3MR0A

Crystal structure of sensory box histidine kinase/response regulator from burkholderia thailandensis e264
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
134
structure length
131
Chain Sequence
ERFQLAVSGASAGLWDWNPKTGAMYLSPHFKKIMGYEDHELPDEITESIHPDDRARVLAALKAHLEHRDTYDVEYRVRTRSGDFRWIQSRGQALWNSAGEPYRMVGWIMDVTDRKRDEDALRVSREELRRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Sensory Box Histidine Kinase/Response Regulator from Burkholderia thailandensis E264
rcsb
source organism Burkholderia thailandensis
molecule tags Transcription regulator
molecule keywords Sensory box histidine kinase/response regulator
total genus 35
structure length 131
sequence length 134
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3mr0A01
4JGOA 2PD7A 5G4YA 4PKYA 5HD3A 4EXOA 2R78A 2OWHA 2B02A 1T18A 3MFXA 4DJ3A 3B33A 3LIBA 1MZUA 3CLOA 4I39A 2PHYA 4EETB 1S4SA 5EFWA 4YWZA 3K3CA 3LIFA 5F6AA 4R70A 3ZQ5A 3OLOA 3T50A 4PKYG 1OTEA 1G28A 4R38A 5J7EA 3NHQA 2ZOHA 1OTDA 1VB6A 2JN7A 2WKQA 1TS8A 5HDSA 5KIZA 4KUOA 1N9OA 3C8CA 3H82A 5F5YA 2PDRA 2ZOIA 2A24A 4LRZE 2PR6A 2GJ3A 2D02A 2JHEA 5DJUA 4EW7A 1OTIA 2KX6A 2P7JA 3H7WA 3VOLA 5HWVA 2V0WA 1DP8A 1XJ3A 2L0WA 2V9AA 3CAXA 3HJIA 1LSWA 3ICYA 2VEAA 2W27A 2QHKA 3MR0A 1JNUA 1TS7A 2V0UA 1TS0A 2L1MA 3LYXA 3P7NA 2V1BA 4NXEA 4EESA 5HWWA 4LPZA 2BASA 1OJ5A 3LIDA 1NWZA 3RTYA 2WKPA 3MXQA 2W0NA 4GHIB 4WF0A 4GHIA 1OT9A 2ZBBA 3K3DA 4HY8A 2VV6A 4KQDA 4XT2A 4EQ1A 3UB6A 1BYWA 3C2WA 1S1ZA 3BY9A 2I9VA 3LICA 3LUQA 5TBMA 1EW0A 1GSXA 4I3JA 4WLAA 5DKKA 2V1AA 4BBTA 2L4RA 3H9WA 4JGRA 3MJQA 2K7SA 1ODVA 1UGUA 4GS9A 4DJ2A 3F1OB 5AVEA 1XJ2A 2A24B 3E4OA 3BY8A 5HDDA 4EEUA 5HZHA 3SW1A 3CWFA 4HQAA 4WN5A 3VE3A 4NXFA 4HP9A 4L9FA 4F3LB 4LRXC 1XJ6A 2QJ7A 1DP9A 4RQ9A 1LSXA 4HJ4A 3PYPA 1T19A 2KDKA 5HDCA 5HD5A 1T1AA 1XJ4A 1N9LA 5DKLA 4EEPA 2QJ5A 4M4XA 3NOUC 2Z6CA 4HHDA 1P0ZA 4JGPA 4MN5A 4HJ6A 4WUJA 1D7EA 2PYRA 4K08A 4E04A 1F9IA 1V9ZA 3LI8A 3MQQA 2CMNA 2INWA 1UWPX 2M1CA 3PHYA 3LI9A 4EERA 1LSVA 2HV1A 2J80A 2Z6DA 2PD8A 3GDIA 4GCZA 2QWSA 2VLGA 4HIAA 3KX0X 4HOIA 1T1BA 3EWKA 4KUKA 4L9GA 5F69A 1UWNX 5TBMB 5I5LA 5A8BA 4H6JB 1XFQA 4GW9A 3UB7A 2YKHA 2YKFA 4LLOB 4R6LA 4WL9A 3UE6A 4HP4A 5J3WA 4BBVA 3FG8A 4I38A 2EA9A 4BBUA 5IU1A 2WKRA 3A0VA 3EEHA 4HI4A 3UB8A 1LL8A 3MQOA 1DRMA 2QKPA 4HNBA 4NXGA 5DJTA 3NJAA 5HWTA 4F3LA 5HSQA 3E4PA 4MN6A 2D01A 1V9YA 4HH3A 3F1PA 4I5SA 1D06A 3RH8B 4B9OA 1Y28A 1TS6A 2PR5A 3BWLA 4NXBA 1S66L 4XT2B 4GS9B 2H28A 5G4ZA 3D72A 4I3AA 5AVFA 5J4EA 2PYPA 1X0OA 2OOLA 4L9EA 1LT0A 3LIEA 1OTAA 1XFNA 3VE4A 3NOPC 1DP6A 3UB9A 3A0RA 4LRYC 3UMDA 2VV7A 3E4QA 3IS2B 4JGQA 1GSWA 4I3IA 5IS1A 1T1CA 3GECA 3IBRA 3F1OA 3G6OA 1N9NA 1OT6A 3F1NB 1WA9A 3H7WB 3F1NA 5F68A 1OJGA 3ULFA 1P97A 4R3AA 1F98A 1GSVA 4HJ3A 4H6JA 3F1PB 2OWJA 3H82B 3UMEA 1S4RA 3A0SA 1OTBA 3HJKA 3IS2A 3LIAA 1KOUA 3FC7A 1S1YA 2VV8A 3NOTC 4HH2A 1S67L
chains in the Genus database with same CATH superfamily
4PKYA 3LFVA 2HP5A 4FH2A 3DTIA 1SKOA 5FI2A 1ACFA 3VP3A 2H5SA 4Q8IA 3IH8A 2ZOHA 2WKQA 4LCLA 2PR6A 2ZLYA 1PRQA 4ZBEA 4X55A 1XGJA 2J3TD 2WGWB 2ZC3B 1FIKA 1NJ4A 2L1MA 4II7A 1KGGA 3BFCA 3LEZA 4OOMA 5TBMA 4A5RA 5A92A 2Z2LB 3H9WA 3CJMA 2EX2A 4GS9A 4WEKA 2ZM0A 1LL9A 2Y59A 1DP9A 3IWIA 3NC8A 5HDCA 3RXXA 3MF0A 3RXWA 4HHDA 4JPMA 2EFXA 2INWA 5CHMA 5TR7A 3D9YA 1NZOA 4BMWA 3Q1FA 3UB7A 4UA6A 5IT5A 3R7WA 3UE3A 2QKPA 5HSQA 1D1JA 1IYSA 3VP4A 3ZDJA 3RH8B 1Y28A 1SKOB 5G4ZA 4WZ5C 2UV0E 2H28A 4WM9A 3V39A 2KLIA 2EWVA 3G31A 4PM6A 4QY6A 1WYCA 3BFFA 4FH4A 3H7WB 2WK0A 4EV4A 3P01A 5EVIA 1VETB 3MFXA 3B33A 1XPBA 5CX7A 3LIFA 3DTMA 4JKTA 4XUXA 1DJCA 3MKEA 4BWIA 3NHQA 3E2LA 3Q82A 4KUOA 1TDLA 4EWFA 4EBNA 1LSWA 1CF0A 3P7NA 4OONA 1TS0A 4X56A 1GCEA 3IXDA 4IBRA 3IX3A 4QD4A 4ZJ1A 5CTMA 2C6WB 4NG2A 4C6YA 4PMAA 3V50A 4K91A 2ZL1A 3KSFA 4Z1WA 2EWWA 3MXRA 3CI6A 1VHMA 4DF6A 1SKFA 4MN5A 3A3DA 5C5KA 2HV1A 2J80A 2BG1A 4L9GA 3S22A 3NECA 3N4IA 2XR0A 5A8BA 4Y2FA 4JLFA 4WL9A 4BENA 3CITA 1JVJA 1LL8A 1DY6A 2XQZA 1ALQA 3D72A 4E3OA 4ETXA 3Q81A 1BLPA 3E4QA 5IS1A 5KZHA 5F68A 3L9KA 3ZG9B 2OAQ1 3G2YA 3HJKA 3NOTC 4B93A 5EOEA 2OWHA 4LENA 4OOLA 5CERA 4EETB 5CECA 3A3FA 4MBFA 4L0LA 5J8XA 4G3VA 2ZM8A 2Q9NA 4ESPA 1ONGA 4X68A 4DMZA 5FDSA 1WE4A 3IQAA 2QMIA 4EW7A 3ICYA 4UQIM 3FYZA 4OVDA 2PBDP 4WF0A 3LY3A 2A49A 5FEGA 4LV3A 4S2MA 1SCWA 1H8ZA 4OPZA 1LI9A 5FASA 2WGVA 3SH8A 2WKEA 5F1FA 1C3BA 1PNEA 4OPRA 1EWZA 2X02A 3ZVTA 3IHBA 1G6AA 4RX3A 3MQQA 3QP5A 4P6ZM 2Z6DA 3G30A 3TG9A 3HLEA 5TBMB 3CZDA 2V2FF 3UO9A 4CLCE 4HP4A 5J3WA 2G2WA 3MQOA 4MN6A 4F94A 1PW8A 1D06A 3GMWA 4XT2B 2QZ6A 5A93A 3AGDA 3SH9A 1J3WA 1JWVA 4DXCA 1YSPA 2VA0A 2V8CA 2PBYA 5L2FA 4WBGA 3ZG8B 1L0GA 1F98A 3WRZA 4NK3A 3FC7A 3PBOA 4N1HA 3ZG5A 4S2KA 4R1GA 3CLOA 4I39A 1GHMA 4DE3A 1RGYA 3M6BA 1NLZA 4GZBA 2EX9A 3G34A 4CLCC 4JF4A 2P74A 1K54C 3VOLA 3TW8A 3HJIA 2ZQ8A 1PIOA 3MFDA 1JTGA 1RGZA 3LYXA 3VP2A 1YPRA 1TDGA 1DJBA 5CXWA 2VJWA 3BEBA 3LR3A 1MXOA 3GRJA 1KDWA 2M7VA 1PW1A 1ONHA 3Q7VB 3QP8A 3E4OA 3E98A 5DVAA 3A3IA 4HP9A 1MWSA 1VETA 2DCFA 3IXHA 1LSXA 5BOHA 3T12B 1BUEA 2KDKA 1BTLA 2G2UA 2QJ5A 2ZMVA 2G7UA 4DE0A 3GDIA 4CLCA 3UB6A 3KX0X 3QP1A 5K5BA 4KG6A 3QP4A 2YKHA 4MDZA 2W3GA 3EEHA 5CRFA 4B4XA 3T4OA 2HF6A 5KMWA 3R7WB 1TS6A 2PR5A 1LT0A 1H8MA 2LB5A 3HUNA 3Q7ZA 4WEJA 3UMDA 3ZFZA 5EM1A 4R23A 4U0XA 1N9NA 3F1NB 2P04A 2JKRI 1GSVA 3F1PB 1K25A 1OTBA 2VV8A 4DJ3A 2QYBA 1H3QA 2XFSA 2J9PA 1YT4A 3ZGAB 3TJZC 3HLCA 3LIBA 4Y3IA 4Y5FA 1S4SA 2W1TB 1TD5A 1IYOA 3T4TA 1NYYA 2CC1A 3LGOA 3JVUA 1K4EA 1MY8A 4DN0A 3TOIA 3C30A 1ESIA 3VMAA 4YFMA 3CAXA 4GN2A 5MC7A 2W27A 4GJ4A 2ZQ9A 3W4QA 3E2KA 4O8GA 3LIDA 1CI9A 2ZBBA 4QJGA 1BYWA 3MZFA 5L07A 1KE4A 4BBTA 3TSGA 2J3TC 3UDFA 3T1SA 1JTDA 4DJ2A 5F83A 4WN5A 4KG2A 5FAQA 2HDRA 4XUZA 5HD5A 1CI8A 1XJ4A 2W3HA 4UQIS 4OQGA 4OQHA 2XH9A 4R4RA 3V67A 5HX9A 3UE6A 2WGIA 2J7VA 4G3WA 4QPRA 5HAQA 5HWTA 2O0YA 3GTCA 3C4PA 4NXBA 1KVLA 4YINA 3MMHA 5A90A 4GOGA 1PYYA 4L9EA 4DDYA 4Y13A 2VV7A 5GHZA 4MLLA 4K0XA 4Y0TA 2W1RA 3QP6A 3N6IA 3UMEA 3LR4A 1S6RA 3IWOA 3G2ZA 5L10A 4HH2A 1S67L 4OOYA 1MZUA 3ZNYA 3LEQA 4KQQA 5FQQA 2OAP1 1G5UA 1PWDA 4S2IA 2Y8HA 3BQAA 3V5MA 3D4FA 3EQVA 4WELA 4R0QA 5KSCA 3ITBA 1NWZA 4ID4A 2W0NA 3QP2A 2PU2A 4DDSA 2WZXA 1UGUA 3V3RA 3F1OB 2HDUA 1A0KA 2XDMA 4CLCB 2P08A 2R9WA 4XXRA 3UE0A 4KZAA 3PBRA 1DJAA 5TGFA 1FCMA 4HJ6A 4EBPA 3WS2A 2VGKA 4OLDA 2ZC4B 3ZYTA 3M2JA 5EUAA 5FEFA 1VEUA 3QNCA 4GNUA 2YKFA 3FG8A 2WAFA 4Q0HA 3EQUA 4BBUA 4GDBA 2FFFB 1NYMA 4F3LA 2XFTA 2ZMFA 2OLUA 4KG5A 3S7PA 3T1XA 2ZQAA 3T1QB 3C7VA 3UDIA 4E3LA 1TEMA 1J9MA 3PXPA 5DTKA 2P9VA 2UWXA 1PFLA 4I3IA 5HL1A 1P97A 3CG5A 3HLDA 1IKIA 5CGSA 2ZMAA 4IJGA 4JGOA 3LO7A 4E3NA 2ACGA 2JKRM 4EUZA 1K0KA 3UE1A 1E25A 1IELA 3PBNA 5GLAA 2ZL1B 1L2SA 2ZOIA 2A2LA 3BW6A 1K56A 5EECA 3PR6A 2Y2PA 4XT2A 4EQ1A 3LY4A 3BY9A 1GHIA 3LICA 1GSXA 2MJ6A 2J8YA 2O99A 5IHVA 1K57C 4F3LB 4QB8A 1XKZA 4AFIA 3PYPA 4HBTA 2AVXA 2WKIA 1XX2A 5DKLA 4IEDA 1P0ZA 1AXBA 4K08A 1M6KA 5FAOA 3HLBA 3LI9A 3K2NA 1LSVA 4E3KA 1ES2A 3IX8A 4IHQA 1TVFA 4N1XA 4N92A 4PM7A 4OP5A 2WADA 1XP4A 4QHCA 1DRMA 3KSHA 2O9BA 2A3UA 1ERQA 4WZ4A 1EI5A 3QHYA 3P98A 4UEYA 1P9WA 3C7UA 4BD0A 3T4KA 5DF9A 1SDNA 1T1CA 4ZJ2A 3G6OA 1YLZA 3LIAA 4EU0A 5G4YA 1CJFA 2J3WA 3HREA 1H5XA 4X1LA 4WMCA 2X01A 1YAXA 4M3KA 2JBFA 1ESUA 1OTEA 3Q07A 4R38A 1ZG4A 1FCNA 5HDSA 2XROA 3T4LA 1K4FA 4X1MA 5HWVA 4PM9A 4B88A 5CHJA 3M2KA 4P6ZS 3SS5A 1O07A 2JKFA 3UPNA 3MXQA 4RA7A 2XK1A 1MC0A 2VGLM 4CLCD 1FR1A 2V1AA 2K2NA 4JGRA 3MJQA 1IFQA 5EVIC 3FPVA 2HP6A 3VE3A 3WS1A 2ZJ9A 3N8RA 2XRNA 3PTEA 2XGNA 1T1AA 3MQ0A 3IH9A 2E8IA 2PT7A 3OPHA 4C3QA 2XA7M 4QY5A 4N9KA 4HESA 4IUKA 2FZ0A 4O7DA 4KZ8A 2C5WB 3W8KA 2O9AA 3KYZA 3NJAA 1BSGA 2B95A 1YLJA 1K38A 4S2NA 1CEFA 3OOVA 3FWLA 1S66L 5HARA 3UPPA 2XLNA 3OCLA 3C38A 3IS2B 1K55A 2Y2IA 1NXYA 1K6SA 1OT6A 3NBLA 1MPLA 3GSGA 5CTNA 2OWJA 4JF5A 3BYDA 3W2ZA 4KENB 1YLYA 3MKFA 1NRJA 5JYPA 4KZBA 3OLOA 5E2EA 3T50A 1LHYA 2W1TA 4R4SA 5F5YA 2NUTC 3IX4A 4PAUA 3H7WA 1XJ3A 2L0WA 4JGQA 4LFUA 4P87A 4NXEA 5HWWA 2V1BA 4Y17A 3GQZA 5DF7A 4LPZA 5EVID 4KZ5A 4LV1A 3KO6A 4UA7A 3IBJA 1Z6FA 3KSGA 4WYYA 2Y91A 4FSFA 5DKKA 3VFFA 1BLHA 5EOOA 1ZTUA 1KVMA 5AVEA 3OBFA 1Q2QA 3CWFA 5FQKA 3PAGA 2VGJA 2XA7S 3O5YA 1XA7A 5GHYA 3T4SA 5FDHA 3A3JA 2DNSA 3SH7A 3LI8A 3PHYA 5HPIA 2CMNA 2HDQA 4JF6A 3M6HA 1NZUA 3FPWA 2E8JA 5F1GA 1UWNX 4LLOB 2JCHA 2Z2MB 3E4PA 1K54A 2W3DA 1KDSA 5EPHA 1IYPA 3IHAA 2ZQDA 3BWLA 4ETZA 4I3AA 1ZC2A 4X6TA 2R9XA 3UPOA 2OOLA 3O88A 3MS6A 3VE4A 3UB9A 4BL3A 2V8FA 2WGWA 1GSWA 3IF5A 5M19A 2WKHA 1WA9A 3ULFA 2OLVA 3NI9A 3VSLA 3A0SA 3IS2A 4GKUA 5DFXA 1S1YA 2EXBA 4JXSA 4BD1A 3S7NA 3BRMA 1IKGA 5L09A 2EX6A 1T18A 4QU3A 3MSHA 5F82A 1XA1A 1OTDA 1VB6A 2JN7A 5KIZA 3CPTA 3VOYA 2A24A 5G18A 3NDEA 2D02A 1LLBA 1E3UA 2V9AA 1O7EA 4D60A 5HL6A 4S2JA 2QPNA 2Y2QA 2WKPA 3SZTA 2EXAA 4CPKA 3K3DA 1M40A 3C2WA 2I9VA 3WS4A 2JE5A 4OP8A 3HLGA 2Y2KA 3EGXC 4MBKA 3W4OA 1XJ2A 3O87A 1ES5A 3BY8A 4HQAA 1F2KA 2H10A 4UAAA 4LV0A 4KQOA 4Y0OA 1T19A 5HAPA 4M4XA 4LV2A 1ZKJA 3R4KA 5AQBA 4ARZA 2JKGA 2PD8A 3EWKA 1I2WA 4OQ0A 1K6RA 3NIAA 1CQAA 3F1PA 4B9OA 3PBTA 2IA2A 1YQSA 5AVFA 2ZC7A 1X0OA 2ZC6B 4S2LA 1Z09A 3A0RA 4LRYC 4RX2A 2ZD8A 3RFBA 4Q0JA 1YKDA 3ZCZA 4R3AA 4H6JA 3HUMA 3NCKA 3S4XA 1K56D 2XD5A 1CEGA 3BJNA 1LL5A 2Y2OA 5HAIA 5HD3A 3ZG7B 3DBAA 2PHYA 1ZG6A 1BULA 3K3CA 3NULA 5DFYA 4GB7A 3KYQA 3T4JA 5FI7A 1FSYA 4S2PA 2QHKA 1JNUA 5M18A 3OZHA 2RCXA 3BM6A 3U4LP 4GHIB 2BTFP 3IF6C 3LUQA 3EEAA 3QNBA 3ZVWA 1VQQA 2IWBA 4Z9QA 4EEUA 5HDDA 3S7OA 5CHUA 1E3UD 3DTEA 5JYOA 1TF1A 4HJ4A 5FA7A 1FR6A 4O0PA 5EE8A 2Z6CA 4JGPA 4JXVA 4WUJA 2PYRA 1KE0A 5FI6A 3BECA 1LI0A 4MCWA 4KUKA 3C4OA 4GD6A 5FQMA 1OPXA 3AGEA 2BLSA 5CEBA 4OKPA 3BLMA 2O9CA 1KGEA 2M7UA 3DWKA 1JWZA 2PRFA 3FV7A 4IBXA 1OTAA 3T4QA 3SOIA 3MZDA 1Y54A 1CK3A 3IBRA 3CUEA 4S2OA 3S1YA 1HZOA 4BJPA 1PZPA 1W8QA 1YMXA 2EFUA 3SS4A 3JVVA 4X53A 1PI5A 1N4OA 2HGVA 1Q2PA 2IWDA 3I7JA 3IWQA 3LCEA 4E6WA 3N8SA 4BLMA 5E43A 1NRFA 1G28A 3HVFA 5J7EA 1TS8A 3H82A 2PDRA 4LRZE 2JHEA 1VEUB 1KGFA 3L7HA 2V0WA 3MR0A 4EXOA 2V0UA 1W8YA 2BASA 4OLGA 5AJGA 2V1ZA 1K55C 5L8MA 1PZOA 1OT9A 2Y2JA 4HY8A 2VV6A 4WMCD 1ES4A 3CPTB 1SDEA 1G6OA 5EM0A 3KSIA 1WYBA 5EVEA 1PI4A 5HPFA 4L9FA 3UN7A 2QJ7A 5DF8A 4PM8A 3WRTA 5GHXA 4QWOA 4U3TA 4ZRRA 3FZCA 1HVBA 2HZ5A 3NOUC 3FKWA 2FFYA 4P85A 4BL2A 4UA9A 2VLGA 3BLSA 1T1BA 3AGFA 4CJNA 2HDSA 4BBVA 4D2OA 1QMEA 2EA9A 2DRWA 5FQJA 3UB8A 5CGWA 4NXGA 4P6BA 3PAEA 4DRTA 3PBQA 1P9RA 4GS9B 1GHPA 5DTTA 1BZAA 1HD8A 2W3FA 1OJGA 4X69A 4C75A 5FSRA 1S4RA 4I38A 3CMZA 4DE1A 3CUEC 2JC7A 3GV9A 4MEZA 3SS3A 3O3VA 4PKYG 1YLPA 5GLDA 1RCJA 2XSSA 4PHTA 4GDNA 2LB9A 3C8CA 3DTKA 2GJ3A 2OSUA 5DJUA 1GA0A 2P7JA 2KX6A 4MMNA 2I72A 5FL3A 1DP8A 1EROA 3UY6A 4KZ3A 2DMWA 4E04A 2J9OA 4IVKA 4EESA 4DXBA 3MBZA 1AWIA 5AQ7A 3RTYA 2Y2HA 4Y0UA 3JYIA 1STZA 4Q0IA 3OPPA 1L3LA 4I3JA 1FSWA 1SHVA 2WYXA 4EQIA 4FOFA 4OPYA 3B47A 4LRXC 4RQ9A 2P9VB 2WAEA 3VSKA 3LR5A 1N9LA 1HTZA 4EEPA 2VK3A 3DAVA 2VX8A 4EERA 4ZDXA 3WS0A 2QWSA 1ZHHB 3G35A 3OPRA 1XFQA 1FOFA 3MXSA 1BLCA 1FCOA 3A3EA 2V20A 5EVIB 1IOUA 2B18A 5DJTA 2D01A 1F5MA 3BFEA 3HLFA 4HH3A 4EUVA 1W79A 2ZC5B 2GNXA 1VM1A 1Y4OA 2HJEA 3NOPC 4U0TA 5GLBA 3NDGA 2HP9A 3F1OA 3F1NA 4OQIA 4KZ6A 3PBSA 4X25A 5E2FA 2Y2NA 2VKSA 2FH5A 5DTSA 3EOIA 4O01A 3ZHHA 4FUWA 1ES3A 1RP5A 3HBRA 4E3IA 4MBHA 4DKIA 4KZ7A 5F6AA 2XF3A 5FQIA 4B4ZA 1XXMA 2VZWA 4PM5A 3D3OA 4LGWA 4EBLA 1TS7A 1MWTA 3UNWA 3G32A 2GZAA 3WWXA 4GHIA 4R3BA 4KQDA 3HUOA 2PU4A 2ZM2A 4PPRA 1S1ZA 2GDNA 3VFHA 3GR2A 4E3MA 1E4DA 2Y2GA 1MWUA 1W5DA 3Q7VA 2OV5A 1NY0A 1L0FA 2H0YA 1YMSA 4Y15A 1XJ6A 3RJUA 3UDXA 3VOZA 2PAVP 1S0WA 1W7FA 4MNRA 3B3XA 2JKTM 4R3JA 2K31A 2M1CA 1UWPX 2HPBA 3B42A 4FCFA 4WZ5A 5A91A 3MZEA 4H6JB 4GW9A 3E0YA 5IU1A 2XEPA 2H0TA 4HI4A 3HCYA 3N7WA 4ME4A 2Y55A 5J4EA 2PYPA 3LIEA 4UHUA 1I2SA 1U60A 2Y2MA 4Y7PA 4DE2A 2KOIA 4YOFA 3H82B 3U2AA 1I5QA 3DW0A 2ZQ7A 3TE8A 2B02A 2HJ9C 5U47A 4N9LA 1FILA 3UB5P 1SZVA 5AQAA 1MBLA 1N9BA 5CGXA 1N9OA 4JXGA 4S2NC 1OTIA 4FD8A 5EVLA 4HOIA 4MN7A 3IF6A 1OJ5A 2NUPC 3NY4A 1W63Q 5I94A 3G4PA 2B5RA 2Y79A 2W3EA 3TRCA 1IEMA 1KE3A 1MWRA 5HZHA 2A24B 4KZ4A 3CHWP 3LR0A 4NXFA 1L0DA 5FATA 5FQ9A 2XD1A 2IWCA 4RVAA 3O86A 1IYQA 4GCZA 4HIAA 5F69A 5GL9A 3OC2A 3ZNTA 2EX8A 5I5LA 4NEED 1QMFA 1G68A 3T1RA 2GX5A 4HBUA 3OCNA 3VV4A 1L0EA 1OMEA 1MKIA 4LCMA 3ISGA 4HNBA 1H0MA 1JWPA 1K57A 2Q0OA 2WZZA 4KZ9A 1YLWA 4E6XA 4I5SA 2Y4AA 1PWCA 5HW3A 4ZAMA 1XFNA 3S7QA 1FQGA 3OPLA 3GECA 5GLCA 2ZQCA 5LBRA 5CEDA 4GD8A 1NLYA 1KOUA 3BFDA 2PD7A 4E3JA 2R78A 3EGDC 3IXGA 4GLQA 4ZJ3A 5EFWA 4YWZA 5D3OA 4HEFA 4R70A 3ZQ5A 4RYEA 5KSHA 2WUQA 2VEAA 3IT9A 3C5AA 4H8RA 5TJJA 1XGIA 1ERMA 3GVBA 3ITAA 3N8LA 3W4PA 1MKMA 5TFQA 2Y2LA 1EW0A 2X71A 4G3KA 4WLAA 2L4RA 3VP0A 1ODVA 2K7SA 3SW1A 5FAPA 3IF6B 4KQRA 4BQMA 2RL3A 4IUHA 4NETA 2VGLS 4ARZB 5M1AA 4P0MA 1HLUP 5AQ9A 1D7EA 3JPUA 4NKPA 1W63M 3P09A 1F9IA 1V9ZA 1BLSA 3WS5A 5E2HA 3DWZA 4JXWA 4ZTKA 3HL9A 4R6LA 4OH0A 1YLTA 2JKTI 3HLWA 2WKRA 3A0VA 3BFGA 3KYEA 3BQ8A 1V9YA 1YSQA 2Q9MA 1GA9A 1BT5A 4IVIA 3FKVA 4CQHA 1DP6A 3V3SA 3VP1A 3ZG0A 4OPQA 5E2GA 1H8YA 3IXBA 4FTXA 1YM1A 5EV0A 4HJ3A 5HFOA 1PWGA 4JBFA 4YNRA 4K0WA
chains in the Genus database with same CATH topology
3CUEC 2QYBA 1H3QA 4PKYA 3LFVA 3TJZC 3LIBA 4Y3IA 4Y5FA 1S4SA 2W1TB 1NRJA 3OLOA 1TD5A 3T50A 4PKYG 2XSSA 2ZOHA 4PHTA 2WKQA 2LB9A 3T4TA 2W1TA 5F5YA 3C8CA 2NUTC 3JVUA 2PR6A 4PAUA 2GJ3A 5DJUA 4DN0A 2P7JA 2KX6A 3C30A 3H7WA 4MMNA 5FL3A 1DP8A 1XJ3A 2L0WA 3CAXA 4JGQA 2J3TD 5MC7A 2DMWA 2W27A 4GJ4A 4E04A 2L1MA 4NXEA 5HWWA 2V1BA 4II7A 4EESA 4LPZA 4O8GA 3LIDA 3KO6A 3RTYA 3IBJA 2ZBBA 4Q0IA 1STZA 1BYWA 3KSGA 4OOMA 5TBMA 4FSFA 4I3JA 5DKKA 4BBTA 3H9WA 2J3TC 4FOFA 1ZTUA 4GS9A 4DJ2A 5AVEA 3OBFA 4WEKA 3CWFA 4WN5A 3B47A 4LRXC 1DP9A 4RQ9A 2XA7S 3O5YA 5HDCA 5HD5A 3LR5A 1XJ4A 1N9LA 3MF0A 3T4SA 4EEPA 2W3HA 4HHDA 3LI8A 3PHYA 2VX8A 2CMNA 2INWA 5HPIA 4EERA 3FPWA 4UQIS 2QWSA 1UWNX 1ZHHB 4BMWA 1XFQA 3UB7A 3V67A 4LLOB 3UE6A 5IT5A 3R7WA 3UE3A 4G3WA 4QPRA 1IOUA 2B18A 2QKPA 5DJTA 5HWTA 2O0YA 5HSQA 3E4PA 2D01A 2W3DA 1F5MA 4HH3A 3RH8B 4EUVA 1Y28A 4NXBA 5G4ZA 3BWLA 3MMHA 2H28A 4ETZA 4I3AA 2GNXA 2OOLA 4L9EA 3VE4A 2HJEA 3NOPC 3UB9A 2KLIA 2EWVA 2VV7A 1GSWA 3F1OA 3H7WB 1WA9A 2W1RA 3F1NA 3ULFA 3PBSA 3UMEA 3A0SA 3IS2A 3LR4A 5DFXA 2VKSA 1S1YA 2FH5A 4HH2A 1S67L 3S7NA 3P01A 3EOIA 4O01A 1T18A 3MFXA 3B33A 1MZUA 5CX7A 3LIFA 5F6AA 4BWIA 3NHQA 1OTDA 1VB6A 2JN7A 2OAP1 5KIZA 4KUOA 2A24A 2Y8HA 2D02A 3BQAA 2VZWA 3D3OA 2V9AA 1LSWA 1TS7A 3P7NA 1TS0A 3EQVA 4WELA 5HL6A 2GZAA 1NWZA 2WKPA 2W0NA 4GHIA 3K3DA 4KQDA 3C2WA 1S1ZA 2I9VA 3EGXC 1UGUA 3F1OB 1XJ2A 3BY8A 4HQAA 3KSFA 4Z1WA 2EWWA 4CLCB 1XJ6A 4KQOA 1T19A 2P08A 3CI6A 3PBRA 1VHMA 4M4XA 4MN5A 4HJ6A 2JKTM 5C5KA 2K31A 3R4KA 2M1CA 1UWPX 3B42A 4ARZA 3ZYTA 2HV1A 2J80A 2PD8A 3EWKA 4L9GA 5A8BA 4Y2FA 4H6JB 4GW9A 2YKFA 4WL9A 3CITA 3FG8A 3E0YA 4Q0HA 3EQUA 4BBUA 5IU1A 4HI4A 1LL8A 4F3LA 3HCYA 2ZMFA 4ME4A 3S7PA 3F1PA 4B9OA 3PBTA 2IA2A 3D72A 5AVFA 5J4EA 2PYPA 1X0OA 3PXPA 3LIEA 4ETXA 3A0RA 4LRYC 3E4QA 4I3IA 5IS1A 3RFBA 4Q0JA 1YKDA 5F68A 1P97A 2OAQ1 4R3AA 4H6JA 2KOIA 4YOFA 3H82B 3U2AA 3HJKA 3NOTC 4IJGA 4B93A 3BJNA 4JGOA 5HD3A 3TE8A 2OWHA 2B02A 4OOLA 3DBAA 2JKRM 2PHYA 4EETB 2HJ9C 4L0LA 3K3CA 4G3VA 5DFYA 3KYQA 3PBNA 4DMZA 1N9OA 3T4JA 2ZOIA 4EW7A 1OTIA 2A2LA 3BW6A 3ICYA 4HOIA 2QHKA 4UQIM 1JNUA 4MN7A 3PR6A 1OJ5A 2NUPC 1W63Q 4GHIB 4WF0A 4XT2A 4EQ1A 2Y79A 3BY9A 3LICA 2W3EA 3LUQA 3EEAA 1GSXA 2MJ6A 3TRCA 4EEUA 5HDDA 5HZHA 2A24B 2O99A 3S7OA 3LR0A 4NXFA 4F3LB 1TF1A 4HJ4A 4AFIA 3PYPA 4O0PA 5DKLA 2Z6CA 1P0ZA 4JGPA 4WUJA 2PYRA 4K08A 3MQQA 3LI9A 3K2NA 4P6ZM 4MCWA 1LSVA 2Z6DA 4GCZA 4HIAA 5F69A 5TBMB 4KUKA 3OC2A 4IHQA 5I5LA 4NEED 4CLCE 4HP4A 5J3WA 2GX5A 1OPXA 3OCNA 3VV4A 4HNBA 3MQOA 1DRMA 3KSHA 2O9BA 4MN6A 2O9CA 2M7UA 4I5SA 1D06A 4XT2B 4UEYA 1OTAA 1XFNA 3T4QA 3S7QA 1YSPA 1P9WA 2VA0A 3T4KA 5DF9A 1T1CA 3GECA 3IBRA 3G6OA 5LBRA 3CUEA 1F98A 4BJPA 1NLYA 3LIAA 4EU0A 1KOUA 3FC7A 3PBOA 5G4YA 2PD7A 3JVVA 2J3WA 2HGVA 2R78A 3EGDC 3CLOA 4I39A 4GLQA 5EFWA 4YWZA 1NLZA 1YAXA 4R70A 3ZQ5A 4CLCC 1OTEA 1G28A 4R38A 5J7EA 1TS8A 5HDSA 5KSHA 3H82A 2PDRA 4LRZE 2XROA 3T4LA 2JHEA 3VOLA 5HWVA 2V0WA 3TW8A 3MR0A 3HJIA 4EXOA 2VEAA 2V0UA 3LYXA 4P6ZS 5TJJA 2BASA 5AJGA 3MXQA 5L8MA 2VJWA 1OT9A 4HY8A 2VV6A 3LR3A 1MKMA 1MC0A 2VGLM 1G6OA 4CLCD 1EW0A 3KSIA 4G3KA 2M7VA 4WLAA 2V1AA 2L4RA 2K2NA 4JGRA 3MJQA 1IFQA 1ODVA 2K7SA 5HPFA 3SW1A 3E4OA 3FPVA 3E98A 3VE3A 4HP9A 4L9FA 2QJ7A 2XRNA 4IUHA 1LSXA 2VGLS 2KDKA 4ARZB 1T1AA 3MQ0A 4ZRRA 2QJ5A 2PT7A 3NOUC 1D7EA 2ZMVA 4NKPA 1W63M 1F9IA 1V9ZA 2XA7M 2G7UA 3GDIA 4IUKA 2VLGA 4CLCA 3UB6A 2FZ0A 3KX0X 1T1BA 5K5BA 2YKHA 4R6LA 4BBVA 2JKTI 2O9AA 2EA9A 4MDZA 2W3GA 2WKRA 3A0VA 3EEHA 3KYZA 3UB8A 4NXGA 3NJAA 3BQ8A 3T4OA 1V9YA 1YSQA 2HF6A 3R7WB 3OOVA 3PBQA 1TS6A 2PR5A 1P9RA 1S66L 4GS9B 4CQHA 1LT0A 1H8MA 2LB5A 4WEJA 1DP6A 3UMDA 3OCLA 3C38A 3IS2B 1N9NA 1OT6A 3F1NB 2P04A 2W3FA 1OJGA 2JKRI 1GSVA 4HJ3A 3F1PB 2OWJA 1S4RA 4I38A 1OTBA 3W2ZA 2VV8A 4DJ3A 4YNRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JGO A;  2PD7 A;  5G4Y A;  4PKY A;  5HD3 A;  4EXO A;  2R78 A;  2OWH A;  2B02 A;  1T18 A;  3MFX A;  4DJ3 A;  3B33 A;  3LIB A;  1MZU A;  3CLO A;  4I39 A;  2PHY A;  4EET B;  1S4S A;  5EFW A;  4YWZ A;  3K3C A;  3LIF A;  5F6A A;  4R70 A;  3ZQ5 A;  3OLO A;  3T50 A;  4PKY G;  1OTE A;  1G28 A;  4R38 A;  5J7E A;  3NHQ A;  2ZOH A;  1OTD A;  1VB6 A;  2JN7 A;  2WKQ A;  1TS8 A;  5HDS A;  5KIZ A;  4KUO A;  1N9O A;  3C8C A;  3H82 A;  5F5Y A;  2PDR A;  2ZOI A;  2A24 A;  4LRZ E;  2PR6 A;  2GJ3 A;  2D02 A;  2JHE A;  5DJU A;  4EW7 A;  1OTI A;  2KX6 A;  2P7J A;  3H7W A;  3VOL A;  5HWV A;  2V0W A;  1DP8 A;  1XJ3 A;  2L0W A;  2V9A A;  3CAX A;  3HJI A;  1LSW A;  3ICY A;  2VEA A;  2W27 A;  2QHK A;  3MR0 A;  1JNU A;  1TS7 A;  2V0U A;  1TS0 A;  2L1M A;  3LYX A;  3P7N A;  2V1B A;  4NXE A;  4EES A;  5HWW A;  4LPZ A;  2BAS A;  1OJ5 A;  3LID A;  1NWZ A;  3RTY A;  2WKP A;  3MXQ A;  2W0N A;  4GHI B;  4WF0 A;  4GHI A;  1OT9 A;  2ZBB A;  3K3D A;  4HY8 A;  2VV6 A;  4KQD A;  4XT2 A;  4EQ1 A;  3UB6 A;  1BYW A;  3C2W A;  1S1Z A;  3BY9 A;  2I9V A;  3LIC A;  3LUQ A;  5TBM A;  1EW0 A;  1GSX A;  4I3J A;  4WLA A;  5DKK A;  2V1A A;  4BBT A;  2L4R A;  3H9W A;  4JGR A;  3MJQ A;  2K7S A;  1ODV A;  1UGU A;  4GS9 A;  4DJ2 A;  3F1O B;  5AVE A;  1XJ2 A;  2A24 B;  3E4O A;  3BY8 A;  5HDD A;  4EEU A;  5HZH A;  3SW1 A;  3CWF A;  4HQA A;  4WN5 A;  3VE3 A;  4NXF A;  4HP9 A;  4L9F A;  4F3L B;  4LRX C;  1XJ6 A;  2QJ7 A;  1DP9 A;  4RQ9 A;  1LSX A;  4HJ4 A;  3PYP A;  1T19 A;  2KDK A;  5HDC A;  5HD5 A;  1T1A A;  1XJ4 A;  1N9L A;  5DKL A;  4EEP A;  2QJ5 A;  4M4X A;  3NOU C;  2Z6C A;  4HHD A;  1P0Z A;  4JGP A;  4MN5 A;  4HJ6 A;  4WUJ A;  1D7E A;  2PYR A;  4K08 A;  4E04 A;  1F9I A;  1V9Z A;  3LI8 A;  3MQQ A;  2CMN A;  2INW A;  1UWP X;  2M1C A;  3PHY A;  3LI9 A;  4EER A;  1LSV A;  2HV1 A;  2J80 A;  2Z6D A;  2PD8 A;  3GDI A;  4GCZ A;  2QWS A;  2VLG A;  4HIA A;  3KX0 X;  4HOI A;  1T1B A;  3EWK A;  4KUK A;  4L9G A;  5F69 A;  1UWN X;  5TBM B;  5I5L A;  5A8B A;  4H6J B;  1XFQ A;  4GW9 A;  3UB7 A;  2YKH A;  2YKF A;  4LLO B;  4R6L A;  4WL9 A;  3UE6 A;  4HP4 A;  5J3W A;  4BBV A;  3FG8 A;  4I38 A;  2EA9 A;  4BBU A;  5IU1 A;  2WKR A;  3A0V A;  3EEH A;  4HI4 A;  3UB8 A;  1LL8 A;  3MQO A;  1DRM A;  2QKP A;  4HNB A;  4NXG A;  5DJT A;  3NJA A;  5HWT A;  4F3L A;  5HSQ A;  3E4P A;  4MN6 A;  2D01 A;  1V9Y A;  4HH3 A;  3F1P A;  4I5S A;  1D06 A;  3RH8 B;  4B9O A;  1Y28 A;  1TS6 A;  2PR5 A;  3BWL A;  4NXB A;  1S66 L;  4XT2 B;  4GS9 B;  2H28 A;  5G4Z A;  3D72 A;  4I3A A;  5AVF A;  5J4E A;  2PYP A;  1X0O A;  2OOL A;  4L9E A;  1LT0 A;  3LIE A;  1OTA A;  1XFN A;  3VE4 A;  3NOP C;  1DP6 A;  3UB9 A;  3A0R A;  4LRY C;  3UMD A;  2VV7 A;  3E4Q A;  3IS2 B;  4JGQ A;  1GSW A;  4I3I A;  5IS1 A;  1T1C A;  3GEC A;  3IBR A;  3F1O A;  3G6O A;  1N9N A;  1OT6 A;  3F1N B;  1WA9 A;  3H7W B;  3F1N A;  5F68 A;  1OJG A;  3ULF A;  1P97 A;  4R3A A;  1F98 A;  1GSV A;  4HJ3 A;  4H6J A;  3F1P B;  2OWJ A;  3H82 B;  3UME A;  1S4R A;  3A0S A;  1OTB A;  3HJK A;  3IS2 A;  3LIA A;  1KOU A;  3FC7 A;  1S1Y A;  2VV8 A;  3NOT C;  4HH2 A;  1S67 L; 
#chains in the Genus database with same CATH topology
 4PKY A;  3LFV A;  2HP5 A;  4FH2 A;  3DTI A;  1SKO A;  5FI2 A;  1ACF A;  3VP3 A;  2H5S A;  4Q8I A;  3IH8 A;  2ZOH A;  2WKQ A;  4LCL A;  2PR6 A;  2ZLY A;  1PRQ A;  4ZBE A;  4X55 A;  1XGJ A;  2J3T D;  2WGW B;  2ZC3 B;  1FIK A;  1NJ4 A;  2L1M A;  4II7 A;  1KGG A;  3BFC A;  3LEZ A;  4OOM A;  5TBM A;  4A5R A;  5A92 A;  2Z2L B;  3H9W A;  3CJM A;  2EX2 A;  4GS9 A;  4WEK A;  2ZM0 A;  1LL9 A;  2Y59 A;  1DP9 A;  3IWI A;  3NC8 A;  5HDC A;  3RXX A;  3MF0 A;  3RXW A;  4HHD A;  4JPM A;  2EFX A;  2INW A;  5CHM A;  5TR7 A;  3D9Y A;  1NZO A;  4BMW A;  3Q1F A;  3UB7 A;  4UA6 A;  5IT5 A;  3R7W A;  3UE3 A;  2QKP A;  5HSQ A;  1D1J A;  1IYS A;  3VP4 A;  3ZDJ A;  3RH8 B;  1Y28 A;  1SKO B;  5G4Z A;  4WZ5 C;  2UV0 E;  2H28 A;  4WM9 A;  3V39 A;  2KLI A;  2EWV A;  3G31 A;  4PM6 A;  4QY6 A;  1WYC A;  3BFF A;  4FH4 A;  3H7W B;  2WK0 A;  4EV4 A;  3P01 A;  5EVI A;  1VET B;  3MFX A;  3B33 A;  1XPB A;  5CX7 A;  3LIF A;  3DTM A;  4JKT A;  4XUX A;  1DJC A;  3MKE A;  4BWI A;  3NHQ A;  3E2L A;  3Q82 A;  4KUO A;  1TDL A;  4EWF A;  4EBN A;  1LSW A;  1CF0 A;  3P7N A;  4OON A;  1TS0 A;  4X56 A;  1GCE A;  3IXD A;  4IBR A;  3IX3 A;  4QD4 A;  4ZJ1 A;  5CTM A;  2C6W B;  4NG2 A;  4C6Y A;  4PMA A;  3V50 A;  4K91 A;  2ZL1 A;  3KSF A;  4Z1W A;  2EWW A;  3MXR A;  3CI6 A;  1VHM A;  4DF6 A;  1SKF A;  4MN5 A;  3A3D A;  5C5K A;  2HV1 A;  2J80 A;  2BG1 A;  4L9G A;  3S22 A;  3NEC A;  3N4I A;  2XR0 A;  5A8B A;  4Y2F A;  4JLF A;  4WL9 A;  4BEN A;  3CIT A;  1JVJ A;  1LL8 A;  1DY6 A;  2XQZ A;  1ALQ A;  3D72 A;  4E3O A;  4ETX A;  3Q81 A;  1BLP A;  3E4Q A;  5IS1 A;  5KZH A;  5F68 A;  3L9K A;  3ZG9 B;  2OAQ 1;  3G2Y A;  3HJK A;  3NOT C;  4B93 A;  5EOE A;  2OWH A;  4LEN A;  4OOL A;  5CER A;  4EET B;  5CEC A;  3A3F A;  4MBF A;  4L0L A;  5J8X A;  4G3V A;  2ZM8 A;  2Q9N A;  4ESP A;  1ONG A;  4X68 A;  4DMZ A;  5FDS A;  1WE4 A;  3IQA A;  2QMI A;  4EW7 A;  3ICY A;  4UQI M;  3FYZ A;  4OVD A;  2PBD P;  4WF0 A;  3LY3 A;  2A49 A;  5FEG A;  4LV3 A;  4S2M A;  1SCW A;  1H8Z A;  4OPZ A;  1LI9 A;  5FAS A;  2WGV A;  3SH8 A;  2WKE A;  5F1F A;  1C3B A;  1PNE A;  4OPR A;  1EWZ A;  2X02 A;  3ZVT A;  3IHB A;  1G6A A;  4RX3 A;  3MQQ A;  3QP5 A;  4P6Z M;  2Z6D A;  3G30 A;  3TG9 A;  3HLE A;  5TBM B;  3CZD A;  2V2F F;  3UO9 A;  4CLC E;  4HP4 A;  5J3W A;  2G2W A;  3MQO A;  4MN6 A;  4F94 A;  1PW8 A;  1D06 A;  3GMW A;  4XT2 B;  2QZ6 A;  5A93 A;  3AGD A;  3SH9 A;  1J3W A;  1JWV A;  4DXC A;  1YSP A;  2VA0 A;  2V8C A;  2PBY A;  5L2F A;  4WBG A;  3ZG8 B;  1L0G A;  1F98 A;  3WRZ A;  4NK3 A;  3FC7 A;  3PBO A;  4N1H A;  3ZG5 A;  4S2K A;  4R1G A;  3CLO A;  4I39 A;  1GHM A;  4DE3 A;  1RGY A;  3M6B A;  1NLZ A;  4GZB A;  2EX9 A;  3G34 A;  4CLC C;  4JF4 A;  2P74 A;  1K54 C;  3VOL A;  3TW8 A;  3HJI A;  2ZQ8 A;  1PIO A;  3MFD A;  1JTG A;  1RGZ A;  3LYX A;  3VP2 A;  1YPR A;  1TDG A;  1DJB A;  5CXW A;  2VJW A;  3BEB A;  3LR3 A;  1MXO A;  3GRJ A;  1KDW A;  2M7V A;  1PW1 A;  1ONH A;  3Q7V B;  3QP8 A;  3E4O A;  3E98 A;  5DVA A;  3A3I A;  4HP9 A;  1MWS A;  1VET A;  2DCF A;  3IXH A;  1LSX A;  5BOH A;  3T12 B;  1BUE A;  2KDK A;  1BTL A;  2G2U A;  2QJ5 A;  2ZMV A;  2G7U A;  4DE0 A;  3GDI A;  4CLC A;  3UB6 A;  3KX0 X;  3QP1 A;  5K5B A;  4KG6 A;  3QP4 A;  2YKH A;  4MDZ A;  2W3G A;  3EEH A;  5CRF A;  4B4X A;  3T4O A;  2HF6 A;  5KMW A;  3R7W B;  1TS6 A;  2PR5 A;  1LT0 A;  1H8M A;  2LB5 A;  3HUN A;  3Q7Z A;  4WEJ A;  3UMD A;  3ZFZ A;  5EM1 A;  4R23 A;  4U0X A;  1N9N A;  3F1N B;  2P04 A;  2JKR I;  1GSV A;  3F1P B;  1K25 A;  1OTB A;  2VV8 A;  4DJ3 A;  2QYB A;  1H3Q A;  2XFS A;  2J9P A;  1YT4 A;  3ZGA B;  3TJZ C;  3HLC A;  3LIB A;  4Y3I A;  4Y5F A;  1S4S A;  2W1T B;  1TD5 A;  1IYO A;  3T4T A;  1NYY A;  2CC1 A;  3LGO A;  3JVU A;  1K4E A;  1MY8 A;  4DN0 A;  3TOI A;  3C30 A;  1ESI A;  3VMA A;  4YFM A;  3CAX A;  4GN2 A;  5MC7 A;  2W27 A;  4GJ4 A;  2ZQ9 A;  3W4Q A;  3E2K A;  4O8G A;  3LID A;  1CI9 A;  2ZBB A;  4QJG A;  1BYW A;  3MZF A;  5L07 A;  1KE4 A;  4BBT A;  3TSG A;  2J3T C;  3UDF A;  3T1S A;  1JTD A;  4DJ2 A;  5F83 A;  4WN5 A;  4KG2 A;  5FAQ A;  2HDR A;  4XUZ A;  5HD5 A;  1CI8 A;  1XJ4 A;  2W3H A;  4UQI S;  4OQG A;  4OQH A;  2XH9 A;  4R4R A;  3V67 A;  5HX9 A;  3UE6 A;  2WGI A;  2J7V A;  4G3W A;  4QPR A;  5HAQ A;  5HWT A;  2O0Y A;  3GTC A;  3C4P A;  4NXB A;  1KVL A;  4YIN A;  3MMH A;  5A90 A;  4GOG A;  1PYY A;  4L9E A;  4DDY A;  4Y13 A;  2VV7 A;  5GHZ A;  4MLL A;  4K0X A;  4Y0T A;  2W1R A;  3QP6 A;  3N6I A;  3UME A;  3LR4 A;  1S6R A;  3IWO A;  3G2Z A;  5L10 A;  4HH2 A;  1S67 L;  4OOY A;  1MZU A;  3ZNY A;  3LEQ A;  4KQQ A;  5FQQ A;  2OAP 1;  1G5U A;  1PWD A;  4S2I A;  2Y8H A;  3BQA A;  3V5M A;  3D4F A;  3EQV A;  4WEL A;  4R0Q A;  5KSC A;  3ITB A;  1NWZ A;  4ID4 A;  2W0N A;  3QP2 A;  2PU2 A;  4DDS A;  2WZX A;  1UGU A;  3V3R A;  3F1O B;  2HDU A;  1A0K A;  2XDM A;  4CLC B;  2P08 A;  2R9W A;  4XXR A;  3UE0 A;  4KZA A;  3PBR A;  1DJA A;  5TGF A;  1FCM A;  4HJ6 A;  4EBP A;  3WS2 A;  2VGK A;  4OLD A;  2ZC4 B;  3ZYT A;  3M2J A;  5EUA A;  5FEF A;  1VEU A;  3QNC A;  4GNU A;  2YKF A;  3FG8 A;  2WAF A;  4Q0H A;  3EQU A;  4BBU A;  4GDB A;  2FFF B;  1NYM A;  4F3L A;  2XFT A;  2ZMF A;  2OLU A;  4KG5 A;  3S7P A;  3T1X A;  2ZQA A;  3T1Q B;  3C7V A;  3UDI A;  4E3L A;  1TEM A;  1J9M A;  3PXP A;  5DTK A;  2P9V A;  2UWX A;  1PFL A;  4I3I A;  5HL1 A;  1P97 A;  3CG5 A;  3HLD A;  1IKI A;  5CGS A;  2ZMA A;  4IJG A;  4JGO A;  3LO7 A;  4E3N A;  2ACG A;  2JKR M;  4EUZ A;  1K0K A;  3UE1 A;  1E25 A;  1IEL A;  3PBN A;  5GLA A;  2ZL1 B;  1L2S A;  2ZOI A;  2A2L A;  3BW6 A;  1K56 A;  5EEC A;  3PR6 A;  2Y2P A;  4XT2 A;  4EQ1 A;  3LY4 A;  3BY9 A;  1GHI A;  3LIC A;  1GSX A;  2MJ6 A;  2J8Y A;  2O99 A;  5IHV A;  1K57 C;  4F3L B;  4QB8 A;  1XKZ A;  4AFI A;  3PYP A;  4HBT A;  2AVX A;  2WKI A;  1XX2 A;  5DKL A;  4IED A;  1P0Z A;  1AXB A;  4K08 A;  1M6K A;  5FAO A;  3HLB A;  3LI9 A;  3K2N A;  1LSV A;  4E3K A;  1ES2 A;  3IX8 A;  4IHQ A;  1TVF A;  4N1X A;  4N92 A;  4PM7 A;  4OP5 A;  2WAD A;  1XP4 A;  4QHC A;  1DRM A;  3KSH A;  2O9B A;  2A3U A;  1ERQ A;  4WZ4 A;  1EI5 A;  3QHY A;  3P98 A;  4UEY A;  1P9W A;  3C7U A;  4BD0 A;  3T4K A;  5DF9 A;  1SDN A;  1T1C A;  4ZJ2 A;  3G6O A;  1YLZ A;  3LIA A;  4EU0 A;  5G4Y A;  1CJF A;  2J3W A;  3HRE A;  1H5X A;  4X1L A;  4WMC A;  2X01 A;  1YAX A;  4M3K A;  2JBF A;  1ESU A;  1OTE A;  3Q07 A;  4R38 A;  1ZG4 A;  1FCN A;  5HDS A;  2XRO A;  3T4L A;  1K4F A;  4X1M A;  5HWV A;  4PM9 A;  4B88 A;  5CHJ A;  3M2K A;  4P6Z S;  3SS5 A;  1O07 A;  2JKF A;  3UPN A;  3MXQ A;  4RA7 A;  2XK1 A;  1MC0 A;  2VGL M;  4CLC D;  1FR1 A;  2V1A A;  2K2N A;  4JGR A;  3MJQ A;  1IFQ A;  5EVI C;  3FPV A;  2HP6 A;  3VE3 A;  3WS1 A;  2ZJ9 A;  3N8R A;  2XRN A;  3PTE A;  2XGN A;  1T1A A;  3MQ0 A;  3IH9 A;  2E8I A;  2PT7 A;  3OPH A;  4C3Q A;  2XA7 M;  4QY5 A;  4N9K A;  4HES A;  4IUK A;  2FZ0 A;  4O7D A;  4KZ8 A;  2C5W B;  3W8K A;  2O9A A;  3KYZ A;  3NJA A;  1BSG A;  2B95 A;  1YLJ A;  1K38 A;  4S2N A;  1CEF A;  3OOV A;  3FWL A;  1S66 L;  5HAR A;  3UPP A;  2XLN A;  3OCL A;  3C38 A;  3IS2 B;  1K55 A;  2Y2I A;  1NXY A;  1K6S A;  1OT6 A;  3NBL A;  1MPL A;  3GSG A;  5CTN A;  2OWJ A;  4JF5 A;  3BYD A;  3W2Z A;  4KEN B;  1YLY A;  3MKF A;  1NRJ A;  5JYP A;  4KZB A;  3OLO A;  5E2E A;  3T50 A;  1LHY A;  2W1T A;  4R4S A;  5F5Y A;  2NUT C;  3IX4 A;  4PAU A;  3H7W A;  1XJ3 A;  2L0W A;  4JGQ A;  4LFU A;  4P87 A;  4NXE A;  5HWW A;  2V1B A;  4Y17 A;  3GQZ A;  5DF7 A;  4LPZ A;  5EVI D;  4KZ5 A;  4LV1 A;  3KO6 A;  4UA7 A;  3IBJ A;  1Z6F A;  3KSG A;  4WYY A;  2Y91 A;  4FSF A;  5DKK A;  3VFF A;  1BLH A;  5EOO A;  1ZTU A;  1KVM A;  5AVE A;  3OBF A;  1Q2Q A;  3CWF A;  5FQK A;  3PAG A;  2VGJ A;  2XA7 S;  3O5Y A;  1XA7 A;  5GHY A;  3T4S A;  5FDH A;  3A3J A;  2DNS A;  3SH7 A;  3LI8 A;  3PHY A;  5HPI A;  2CMN A;  2HDQ A;  4JF6 A;  3M6H A;  1NZU A;  3FPW A;  2E8J A;  5F1G A;  1UWN X;  4LLO B;  2JCH A;  2Z2M B;  3E4P A;  1K54 A;  2W3D A;  1KDS A;  5EPH A;  1IYP A;  3IHA A;  2ZQD A;  3BWL A;  4ETZ A;  4I3A A;  1ZC2 A;  4X6T A;  2R9X A;  3UPO A;  2OOL A;  3O88 A;  3MS6 A;  3VE4 A;  3UB9 A;  4BL3 A;  2V8F A;  2WGW A;  1GSW A;  3IF5 A;  5M19 A;  2WKH A;  1WA9 A;  3ULF A;  2OLV A;  3NI9 A;  3VSL A;  3A0S A;  3IS2 A;  4GKU A;  5DFX A;  1S1Y A;  2EXB A;  4JXS A;  4BD1 A;  3S7N A;  3BRM A;  1IKG A;  5L09 A;  2EX6 A;  1T18 A;  4QU3 A;  3MSH A;  5F82 A;  1XA1 A;  1OTD A;  1VB6 A;  2JN7 A;  5KIZ A;  3CPT A;  3VOY A;  2A24 A;  5G18 A;  3NDE A;  2D02 A;  1LLB A;  1E3U A;  2V9A A;  1O7E A;  4D60 A;  5HL6 A;  4S2J A;  2QPN A;  2Y2Q A;  2WKP A;  3SZT A;  2EXA A;  4CPK A;  3K3D A;  1M40 A;  3C2W A;  2I9V A;  3WS4 A;  2JE5 A;  4OP8 A;  3HLG A;  2Y2K A;  3EGX C;  4MBK A;  3W4O A;  1XJ2 A;  3O87 A;  1ES5 A;  3BY8 A;  4HQA A;  1F2K A;  2H10 A;  4UAA A;  4LV0 A;  4KQO A;  4Y0O A;  1T19 A;  5HAP A;  4M4X A;  4LV2 A;  1ZKJ A;  3R4K A;  5AQB A;  4ARZ A;  2JKG A;  2PD8 A;  3EWK A;  1I2W A;  4OQ0 A;  1K6R A;  3NIA A;  1CQA A;  3F1P A;  4B9O A;  3PBT A;  2IA2 A;  1YQS A;  5AVF A;  2ZC7 A;  1X0O A;  2ZC6 B;  4S2L A;  1Z09 A;  3A0R A;  4LRY C;  4RX2 A;  2ZD8 A;  3RFB A;  4Q0J A;  1YKD A;  3ZCZ A;  4R3A A;  4H6J A;  3HUM A;  3NCK A;  3S4X A;  1K56 D;  2XD5 A;  1CEG A;  3BJN A;  1LL5 A;  2Y2O A;  5HAI A;  5HD3 A;  3ZG7 B;  3DBA A;  2PHY A;  1ZG6 A;  1BUL A;  3K3C A;  3NUL A;  5DFY A;  4GB7 A;  3KYQ A;  3T4J A;  5FI7 A;  1FSY A;  4S2P A;  2QHK A;  1JNU A;  5M18 A;  3OZH A;  2RCX A;  3BM6 A;  3U4L P;  4GHI B;  2BTF P;  3IF6 C;  3LUQ A;  3EEA A;  3QNB A;  3ZVW A;  1VQQ A;  2IWB A;  4Z9Q A;  4EEU A;  5HDD A;  3S7O A;  5CHU A;  1E3U D;  3DTE A;  5JYO A;  1TF1 A;  4HJ4 A;  5FA7 A;  1FR6 A;  4O0P A;  5EE8 A;  2Z6C A;  4JGP A;  4JXV A;  4WUJ A;  2PYR A;  1KE0 A;  5FI6 A;  3BEC A;  1LI0 A;  4MCW A;  4KUK A;  3C4O A;  4GD6 A;  5FQM A;  1OPX A;  3AGE A;  2BLS A;  5CEB A;  4OKP A;  3BLM A;  2O9C A;  1KGE A;  2M7U A;  3DWK A;  1JWZ A;  2PRF A;  3FV7 A;  4IBX A;  1OTA A;  3T4Q A;  3SOI A;  3MZD A;  1Y54 A;  1CK3 A;  3IBR A;  3CUE A;  4S2O A;  3S1Y A;  1HZO A;  4BJP A;  1PZP A;  1W8Q A;  1YMX A;  2EFU A;  3SS4 A;  3JVV A;  4X53 A;  1PI5 A;  1N4O A;  2HGV A;  1Q2P A;  2IWD A;  3I7J A;  3IWQ A;  3LCE A;  4E6W A;  3N8S A;  4BLM A;  5E43 A;  1NRF A;  1G28 A;  3HVF A;  5J7E A;  1TS8 A;  3H82 A;  2PDR A;  4LRZ E;  2JHE A;  1VEU B;  1KGF A;  3L7H A;  2V0W A;  3MR0 A;  4EXO A;  2V0U A;  1W8Y A;  2BAS A;  4OLG A;  5AJG A;  2V1Z A;  1K55 C;  5L8M A;  1PZO A;  1OT9 A;  2Y2J A;  4HY8 A;  2VV6 A;  4WMC D;  1ES4 A;  3CPT B;  1SDE A;  1G6O A;  5EM0 A;  3KSI A;  1WYB A;  5EVE A;  1PI4 A;  5HPF A;  4L9F A;  3UN7 A;  2QJ7 A;  5DF8 A;  4PM8 A;  3WRT A;  5GHX A;  4QWO A;  4U3T A;  4ZRR A;  3FZC A;  1HVB A;  2HZ5 A;  3NOU C;  3FKW A;  2FFY A;  4P85 A;  4BL2 A;  4UA9 A;  2VLG A;  3BLS A;  1T1B A;  3AGF A;  4CJN A;  2HDS A;  4BBV A;  4D2O A;  1QME A;  2EA9 A;  2DRW A;  5FQJ A;  3UB8 A;  5CGW A;  4NXG A;  4P6B A;  3PAE A;  4DRT A;  3PBQ A;  1P9R A;  4GS9 B;  1GHP A;  5DTT A;  1BZA A;  1HD8 A;  2W3F A;  1OJG A;  4X69 A;  4C75 A;  5FSR A;  1S4R A;  4I38 A;  3CMZ A;  4DE1 A;  3CUE C;  2JC7 A;  3GV9 A;  4MEZ A;  3SS3 A;  3O3V A;  4PKY G;  1YLP A;  5GLD A;  1RCJ A;  2XSS A;  4PHT A;  4GDN A;  2LB9 A;  3C8C A;  3DTK A;  2GJ3 A;  2OSU A;  5DJU A;  1GA0 A;  2P7J A;  2KX6 A;  4MMN A;  2I72 A;  5FL3 A;  1DP8 A;  1ERO A;  3UY6 A;  4KZ3 A;  2DMW A;  4E04 A;  2J9O A;  4IVK A;  4EES A;  4DXB A;  3MBZ A;  1AWI A;  5AQ7 A;  3RTY A;  2Y2H A;  4Y0U A;  3JYI A;  1STZ A;  4Q0I A;  3OPP A;  1L3L A;  4I3J A;  1FSW A;  1SHV A;  2WYX A;  4EQI A;  4FOF A;  4OPY A;  3B47 A;  4LRX C;  4RQ9 A;  2P9V B;  2WAE A;  3VSK A;  3LR5 A;  1N9L A;  1HTZ A;  4EEP A;  2VK3 A;  3DAV A;  2VX8 A;  4EER A;  4ZDX A;  3WS0 A;  2QWS A;  1ZHH B;  3G35 A;  3OPR A;  1XFQ A;  1FOF A;  3MXS A;  1BLC A;  1FCO A;  3A3E A;  2V20 A;  5EVI B;  1IOU A;  2B18 A;  5DJT A;  2D01 A;  1F5M A;  3BFE A;  3HLF A;  4HH3 A;  4EUV A;  1W79 A;  2ZC5 B;  2GNX A;  1VM1 A;  1Y4O A;  2HJE A;  3NOP C;  4U0T A;  5GLB A;  3NDG A;  2HP9 A;  3F1O A;  3F1N A;  4OQI A;  4KZ6 A;  3PBS A;  4X25 A;  5E2F A;  2Y2N A;  2VKS A;  2FH5 A;  5DTS A;  3EOI A;  4O01 A;  3ZHH A;  4FUW A;  1ES3 A;  1RP5 A;  3HBR A;  4E3I A;  4MBH A;  4DKI A;  4KZ7 A;  5F6A A;  2XF3 A;  5FQI A;  4B4Z A;  1XXM A;  2VZW A;  4PM5 A;  3D3O A;  4LGW A;  4EBL A;  1TS7 A;  1MWT A;  3UNW A;  3G32 A;  2GZA A;  3WWX A;  4GHI A;  4R3B A;  4KQD A;  3HUO A;  2PU4 A;  2ZM2 A;  4PPR A;  1S1Z A;  2GDN A;  3VFH A;  3GR2 A;  4E3M A;  1E4D A;  2Y2G A;  1MWU A;  1W5D A;  3Q7V A;  2OV5 A;  1NY0 A;  1L0F A;  2H0Y A;  1YMS A;  4Y15 A;  1XJ6 A;  3RJU A;  3UDX A;  3VOZ A;  2PAV P;  1S0W A;  1W7F A;  4MNR A;  3B3X A;  2JKT M;  4R3J A;  2K31 A;  2M1C A;  1UWP X;  2HPB A;  3B42 A;  4FCF A;  4WZ5 A;  5A91 A;  3MZE A;  4H6J B;  4GW9 A;  3E0Y A;  5IU1 A;  2XEP A;  2H0T A;  4HI4 A;  3HCY A;  3N7W A;  4ME4 A;  2Y55 A;  5J4E A;  2PYP A;  3LIE A;  4UHU A;  1I2S A;  1U60 A;  2Y2M A;  4Y7P A;  4DE2 A;  2KOI A;  4YOF A;  3H82 B;  3U2A A;  1I5Q A;  3DW0 A;  2ZQ7 A;  3TE8 A;  2B02 A;  2HJ9 C;  5U47 A;  4N9L A;  1FIL A;  3UB5 P;  1SZV A;  5AQA A;  1MBL A;  1N9B A;  5CGX A;  1N9O A;  4JXG A;  4S2N C;  1OTI A;  4FD8 A;  5EVL A;  4HOI A;  4MN7 A;  3IF6 A;  1OJ5 A;  2NUP C;  3NY4 A;  1W63 Q;  5I94 A;  3G4P A;  2B5R A;  2Y79 A;  2W3E A;  3TRC A;  1IEM A;  1KE3 A;  1MWR A;  5HZH A;  2A24 B;  4KZ4 A;  3CHW P;  3LR0 A;  4NXF A;  1L0D A;  5FAT A;  5FQ9 A;  2XD1 A;  2IWC A;  4RVA A;  3O86 A;  1IYQ A;  4GCZ A;  4HIA A;  5F69 A;  5GL9 A;  3OC2 A;  3ZNT A;  2EX8 A;  5I5L A;  4NEE D;  1QMF A;  1G68 A;  3T1R A;  2GX5 A;  4HBU A;  3OCN A;  3VV4 A;  1L0E A;  1OME A;  1MKI A;  4LCM A;  3ISG A;  4HNB A;  1H0M A;  1JWP A;  1K57 A;  2Q0O A;  2WZZ A;  4KZ9 A;  1YLW A;  4E6X A;  4I5S A;  2Y4A A;  1PWC A;  5HW3 A;  4ZAM A;  1XFN A;  3S7Q A;  1FQG A;  3OPL A;  3GEC A;  5GLC A;  2ZQC A;  5LBR A;  5CED A;  4GD8 A;  1NLY A;  1KOU A;  3BFD A;  2PD7 A;  4E3J A;  2R78 A;  3EGD C;  3IXG A;  4GLQ A;  4ZJ3 A;  5EFW A;  4YWZ A;  5D3O A;  4HEF A;  4R70 A;  3ZQ5 A;  4RYE A;  5KSH A;  2WUQ A;  2VEA A;  3IT9 A;  3C5A A;  4H8R A;  5TJJ A;  1XGI A;  1ERM A;  3GVB A;  3ITA A;  3N8L A;  3W4P A;  1MKM A;  5TFQ A;  2Y2L A;  1EW0 A;  2X71 A;  4G3K A;  4WLA A;  2L4R A;  3VP0 A;  1ODV A;  2K7S A;  3SW1 A;  5FAP A;  3IF6 B;  4KQR A;  4BQM A;  2RL3 A;  4IUH A;  4NET A;  2VGL S;  4ARZ B;  5M1A A;  4P0M A;  1HLU P;  5AQ9 A;  1D7E A;  3JPU A;  4NKP A;  1W63 M;  3P09 A;  1F9I A;  1V9Z A;  1BLS A;  3WS5 A;  5E2H A;  3DWZ A;  4JXW A;  4ZTK A;  3HL9 A;  4R6L A;  4OH0 A;  1YLT A;  2JKT I;  3HLW A;  2WKR A;  3A0V A;  3BFG A;  3KYE A;  3BQ8 A;  1V9Y A;  1YSQ A;  2Q9M A;  1GA9 A;  1BT5 A;  4IVI A;  3FKV A;  4CQH A;  1DP6 A;  3V3S A;  3VP1 A;  3ZG0 A;  4OPQ A;  5E2G A;  1H8Y A;  3IXB A;  4FTX A;  1YM1 A;  5EV0 A;  4HJ3 A;  5HFO A;  1PWG A;  4JBF A;  4YNR A;  4K0W A; 
#chains in the Genus database with same CATH homology
 3CUE C;  2QYB A;  1H3Q A;  4PKY A;  3LFV A;  3TJZ C;  3LIB A;  4Y3I A;  4Y5F A;  1S4S A;  2W1T B;  1NRJ A;  3OLO A;  1TD5 A;  3T50 A;  4PKY G;  2XSS A;  2ZOH A;  4PHT A;  2WKQ A;  2LB9 A;  3T4T A;  2W1T A;  5F5Y A;  3C8C A;  2NUT C;  3JVU A;  2PR6 A;  4PAU A;  2GJ3 A;  5DJU A;  4DN0 A;  2P7J A;  2KX6 A;  3C30 A;  3H7W A;  4MMN A;  5FL3 A;  1DP8 A;  1XJ3 A;  2L0W A;  3CAX A;  4JGQ A;  2J3T D;  5MC7 A;  2DMW A;  2W27 A;  4GJ4 A;  4E04 A;  2L1M A;  4NXE A;  5HWW A;  2V1B A;  4II7 A;  4EES A;  4LPZ A;  4O8G A;  3LID A;  3KO6 A;  3RTY A;  3IBJ A;  2ZBB A;  4Q0I A;  1STZ A;  1BYW A;  3KSG A;  4OOM A;  5TBM A;  4FSF A;  4I3J A;  5DKK A;  4BBT A;  3H9W A;  2J3T C;  4FOF A;  1ZTU A;  4GS9 A;  4DJ2 A;  5AVE A;  3OBF A;  4WEK A;  3CWF A;  4WN5 A;  3B47 A;  4LRX C;  1DP9 A;  4RQ9 A;  2XA7 S;  3O5Y A;  5HDC A;  5HD5 A;  3LR5 A;  1XJ4 A;  1N9L A;  3MF0 A;  3T4S A;  4EEP A;  2W3H A;  4HHD A;  3LI8 A;  3PHY A;  2VX8 A;  2CMN A;  2INW A;  5HPI A;  4EER A;  3FPW A;  4UQI S;  2QWS A;  1UWN X;  1ZHH B;  4BMW A;  1XFQ A;  3UB7 A;  3V67 A;  4LLO B;  3UE6 A;  5IT5 A;  3R7W A;  3UE3 A;  4G3W A;  4QPR A;  1IOU A;  2B18 A;  2QKP A;  5DJT A;  5HWT A;  2O0Y A;  5HSQ A;  3E4P A;  2D01 A;  2W3D A;  1F5M A;  4HH3 A;  3RH8 B;  4EUV A;  1Y28 A;  4NXB A;  5G4Z A;  3BWL A;  3MMH A;  2H28 A;  4ETZ A;  4I3A A;  2GNX A;  2OOL A;  4L9E A;  3VE4 A;  2HJE A;  3NOP C;  3UB9 A;  2KLI A;  2EWV A;  2VV7 A;  1GSW A;  3F1O A;  3H7W B;  1WA9 A;  2W1R A;  3F1N A;  3ULF A;  3PBS A;  3UME A;  3A0S A;  3IS2 A;  3LR4 A;  5DFX A;  2VKS A;  1S1Y A;  2FH5 A;  4HH2 A;  1S67 L;  3S7N A;  3P01 A;  3EOI A;  4O01 A;  1T18 A;  3MFX A;  3B33 A;  1MZU A;  5CX7 A;  3LIF A;  5F6A A;  4BWI A;  3NHQ A;  1OTD A;  1VB6 A;  2JN7 A;  2OAP 1;  5KIZ A;  4KUO A;  2A24 A;  2Y8H A;  2D02 A;  3BQA A;  2VZW A;  3D3O A;  2V9A A;  1LSW A;  1TS7 A;  3P7N A;  1TS0 A;  3EQV A;  4WEL A;  5HL6 A;  2GZA A;  1NWZ A;  2WKP A;  2W0N A;  4GHI A;  3K3D A;  4KQD A;  3C2W A;  1S1Z A;  2I9V A;  3EGX C;  1UGU A;  3F1O B;  1XJ2 A;  3BY8 A;  4HQA A;  3KSF A;  4Z1W A;  2EWW A;  4CLC B;  1XJ6 A;  4KQO A;  1T19 A;  2P08 A;  3CI6 A;  3PBR A;  1VHM A;  4M4X A;  4MN5 A;  4HJ6 A;  2JKT M;  5C5K A;  2K31 A;  3R4K A;  2M1C A;  1UWP X;  3B42 A;  4ARZ A;  3ZYT A;  2HV1 A;  2J80 A;  2PD8 A;  3EWK A;  4L9G A;  5A8B A;  4Y2F A;  4H6J B;  4GW9 A;  2YKF A;  4WL9 A;  3CIT A;  3FG8 A;  3E0Y A;  4Q0H A;  3EQU A;  4BBU A;  5IU1 A;  4HI4 A;  1LL8 A;  4F3L A;  3HCY A;  2ZMF A;  4ME4 A;  3S7P A;  3F1P A;  4B9O A;  3PBT A;  2IA2 A;  3D72 A;  5AVF A;  5J4E A;  2PYP A;  1X0O A;  3PXP A;  3LIE A;  4ETX A;  3A0R A;  4LRY C;  3E4Q A;  4I3I A;  5IS1 A;  3RFB A;  4Q0J A;  1YKD A;  5F68 A;  1P97 A;  2OAQ 1;  4R3A A;  4H6J A;  2KOI A;  4YOF A;  3H82 B;  3U2A A;  3HJK A;  3NOT C;  4IJG A;  4B93 A;  3BJN A;  4JGO A;  5HD3 A;  3TE8 A;  2OWH A;  2B02 A;  4OOL A;  3DBA A;  2JKR M;  2PHY A;  4EET B;  2HJ9 C;  4L0L A;  3K3C A;  4G3V A;  5DFY A;  3KYQ A;  3PBN A;  4DMZ A;  1N9O A;  3T4J A;  2ZOI A;  4EW7 A;  1OTI A;  2A2L A;  3BW6 A;  3ICY A;  4HOI A;  2QHK A;  4UQI M;  1JNU A;  4MN7 A;  3PR6 A;  1OJ5 A;  2NUP C;  1W63 Q;  4GHI B;  4WF0 A;  4XT2 A;  4EQ1 A;  2Y79 A;  3BY9 A;  3LIC A;  2W3E A;  3LUQ A;  3EEA A;  1GSX A;  2MJ6 A;  3TRC A;  4EEU A;  5HDD A;  5HZH A;  2A24 B;  2O99 A;  3S7O A;  3LR0 A;  4NXF A;  4F3L B;  1TF1 A;  4HJ4 A;  4AFI A;  3PYP A;  4O0P A;  5DKL A;  2Z6C A;  1P0Z A;  4JGP A;  4WUJ A;  2PYR A;  4K08 A;  3MQQ A;  3LI9 A;  3K2N A;  4P6Z M;  4MCW A;  1LSV A;  2Z6D A;  4GCZ A;  4HIA A;  5F69 A;  5TBM B;  4KUK A;  3OC2 A;  4IHQ A;  5I5L A;  4NEE D;  4CLC E;  4HP4 A;  5J3W A;  2GX5 A;  1OPX A;  3OCN A;  3VV4 A;  4HNB A;  3MQO A;  1DRM A;  3KSH A;  2O9B A;  4MN6 A;  2O9C A;  2M7U A;  4I5S A;  1D06 A;  4XT2 B;  4UEY A;  1OTA A;  1XFN A;  3T4Q A;  3S7Q A;  1YSP A;  1P9W A;  2VA0 A;  3T4K A;  5DF9 A;  1T1C A;  3GEC A;  3IBR A;  3G6O A;  5LBR A;  3CUE A;  1F98 A;  4BJP A;  1NLY A;  3LIA A;  4EU0 A;  1KOU A;  3FC7 A;  3PBO A;  5G4Y A;  2PD7 A;  3JVV A;  2J3W A;  2HGV A;  2R78 A;  3EGD C;  3CLO A;  4I39 A;  4GLQ A;  5EFW A;  4YWZ A;  1NLZ A;  1YAX A;  4R70 A;  3ZQ5 A;  4CLC C;  1OTE A;  1G28 A;  4R38 A;  5J7E A;  1TS8 A;  5HDS A;  5KSH A;  3H82 A;  2PDR A;  4LRZ E;  2XRO A;  3T4L A;  2JHE A;  3VOL A;  5HWV A;  2V0W A;  3TW8 A;  3MR0 A;  3HJI A;  4EXO A;  2VEA A;  2V0U A;  3LYX A;  4P6Z S;  5TJJ A;  2BAS A;  5AJG A;  3MXQ A;  5L8M A;  2VJW A;  1OT9 A;  4HY8 A;  2VV6 A;  3LR3 A;  1MKM A;  1MC0 A;  2VGL M;  1G6O A;  4CLC D;  1EW0 A;  3KSI A;  4G3K A;  2M7V A;  4WLA A;  2V1A A;  2L4R A;  2K2N A;  4JGR A;  3MJQ A;  1IFQ A;  1ODV A;  2K7S A;  5HPF A;  3SW1 A;  3E4O A;  3FPV A;  3E98 A;  3VE3 A;  4HP9 A;  4L9F A;  2QJ7 A;  2XRN A;  4IUH A;  1LSX A;  2VGL S;  2KDK A;  4ARZ B;  1T1A A;  3MQ0 A;  4ZRR A;  2QJ5 A;  2PT7 A;  3NOU C;  1D7E A;  2ZMV A;  4NKP A;  1W63 M;  1F9I A;  1V9Z A;  2XA7 M;  2G7U A;  3GDI A;  4IUK A;  2VLG A;  4CLC A;  3UB6 A;  2FZ0 A;  3KX0 X;  1T1B A;  5K5B A;  2YKH A;  4R6L A;  4BBV A;  2JKT I;  2O9A A;  2EA9 A;  4MDZ A;  2W3G A;  2WKR A;  3A0V A;  3EEH A;  3KYZ A;  3UB8 A;  4NXG A;  3NJA A;  3BQ8 A;  3T4O A;  1V9Y A;  1YSQ A;  2HF6 A;  3R7W B;  3OOV A;  3PBQ A;  1TS6 A;  2PR5 A;  1P9R A;  1S66 L;  4GS9 B;  4CQH A;  1LT0 A;  1H8M A;  2LB5 A;  4WEJ A;  1DP6 A;  3UMD A;  3OCL A;  3C38 A;  3IS2 B;  1N9N A;  1OT6 A;  3F1N B;  2P04 A;  2W3F A;  1OJG A;  2JKR I;  1GSV A;  4HJ3 A;  3F1P B;  2OWJ A;  1S4R A;  4I38 A;  1OTB A;  3W2Z A;  2VV8 A;  4DJ3 A;  4YNR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...