OPP A;  3RXW A;  4P6Z S;  4OLG A;  1MY8 A;  1YSP A;  1F9I A;  3IBR A;  3UE0 A;  2WGI A;  1LSX A;  1CJF A;  3A3J A;  1XGI A;  3BFD A;  1I2W A;  4ZJ3 A;  1H8M A;  3BFG A;  1N4O A;  1DJC A;  1S6R A;  2HJ9 C;  2X02 A;  5GHY A;  3PBS A;  3NDG A;  2GDN A;  5FAO A;  2E8I A;  4Z9Q A;  4GOG A;  4FD8 A;  2ZQ8 A;  3MXQ A;  2XA7 S;  5HAR A;  1K56 A;  3Q1F A;  4JF4 A;  3TE8 A;  1N9O A;  5FAS A;  4PM8 A;  2ZQD A;  2ZD8 A;  2V2F F;  3ISG A;  4KZ9 A;  4DE3 A;  1GCE A;  3CLO A;  5HD3 A;  2ZMA A;  3LR0 A;  4DE1 A;  3FKW A;  3T4Q A;  3S4X A;  3KSG A;  2PDR A;  1SKF A;  3NY4 A;  3BRM A;  3UME A;  3OPR A;  5FSR A;  4K08 A;  3EQU A;  3HLG A;  1ALQ A;  3MZD A;  3V50 A;  4ME4 A;  3ZG7 B;  1PNE A;  1Z09 A;  4OKP A;  2V1Z A;  3R7W B;  1PZP A;  3K3D A;  4FH2 A;  4Q0I A;  2IA2 A;  3LIB A;  4NET A;  1P97 A;  4GD6 A;  3MJQ A;  5EOO A;  3RH8 B;  2YKF A;  3TW8 A;  3WS5 A;  3C38 A;  1P9W A;  3LIF A;  1TS7 A;  2V8C A;  4DJ3 A;  1KVM A;  1DP6 A;  3B3X A;  5TBM B;  3BEC A;  4N9K A;  2JKT I;  1Q2Q A;  2Y59 A;  1GHI A;  4KZA A;  2XFS A;  1SKO A;  1K54 C;  4BEN A;  3LIE A;  2ZQ9 A;  1KE0 A;  3C30 A;  1LSW A;  2IWB A;  4I3I A;  4EEU A;  4IUH A;  5J4E A;  5FQI A;  5E2H A;  3DTM A;  3SS3 A;  1PRQ A;  3C4O A;  2DNS A;  4DF6 A;  2WK0 A;  3MR0 A;  1X0O A;  3UY6 A;  2EXB A;  4DN0 A;  3L7H A;  5HL1 A;  1DRM A;  4OQH A;  1OTI A;  2P04 A;  3QHY A;  3IBJ A;  2A24 B;  2Y2M A;  5E2G A;  5F69 A;  1HLU P;  4WYY A;  5J8X A;  3A3F A;  3HLB A;  2Z2L B;  1XXM A;  4XT2 A;  5D3O A;  2JKF A;  2XD1 A;  3F1O B;  2I72 A;  3LI8 A;  5IS1 A;  1RP5 A;  2FH5 A;  5F83 A;  5FAP A;  2VGJ A;  1VM1 A;  3ITB A;  4BD1 A;  1S0W A;  2XRO A;  1Q2P A;  2V0W A;  2PBD P;  3BM6 A;  5TFQ A;  5U47 A;  2WKI A;  5FQM A;  1NZU A;  2R9W A;  4LV1 A;  1K6S A;  4IVI A;  2KOI A;  2WZX A;  3OCN A;  2VA0 A;  5C5K A;  3CUE C;  4F3L B;  4PM7 A;  3FPV A;  1XFQ A;  3LFV A;  2MJ6 A;  1IEL A;  3PBQ A;  4E3N A;  5CHJ A;  3B42 A;  2PU4 A;  5EVE A;  5EVI A;  5LBR A;  3K3C A;  3UB5 P;  1VEU B;  1FSW A;  2JHE A;  4GNU A;  1NYM A;  2G2U A;  2XR0 A;  1CEF A;  5DTS A;  3LIA A;  3ZCZ A;  2W3H A;  1GSV A;  1MPL A;  1ZC2 A;  2ZM8 A;  3W4Q A;  4S2P A;  3VMA A;  2J8Y A;  1FCN A;  1NYY A;  3MXS A;  1JWZ A;  3ZHH A;  2QYB A;  5DTK A;  2PRF A;  4I39 A;  2VZW A;  4KUO A;  5DTT A;  5M18 A;  4L9F A;  1LL8 A;  3ZNY A;  1LI9 A;  3KX0 X;  2JKT M;  1SCW A;  2Y8H A;  1S4R A;  2Y2H A;  3HBR A;  1ODV A;  3HL9 A;  2DCF A;  1KGE A;  2J9O A;  3PYP A;  4LV0 A;  3F1O A;  4MLL A;  3B33 A;  1N9L A;  4LCM A;  5FEG A;  3VP4 A;  2VEA A;  3V39 A;  4KQQ A;  1S67 L;  1BUE A;  2QZ6 A;  3IXB A;  3GTC A;  5FA7 A;  3QNB A;  2WZZ A;  2OLU A;  2XD5 A;  4PKY A;  4OOM A;  4O01 A;  4E6X A;  4HHD A;  4IBX A;  2JE5 A;  2P9V B;  3FKV A;  2Q0O A;  3N8S A;  5CHU A;  4LRZ E;  3VP0 A;  1FCM A;  4EER A;  5HX9 A;  1OME A;  4OQ0 A;  1EW0 A;  1IKG A;  2ZMV A;  3T4O A;  1MWR A;  2XK1 A;  4BWI A;  2J7V A;  1XPB A;  4ZBE A;  2VX8 A;  2Y2N A;  4YIN A;  1FR1 A;  4NKP A;  2J80 A;  3UPN A;  4R4R A;  1K4F A;  1E25 A;  1K6R A;  2HDR A;  3C8C A;  5JYO A;  4WBG A;  1K4E A;  1PWD A;  3PHY A;  3MMH A;  5CTN A;  3A3E A;  1VQQ A;  4GCZ A;  4HP4 A;  2J3T D;  3PBN A;  1NJ4 A;  3VP2 A;  2EX9 A;  4EXO A;  2H0T A;  3S7N A;  2DMW A;  5AJG A;  3H9W A;  3PBO A;  3PR6 A;  1ACF A;  3N6I A;  1W5D A;  4LEN A;  3MQ0 A;  4HQA A;  5HDS A;  4L0L A;  1GA9 A;  3FG8 A;  3IH8 A;  4WLA A;  3VFF A;  4S2K A;  1G68 A;  4BL3 A;  1O07 A;  4DE0 A;  4YNR A;  2M7V A;  5TJJ A;  1S66 L;  4HES A;  4A5R A;  2VGL S;  4OVD A;  4R23 A;  4BQM A;  3UDX A;  1BUL A;  4PM9 A;  4FUW A;  3HUO A;  4Y0O A;  3TG9 A;  2WAF A;  5DKL A;  4FOF A;  4IUK A;  5F1F A;  4R1G A;  3BEB A;  1F5M A;  1MWS A;  4ZRR A;  3S22 A;  1MBL A;  4IHQ A;  5EV0 A;  2P7J A;  4QU3 A;  3BQ8 A;  4X25 A;  4EET B;  3HVF A;  4OPR A;  1W79 A;  2WYX A;  1GHP A;  4GZB A;  1OPX A;  2ZOI A;  5A8B A;  2J9P A;  4WUJ A;  2HDU A;  2EX2 A;  3G6O A;  3HJI A;  1G28 A;  2XRN A;  5AQA A;  1G6A A;  1YLT A;  1Y54 A;  4EV4 A;  4JBF A;  4X6T A;  5GLC A;  3MZF A;  3OCL A;  4ZTK A;  4DMZ A;  1PI4 A;  1V9Y A;  1KE3 A;  2CC1 A;  3N8L A;  1MWT A;  2HP5 A;  2PD7 A;  4GW9 A;  4N9L A;  4Q8I A;  3OOV A;  4GN2 A;  1NLY A;  2XF3 A;  3SH8 A;  1ZG4 A;  4S2I A;  5IU1 A;  2O9B A;  4KQR A;  4LRX C;  2QJ7 A;  5EE8 A;  3A3D A;  5HWW A;  4OP5 A;  1T1A A;  5DKK A;  2XQZ A;  4R38 A;  3HRE A;  1IKI A;  5EPH A;  4JF5 A;  2VGK A;  4R70 A;  5KZH A;  2Y55 A;  2K31 A;  4RX3 A;  1FOF A;  1F2K A;  3R4K A;  2OAP 1;  1S1Z A;  4WM9 A;  3DTK A;  4OLD A;  4RQ9 A;  2PYP A;  2L0W A;  3QP8 A;  2IWC A;  4E3K A;  4QPR A;  4QY5 A;  1HZO A;  5F5Y A;  4E04 A;  3CWF A;  5CXW A;  3HLW A;  3Q7Z A;  4K0X A;  1K56 D;  3EOI A;  4LRY C;  4Y15 A;  1IYO A;  2EA9 A;  1OTA A;  2CMN A;  4HP9 A;  2ACG A;  3MS6 A;  3CMZ A;  3KYZ A;  4E3L A;  3PTE A;  3G2Z A;  3GV9 A;  4KUK A;  2BG1 A;  4JLF A;  4MEZ A;  2WGW A;  2Y4A A;  4MBK A;  1OJG A;  2ZJ9 A;  3NJA A;  4OOY A;  1SKO B;  4OP8 A;  4OON A;  1BLC A;  3T50 A;  3CAX A;  5I5L A;  4H6J B;  2VLG A;  3IF6 C;  4EBL A;  4EQI A;  3UDI A;  5L2F A;  3BW6 A;  5FI2 A;  2KX6 A;  5DF7 A;  2H5S A;  4UAA A;  1YLJ A;  2HF6 A;  1XA7 A;  3MFD A;  3JPU A;  4Y5F A;  1V9Z A;  5KIZ A;  4FH4 A;  5MC7 A;  1SHV A;  4II7 A;  4P85 A;  1TDL A;  1ZG6 A;  3UB9 A;  3JVV A;  5E2E A;  4S2N C;  1FIK A;  4KZ3 A;  4EEP A;  1LLB A;  2W3E A;  2OOL A;  1FQG A;  4NG2 A;  3ZVT A;  3BY9 A;  4R3J A;  3T1R A;  4XT2 B;  5A93 A;  5FL3 A;  5EEC A;  2UV0 E;  3OPH A;  4Y0U A;  1KGG A;  4WF0 A;  3HJK A;  3IX8 A;  4WEL A;  3N4I A;  5G4Z A;  4L9E A;  4Y17 A;  4RVA A;  3VSL A;  2W0N A;  2WKE A;  4B4X A;  3UMD A;  4I3A A;  3ZVW A;  3ZG5 A;  5EOE A;  1L0G A;  1XJ3 A;  4PM5 A;  5FI7 A;  4JGO A;  4ZAM A;  3FPW A;  5EVI B;  2O9A A;  1VB6 A;  2Y79 A;  3T12 B;  5FQQ A;  5F82 A;  3H82 B;  2JC7 A;  4H6J A;  1KOU A;  1XGJ A;  3Q7V A;  4QWO A;  4EUV A;  3O88 A;  2ZC3 B;  4LLO B;  2VK3 A;  5EVL A;  1I2S A;  1VHM A;  3Q81 A;  5HAQ A;  3DWZ A;  3C5A A;  4S2L A;  5A92 A;  1L2S A;  4UA9 A;  3F1N A;  3IWQ A;  4R3B A;  3T4L A;  3GRJ A;  1BLS A;  3WS1 A;  2KDK A;  4WEK A;  2PD8 A;  4HEF A;  3BFC A;  1NZO A;  2L4R A;  3M2J A;  5CRF A;  4U0X A;  3HLE A;  2RCX A;  2ZM0 A;  2R78 A;  5DF8 A;  3ZG9 B;  3ZYT A;  3LIC A;  1LI0 A;  3NOT C;  4AFI A;  4PKY G;  3QP1 A;  3AGD A;  5FDH A;  5EVI D;  1PWC A;  2HZ5 A;  3BYD A;  4OPQ A;  4PM6 A;  4EW7 A;  4NXF A;  4BBT A;  3LGO A;  3MZE A;  1W8Y A;  4EU0 A;  1STZ A;  2HDS A;  2ZL1 A;  1YLZ A;  3IT9 A;  1P0Z A;  1T1B A;  2W1T A;  3BY8 A;  3NUL A;  3D9Y A;  4JPM A;  4WZ5 C;  1YMS A;  3MFX A;  4BBU A;  2QWS A;  1MZU A;  5K5B A;  4NXG A;  3M2K A;  1JTG A;  3Q07 A;  2Y2P A;  1PZO A;  3IXH A;  3P7N A;  4XXR A;  1F98 A;  2H10 A;  4BD0 A;  3H82 A;  4WMC A;  5HDD A;  5IT5 A;  2Q9N A;  5M19 A;  4P6Z M;  1PIO A;  2HP6 A;  1CI9 A;  5HPI A;  4Q0H A;  4EUZ A;  1FSY A; 
#chains in the Genus database with same CATH homology
 3MQQ A;  2J3T D;  4UEY A;  3PBN A;  2W1T B;  4NXE A;  3NOU C;  2B02 A;  2VJW A;  3BJN A;  2EWW A;  1XJ4 A;  5HDC A;  3T4S A;  4EXO A;  3VE3 A;  2J3W A;  3S7N A;  3IS2 A;  2DMW A;  5AJG A;  4EES A;  3H9W A;  3PBO A;  2WKP A;  3PR6 A;  3S7P A;  2WKR A;  3H7W A;  3RTY A;  1UWN X;  4CLC D;  2YKH A;  3MQ0 A;  4HQA A;  2W27 A;  5HDS A;  4L0L A;  3S7O A;  4HI4 A;  4O8G A;  3FG8 A;  4WLA A;  3E98 A;  3NOP C;  1T18 A;  4GCZ A;  4HP4 A;  3S7Q A;  4YNR A;  2M7V A;  4I38 A;  5TJJ A;  1S66 L;  3D72 A;  1LSV A;  3E4O A;  1YSQ A;  3E4Q A;  3DBA A;  2VGL S;  3V67 A;  4P6Z S;  1MC0 A;  4GS9 A;  1YSP A;  1F9I A;  3IBR A;  3PBR A;  2XSS A;  1LSX A;  3H7W B;  4YOF A;  3VV4 A;  1XJ2 A;  4ARZ B;  1D06 A;  4HY8 A;  5DKL A;  2WKQ A;  3K2N A;  4BJP A;  1H8M A;  4FOF A;  5DJU A;  4IUK A;  3A0V A;  2HJ9 C;  5HSQ A;  2GZA A;  2P08 A;  1F5M A;  2LB5 A;  3PBS A;  3EGX C;  4ZRR A;  5HD5 A;  1NLZ A;  5AVF A;  4MN7 A;  5F68 A;  3MXQ A;  2QJ5 A;  4IHQ A;  2XA7 S;  2P7J A;  4B93 A;  3FC7 A;  5AVE A;  1TS8 A;  3BQ8 A;  4OOL A;  4EET B;  4GS9 B;  2B18 A;  3TE8 A;  3KSI A;  1N9O A;  4HOI A;  1IFQ A;  3OLO A;  4HH2 A;  3UE6 A;  1OPX A;  2ZOI A;  2PR5 A;  5A8B A;  3R7W A;  4CQH A;  4I5S A;  4B9O A;  3CLO A;  5HD3 A;  4WUJ A;  2I9V A;  4HJ4 A;  4EQ1 A;  1TD5 A;  3LR0 A;  3KSF A;  3G6O A;  1T1C A;  3HCY A;  3HJI A;  3T4Q A;  1G28 A;  4Y2F A;  2XRN A;  3CI6 A;  3KSG A;  2PDR A;  3BQA A;  3PBT A;  2VV6 A;  3UME A;  4R3A A;  1GSW A;  2W3D A;  4K08 A;  3EQU A;  5G4Y A;  2J3T C;  3E4P A;  3OBF A;  3OCL A;  4DMZ A;  1OT9 A;  3D3O A;  1V9Y A;  2D01 A;  5TBM A;  4KQO A;  4ME4 A;  3EEA A;  4HH3 A;  2PYR A;  4WEJ A;  2PD7 A;  4GW9 A;  3TRC A;  3OOV A;  2GJ3 A;  1NLY A;  3R7W B;  4Q0I A;  3K3D A;  2IA2 A;  3LIB A;  5IU1 A;  2ZOH A;  1MKM A;  2O9B A;  5DJT A;  1P97 A;  3EEH A;  4CLC C;  2A2L A;  4LRX C;  3MJQ A;  2ZMF A;  2QJ7 A;  3RH8 B;  2YKF A;  5HWW A;  3TW8 A;  5J7E A;  3BWL A;  1T1A A;  5DKK A;  4HIA A;  4R38 A;  3C38 A;  4BMW A;  2ZBB A;  1P9W A;  3LIF A;  2O0Y A;  1TS7 A;  3O5Y A;  3EWK A;  4R70 A;  2NUP C;  4DJ3 A;  2QHK A;  2XA7 M;  4ARZ A;  2K31 A;  1DP6 A;  3R4K A;  2OAP 1;  1S1Z A;  5TBM B;  1XJ6 A;  2JKT I;  4MMN A;  4O0P A;  3CUE A;  4RQ9 A;  2PYP A;  1LT0 A;  2L0W A;  4HJ6 A;  2G7U A;  4GLQ A;  2A24 A;  3LIE A;  4QPR A;  1IOU A;  3MF0 A;  5F5Y A;  3C30 A;  3UB6 A;  1LSW A;  3KYQ A;  3CWF A;  4I3I A;  4E04 A;  3JVU A;  3EOI A;  4LRY C;  3MQO A;  4EEU A;  4IUH A;  1Y28 A;  2EA9 A;  5J4E A;  1OTA A;  2CMN A;  4HP9 A;  2V9A A;  1TF1 A;  5KSH A;  2M7U A;  4MN6 A;  3KYZ A;  2W1R A;  4GHI B;  5HZH A;  5HL6 A;  4PAU A;  2O9C A;  4HNB A;  4KUK A;  4L9G A;  2K2N A;  3MR0 A;  2V1A A;  1OJG A;  1X0O A;  5DFX A;  4DN0 A;  1DRM A;  1OTD A;  3NJA A;  2NUT C;  2PT7 A;  1OTI A;  3GDI A;  2P04 A;  2Z6C A;  3KO6 A;  2OWH A;  2W3G A;  3IBJ A;  2A24 B;  3RFB A;  4Z1W A;  1S4S A;  3T50 A;  3B47 A;  3CAX A;  5I5L A;  5F69 A;  2O99 A;  4H6J B;  2EWV A;  2VLG A;  4F3L A;  3BW6 A;  4GJ4 A;  4XT2 A;  2LB9 A;  3LI8 A;  3F1O B;  2KX6 A;  4LPZ A;  2V0U A;  5IS1 A;  1N9N A;  1OJ5 A;  1YAX A;  2FH5 A;  2HF6 A;  1GSX A;  4WN5 A;  4Y5F A;  1V9Z A;  4PHT A;  2Z6D A;  5KIZ A;  2XRO A;  3LYX A;  1DP9 A;  2JKR I;  2V0W A;  5MC7 A;  1G6O A;  3T4K A;  1T19 A;  4CLC E;  4II7 A;  3SW1 A;  3LR5 A;  3UB9 A;  4WL9 A;  2JKR M;  3JVV A;  4BBV A;  2KOI A;  4EEP A;  1JNU A;  3OCN A;  2M1C A;  2W3E A;  5DFY A;  2OOL A;  3NHQ A;  2VA0 A;  5C5K A;  2OWJ A;  3BY9 A;  3CUE C;  4F3L B;  1ZTU A;  3FPV A;  4XT2 B;  1XFQ A;  3C2W A;  5FL3 A;  3LFV A;  2MJ6 A;  3GEC A;  3PBQ A;  4DJ2 A;  3PXP A;  4R6L A;  3B42 A;  2KLI A;  4WF0 A;  3K3C A;  5LBR A;  3HJK A;  5HWV A;  4WEL A;  3TJZ C;  5L8M A;  2JHE A;  5F6A A;  5G4Z A;  1TS0 A;  3LUQ A;  4L9E A;  2VKS A;  2HJE A;  4MN5 A;  2L1M A;  2GX5 A;  3OC2 A;  3LR3 A;  3VOL A;  2W0N A;  1OT6 A;  2D02 A;  3LIA A;  4NXB A;  2W3H A;  3EGD C;  3UMD A;  5HWT A;  1GSV A;  4I3A A;  1S1Y A;  2QKP A;  1D7E A;  4GHI A;  4UQI S;  1XJ3 A;  2QYB A;  2HGV A;  3KSH A;  5DF9 A;  1W63 M;  1TS6 A;  4I39 A;  2VZW A;  4JGO A;  4KUO A;  3FPW A;  1UWP X;  4L9F A;  4YWZ A;  1LL8 A;  2O9A A;  1VB6 A;  1OTE A;  1W63 Q;  3CIT A;  3EQV A;  1OTB A;  2Y79 A;  3KX0 X;  3UB7 A;  3ULF A;  3H82 B;  1NRJ A;  2JKT M;  4G3V A;  2Y8H A;  1S4R A;  4H6J A;  1ODV A;  1KOU A;  2OAQ 1;  4EUV A;  3PYP A;  4LLO B;  5J3W A;  3F1O A;  1VHM A;  3B33 A;  1N9L A;  2VEA A;  5CX7 A;  5HPF A;  3F1N A;  1S67 L;  3P01 A;  3IS2 B;  3ZQ5 A;  1BYW A;  3T4L A;  1ZHH B;  1H3Q A;  4I3J A;  4FSF A;  4MCW A;  4G3K A;  4PKY A;  2KDK A;  4OOM A;  4WEK A;  4CLC A;  1YKD A;  2PD8 A;  3LID A;  4O01 A;  4MDZ A;  4IJG A;  2L4R A;  4HHD A;  2V1B A;  3F1P A;  2W3F A;  2PR6 A;  4M4X A;  2BAS A;  3E0Y A;  2JN7 A;  2R78 A;  1UGU A;  2K7S A;  4LRZ E;  3T4J A;  3ZYT A;  3LIC A;  3U2A A;  4NEE D;  3NOT C;  2HV1 A;  4AFI A;  4PKY G;  4EER A;  2VV7 A;  3F1N B;  4Y3I A;  1EW0 A;  4UQI M;  1DP8 A;  3T4T A;  4EW7 A;  4JGR A;  4ETX A;  4NXF A;  4KQD A;  4BBT A;  2ZMV A;  3T4O A;  1P9R A;  4EU0 A;  4CLC B;  3A0S A;  3ICY A;  4BWI A;  1STZ A;  1P0Z A;  1T1B A;  4ETZ A;  3F1P B;  1XFN A;  2W1T A;  3BY8 A;  1NWZ A;  3UB8 A;  2GNX A;  3VE4 A;  2H28 A;  2VX8 A;  4Q0J A;  2PHY A;  3UE3 A;  3LR4 A;  4NKP A;  3MFX A;  2J80 A;  4BBU A;  2QWS A;  1MZU A;  5K5B A;  3A0R A;  4NXG A;  3LI9 A;  2INW A;  2VV8 A;  3C8C A;  4G3W A;  3P7N A;  1F98 A;  2FZ0 A;  2VGL M;  3H82 A;  5HDD A;  5IT5 A;  4JGQ A;  5EFW A;  3PHY A;  3W2Z A;  4P6Z M;  3MMH A;  4JGP A;  5HPI A;  4HJ3 A;  4Q0H A;  1WA9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...