3MR0A

Crystal structure of sensory box histidine kinase/response regulator from burkholderia thailandensis e264
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
134
structure length
131
Chain Sequence
ERFQLAVSGASAGLWDWNPKTGAMYLSPHFKKIMGYEDHELPDEITESIHPDDRARVLAALKAHLEHRDTYDVEYRVRTRSGDFRWIQSRGQALWNSAGEPYRMVGWIMDVTDRKRDEDALRVSREELRRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Sensory Box Histidine Kinase/Response Regulator from Burkholderia thailandensis E264
rcsb
source organism Burkholderia thailandensis
molecule tags Transcription regulator
molecule keywords Sensory box histidine kinase/response regulator
total genus 35
structure length 131
sequence length 134
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3mr0A01
1OJ5A 1OTIA 4PKYA 3OLOA 3LIAA 4JGQA 2QKPA 4F3LB 2PD8A 5DJTA 2P7JA 1D06A 3BY9A 3UMEA 4EEUA 2EA9A 3KX0X 2PR5A 4HJ3A 5TBMA 3MQQA 1TS8A 4JGOA 3E4PA 5HSQA 2OWJA 1LSWA 1OTAA 2OWHA 3LIEA 4H6JB 4HOIA 2D02A 2H28A 4JGPA 4WLAA 5F5YA 4HNBA 5G4ZA 4WF0A 2WKPA 5AVEA 4RQ9A 4LRXC 1OJGA 5IU1A 3K3CA 4XT2B 4E04A 1LSVA 3H82B 3G6OA 4EW7A 2QJ7A 5HWWA 3VE3A 3A0SA 4HHDA 4HP4A 3VOLA 1V9YA 5A8BA 5KIZA 4WL9A 1XFQA 2V1AA 3H7WB 4LRYC 5I5LA 2QWSA 4R70A 4L9FA 3F1OB 2Z6CA 2VV7A 5DKKA 1OT9A 3UB9A 2M1CA 1XJ2A 1T1BA 5J4EA 1LSXA 4I3AA 4HP9A 3RTYA 4GS9A 1XJ3A 1GSVA 1S4RA 4L9EA 2V9AA 3CLOA 1ODVA 2V0WA 3LI8A 2KX6A 3P7NA 3PYPA 4HIAA 3IBRA 1DP8A 2VLGA 4R38A 2YKFA 4HH2A 4LLOB 1LL8A 3BY8A 1Y28A 2L0WA 3IS2A 1P97A 3SW1A 1OTEA 3IS2B 3MXQA 1JNUA 3UMDA 3ULFA 2ZOIA 4DJ2A 3E4QA 2A24A 3LIBA 2J80A 1KOUA 1S67L 1S1ZA 5F68A 3MQOA 4BBVA 2W0NA 1T19A 5HWVA 3CWFA 5HD5A 4DJ3A 4NXBA 4KUKA 1GSXA 1OT6A 1NWZA 2OOLA 2W27A 4JGRA 3UE6A 1EW0A 4B9OA 5IS1A 5DKLA 5HDDA 5F69A 2GJ3A 1MZUA 2A24B 3H7WA 2I9VA 1T18A 3FC7A 4HJ4A 5HDCA 4EEPA 4HJ6A 3NOTC 3UB6A 4LRZE 3GECA 4KQDA 4R6LA 1V9ZA 3A0RA 3D72A 3MFXA 4XT2A 3GDIA 3H9WA 3K3DA 3NHQA 1VB6A 1XJ6A 3A0VA 4HQAA 4MN6A 4EERA 1XFNA 2V0UA 3F1NB 4EESA 1N9NA 2L4RA 4GS9B 2INWA 2CMNA 4HI4A 3VE4A 5TBMB 3EWKA 4NXGA 1X0OA 1TS0A 5EFWA 3UB8A 1S66L 4NXFA 1D7EA 2VV6A 1N9LA 2VEAA 2BASA 1T1AA 1XJ4A 4I39A 2B02A 3F1PB 4I3JA 1WA9A 1OTBA 1P0ZA 4GCZA 1DP6A 1G28A 1S1YA 3RH8B 3H82A 2PDRA 1F9IA 2L1MA 2R78A 5AVFA 2VV8A 3LICA 4GHIA 3F1OA 5HWTA 4BBUA 4EETB 2HV1A 4HH3A 3LI9A 3HJKA 1T1CA 3MJQA 3PHYA 2QJ5A 4I38A 4MN5A 5J7EA 5HDSA 5F6AA 3LIDA 1UWNX 2KDKA 2PD7A 1BYWA 3UB7A 2V1BA 3LYXA 1DP9A 1DRMA 1UWPX 1LT0A 1GSWA 4EQ1A 4GHIB 2PHYA 4EXOA 3C2WA 4BBTA 1OTDA 2YKHA 4F3LA 2ZBBA 3E4OA 2PR6A 3EEHA 4I3IA 3ICYA 4H6JA 3F1NA 3FG8A 4WN5A 3HJIA 2PYPA 2JHEA 3B33A 3NOPC 4NXEA 4R3AA 4PKYG 4WUJA 5HD3A 3T50A 3MR0A 3ZQ5A 1N9OA 2K7SA 2ZOHA 5DJUA 4I5SA 4M4XA 2PYRA 2WKQA 4K08A 3C8CA 3LUQA 4HY8A 4L9GA 4LPZA 5HZHA 3NOUC 1F98A 3NJAA 2WKRA 3F1PA 2Z6DA 2QHKA 4KUOA 1TS6A 2D01A 1S4SA 3BWLA 3CAXA 4YWZA 5G4YA 5J3WA 3LIFA 2JN7A 1UGUA 1TS7A 4GW9A
chains in the Genus database with same CATH superfamily
4KG5A 5AQ7A 1FCNA 2WKIA 3GRJA 4JGQA 5DJTA 4EEUA 2EWVA 5GLCA 2ZQ8A 1G5UA 3Q7VB 5EECA 5HSQA 3KYEA 4WLAA 2ZJ9A 5TFQA 3R4KA 4X1LA 4RQ9A 3A3DA 3G6OA 4HP4A 2A49A 3SS4A 4GLQA 1XXMA 1XPBA 1KGGA 1LI0A 4ARZA 3TW8A 2Y2JA 2V9AA 3V5MA 3HBRA 2FFFB 2O99A 2AVXA 2ZC7A 2QPNA 1HZOA 1DJAA 2VX8A 2ZM8A 4NXBA 2W27A 2W1TB 1T18A 2WZZA 3BQ8A 3IWQA 1V9ZA 3UE3A 4ZBEA 1BTLA 1XJ6A 1VETB 3KYZA 4EESA 3OBFA 1ES2A 3ZDJA 4NETA 4DXBA 1OMEA 3F1PB 3VP3A 1S0WA 1H5XA 1LHYA 2PDRA 2XEPA 3B42A 3BFEA 4P6ZM 3NDGA 4DXCA 4L0LA 3FYZA 1H8ZA 3ITAA 3LCEA 4G3KA 3UPNA 4OQIA 1YM1A 4EXOA 4DE2A 3UPOA 3T1RA 3IF6B 1CJFA 1YLWA 4I3IA 4N9KA 1FSYA 3F1NA 2Z2MB 4HESA 3ZG5A 2MJ6A 2EX2A 2H0YA 4II7A 2XQZA 4EV4A 4U3TA 3NOUC 1L3LA 3NULA 1GA9A 3HLBA 3HLCA 3MSHA 3GTCA 4LCLA 4PM9A 3K3CA 4XXRA 5CGSA 2W1TA 3DWKA 1VEUA 2VGLM 4P85A 1SKOB 3SH7A 5EVLA 3IH8A 4GOGA 2PBYA 4KZ6A 4OH0A 4M3KA 1D1JA 4Q0IA 2HDQA 4BL2A 4WZ5C 4BJPA 4HBTA 5KMWA 1MWUA 2HJ9C 3E2KA 4N1XA 4OQGA 1XX2A 3LIBA 5FEFA 1DJCA 1J3WA 4P6ZS 3VOYA 3OCNA 2OAQ1 2OOLA 4QY6A 1K55A 5F69A 4EEPA 3O87A 3VFHA 4BWIA 1XA1A 5DVAA 2V8FA 3MKEA 3NHQA 3O3VA 4JF5A 3DTKA 1JVJA 2PU4A 1K57A 4OPQA 5DTKA 2BASA 1T1AA 1MPLA 3D4FA 3SS5A 4ETXA 1RGYA 3H82A 1BLPA 4DDSA 3QNBA 3IWIA 3F1OA 1H8YA 3S4XA 1UWNX 2M7VA 2HDUA 1DP9A 1DRMA 3N4IA 3E2LA 3VSKA 4ME4A 1PIOA 1G68A 4YOFA 4WN5A 3MFDA 4R3AA 2PYPA 2JHEA 4NXEA 3SW1A 5HD3A 2EXAA 3TJZC 4ZRRA 2ZOHA 2WGWA 4M4XA 3C8CA 4L9GA 2R9XA 3CUEC 4JXWA 3CJMA 3SH8A 4EBPA 4FD8A 2WADA 3LIAA 5BOHA 2WGWB 3T1SA 2BG1A 3WS5A 1AXBA 4FSFA 1CEGA 2ZMAA 5G18A 3TSGA 4HNBA 2WUQA 1XA7A 5AVEA 1VETA 4XT2B 4S2MA 4HHDA 2XROA 1FQGA 1FR1A 2EFUA 4DE1A 1O07A 4QB8A 5CECA 1NZOA 1GCEA 2Q0OA 4BL3A 5FASA 3S7PA 1S6RA 4E3KA 4KQRA 1A0KA 3OPRA 2DRWA 2Y79A 4Y15A 3CWFA 3IXHA 4KZ8A 2Y2HA 2P74A 2V2FF 4HJ6A 3AGEA 1FCMA 4C3QA 1YQSA 4KQDA 1KE4A 4PHTA 1E4DA 1SKOA 4PAUA 3N8SA 1MY8A 2ZMFA 4EUVA 5M1AA 3ZYTA 4GDBA 5M18A 1DP6A 3DTEA 4JF6A 2ZQ9A 5HPIA 1IYPA 1Z09A 2XA7S 3HLWA 4KG6A 3LI9A 4CLCD 2Y2PA 4E3LA 5HDSA 3PBOA 3QP8A 1GSWA 2W3DA 3D3OA 5FQIA 3ZFZA 4F3LA 2ZBBA 5AJGA 4P6BA 1MKMA 3A3EA 3T50A 4FOFA 3MZFA 1N9OA 2K7SA 4GD6A 4HY8A 1XP4A 3PBSA 4AFIA 2Y8HA 4YWZA 5GLBA 4PM7A 2JN7A 1NJ4A 2P7JA 4S2LA 3VP4A 1D06A 2EA9A 2W1RA 2CC1A 1AWIA 4JGPA 3PBNA 3IF6A 5FQKA 5IU1A 1PW1A 5F1GA 2EXBA 2Y2KA 1XFQA 1MWTA 1XJ2A 5HX9A 4I3AA 3OOVA 3HVFA 4LLOB 5AQ9A 1JNUA 4K91A 2A24A 2IWDA 1L0GA 1T19A 1BULA 2JBFA 3RXWA 4ID4A 3HCYA 4ARZB 3D72A 2GDNA 5DTSA 1E3UD 2VKSA 3LGOA 3DAVA 1MKIA 1OTBA 5L07A 4JPMA 2PU2A 4BBUA 5E2EA 3TE8A 4HH3A 2W3HA 2LB9A 3VSLA 3DW0A 3QP1A 3AGDA 3N7WA 3HJIA 3ZQ5A 3MBZA 2HP5A 3G30A 3B3XA 3V3RA 4X69A 3UDXA 1VM1A 3S7QA 4MMNA 2GZAA 2ZC3B 5L2FA 1IELA 4OKPA 3UE1A 4CJNA 5G4ZA 3CZDA 5GHYA 4MBFA 5HL6A 1PRQA 2Y91A 3G4PA 5FAPA 4E6XA 1EI5A 3ZVTA 2K2NA 4Y17A 1IYQA 3H7WB 4JXGA 1OT9A 2M1CA 1LL9A 4DN0A 4GJ4A 1KE3A 1BLHA 3UNWA 2ZC4B 4HEFA 1JWVA 2A2LA 3VP0A 1W8QA 3WWXA 2HZ5A 4DJ3A 3VOZA 5HDDA 3S7OA 1H0MA 4NK3A 1NYMA 5EVIC 3RFBA 4HQAA 5L09A 3CUEA 5FQ9A 1K38A 3EGXC 4GS9B 4KZBA 3IF5A 2INWA 1PYYA 2Y2OA 3BFCA 3C7UA 4JF4A 1K55C 3FV7A 1P0ZA 4OLDA 1G28A 1PNEA 5EVIB 3ZG9B 4OPYA 2WAEA 2GX5A 4GHIB 2DCFA 3C2WA 2YKHA 2HF6A 3ICYA 1HTZA 4XUXA 2WGIA 1K56A 3WS4A 2OLUA 5A90A 1F98A 4KUOA 3DWZA 3BWLA 3FPWA 1OJ5A 1SHVA 4DMZA 2X71A 4GDNA 5GHZA 4LV1A 1NLYA 2WZXA 3G34A 2OWJA 1LSWA 2OWHA 3HLDA 3EGDC 1K25A 1PWGA 2VA0A 4LRXC 5DF7A 2ACGA 2HP6A 4ETZA 2M7UA 2JKGA 3BLSA 3O88A 2BLSA 2JC7A 1TDLA 3UY6A 4R3BA 3LY3A 1GSVA 4P0MA 3T1XA 5FSRA 3HUOA 4LGWA 4MN7A 1GA0A 3LR5A 1HD8A 1IOUA 2ZL1B 1CI8A 2XGNA 4MBKA 3LEZA 4LRZE 3QP5A 3N6IA 2VK3A 4Y5FA 4MN6A 4FH4A 3OC2A 2VJWA 4Z1WA 4B4ZA 5TBMB 2ZC6B 3SH9A 3NBLA 4NEED 4G3VA 4DKIA 2VGLS 3PHYA 1GHPA 1UWPX 3MZDA 3BRMA 1E25A 3V67A 3C4PA 4H6JA 3E0YA 1NXYA 2EWWA 3MR0A 2DNSA 2I72A 4K08A 4DF6A 1YMXA 2WKRA 5FDSA 2D01A 3LR0A 3C7VA 1TS7A 3PR6A 3PBRA 1OTIA 4MCWA 3MF0A 4OONA 5CHMA 5CHJA 3T4SA 4F3LB 2HDSA 1MC0A 5U47A 2P08A 4S2KA 4EU0A 4FUWA 2B95A 1K56D 4IBXA 2WKPA 3V39A 1BUEA 5A91A 2R9WA 4WL9A 2V1AA 1ZKJA 2B5RA 2P04A 3UB9A 3LR3A 2W3GA 2G7UA 3M6HA 4PM6A 4KZ5A 1TEMA 4EETB 3UB7A 4E3JA 4F94A 3ISGA 5HW3A 3IS2B 1E3UA 3QP2A 1TDGA 5HAQA 1WE4A 1YLYA 3RJUA 1KOUA 5EOOA 1S67L 4FH2A 3MQOA 2Y55A 2P9VB 3Q81A 5CEBA 5A92A 3TRCA 3MFXA 4XT2A 3WRZA 3R7WA 3B47A 2XR0A 2WYXA 3A0VA 4GNUA 4HI4A 3BM6A 3G2ZA 3RXXA 1D7EA 2WKEA 1N9LA 3N8LA 2H5SA 3UO9A 1KVLA 2JE5A 5EM1A 2A3UA 1P9RA 4JXVA 4RYEA 5EVIA 1ZTUA 4KQQA 4GKUA 1NLZA 1BZAA 3E4OA 5CX7A 3MS6A 1IYSA 3Q82A 3NOPC 2JCHA 5E2FA 1QMFA 3EOIA 5CRFA 1YT4A 1CEFA 3QHYA 2FH5A 3P98A 3F1PA 3M6BA 4JBFA 5G4YA 4KZ7A 5F83A 4GW9A 1BLCA 1SKFA 4S2IA 2ZC5B 4Y2FA 1ONHA 2PD8A 1RCJA 2ZM2A 2ZL1A 4R0QA 4UAAA 5M19A 2V20A 1IKGA 1L0EA 3MXRA 2IWCA 5HAPA 4E04A 5FL3A 4D2OA 1LSVA 2QJ7A 1MWSA 4B88A 4GB7A 4L9FA 4JXSA 2Z2LB 4QHCA 3LY4A 1LSXA 1XJ3A 2Y2NA 1S4RA 4Y0OA 4Y13A 2WKHA 3CLOA 1ODVA 2V0WA 3P7NA 4OQHA 3T1QB 4HH2A 3GV9A 4E3NA 3DTIA 1JTGA 5FQMA 4MDZA 3E4QA 3UE0A 4CQHA 2ZQCA 4CPKA 1NRJA 4NG2A 3UB6A 3T4TA 4DE3A 1CQAA 3K3DA 3ZVWA 2BTFP 3VE4A 1TS0A 1PFLA 4OQ0A 2J7VA 2X02A 2VV6A 2XLNA 3PBTA 4U0TA 4KENB 1W8YA 3PAGA 5FEGA 1F9IA 3BYDA 4GHIA 2H10A 3E98A 3JVUA 5F6AA 3W4OA 3KSFA 4O8GA 2PHYA 2IA2A 4FTXA 1K54A 1YLJA 1N9BA 1K4FA 3PXPA 4LPZA 5IHVA 2IWBA 1VHMA 2HPBA 4X55A 3LIFA 4E3MA 4LV3A 1CF0A 1K4EA 3UMEA 3KX0X 2XSSA 5FA7A 4R3JA 2G2UA 2PAVP 1O7EA 1RP5A 2NUPC 1Y4OA 1W5DA 3F1OB 2XA7M 5DKKA 5K5BA 1F5MA 4HIAA 3UPPA 2XH9A 5L10A 4X56A 1P97A 2FZ0A 1OTEA 3MXQA 4WELA 3HLEA 3CHWP 1PWCA 5FAOA 4YFMA 3T4JA 2P9VA 2Y2LA 1YPRA 1OT6A 3KO6A 4E3OA 3G31A 1MZUA 5JYOA 4ZJ3A 1MXOA 3KYQA 4K0XA 3BFGA 4X6TA 3O86A 2XK1A 5EFWA 3OPPA 4NXFA 1ERMA 3DTMA 3JVVA 4N92A 4I39A 1G6AA 1K0KA 4IHQA 5CTNA 4I3JA 4S2PA 5FI7A 1HLUP 4IJGA 3CITA 2WAFA 1T1CA 4RVAA 1Y54A 3IT9A 4OLGA 4WZ5A 4PM5A 4OOLA 4Y7PA 4UHUA 2VGJA 4PKYG 3KSIA 2X01A 4ZDXA 1S4SA 3CAXA 3ZNYA 3M2JA 1QMEA 5HWTA 5CERA 3ZG7B 1NZUA 3W4PA 2JKTM 5HFOA 2QKPA 4QJGA 4KZ9A 5CTMA 2H28A 1W79A 4UA9A 4IUKA 1ZG6A 1BT5A 3PTEA 3MKFA 5HWWA 1ONGA 5FI2A 5A8BA 2XD5A 3ZNTA 1RGZA 1L0FA 5FI6A 2K31A 1W63Q 4NKPA 1YSQA 4HP9A 4BENA 3CG5A 4S2OA 5E43A 3BY8A 1I2WA 3CPTB 4UEYA 3UDFA 3FKVA 4MEZA 1M40A 3IXGA 5EE8A 5F68A 5HAIA 4S2JA 2B18A 3IHBA 5IS1A 3NIAA 3P01A 1NRFA 1VB6A 1YAXA 1XFNA 3U4LP 5CEDA 4DDYA 2OAP1 4MLLA 2Q9MA 3OZHA 1K6SA 1PI5A 4QY5A 2PT7A 1WA9A 1K57C 3LEQA 2ZD8A 3C38A 3HJKA 1I2SA 4IVKA 4MN5A 2PD7A 4ZJ1A 5A93A 3NCKA 1PZPA 2ZQ7A 3V50A 3ZHHA 1YLZA 1ZC2A 3VFFA 4QPRA 2WK0A 3S1YA 2VGKA 2ZQAA 3VMAA 5EOEA 1VQQA 4U0XA 3SOIA 5AQBA 4OOMA 1ESUA 1PWDA 3CMZA 4PKYA 4UA7A 4HJ3A 1ZHHB 2OSUA 3GSGA 5LBRA 4R1GA 3T4LA 2GNXA 4GN2A 3VE3A 4ESPA 3HLFA 1XKZA 2Q9NA 4WEJA 1ALQA 2Z6CA 1VEUB 5F1FA 1BLSA 4O0PA 4Q0JA 4GS9A 1KVMA 1JWPA 5KSCA 4R38A 4G3WA 2L0WA 2XF3A 4C6YA 2J80A 3A3IA 2HGVA 4EUZA 3GR2A 5HD5A 4JGRA 4IVIA 5DKLA 4B4XA 2I9VA 3EQUA 2XDMA 4D60A 3GECA 5D3OA 4BMWA 1NY0A 1CI9A 4EERA 1EWZA 3F1NB 1N9NA 5EV0A 2VEAA 2B02A 1S1YA 4MBHA 3RH8B 1STZA 2R78A 2HV1A 3IX3A 4I38A 4CLCE 2ZLYA 3IQAA 3JYIA 3P09A 3L7HA 5IT5A 3W2ZA 4Q0HA 4KZAA 2QMIA 1ESIA 5TGFA 3S7NA 2JKFA 2RL3A 4O7DA 5J3WA 1UGUA 1K54C 3FPVA 1JTDA 3FZCA 4GD8A 2V1ZA 4IBRA 1FIKA 1TS8A 3E4PA 5MC7A 1KGEA 2O9CA 2D02A 4LCMA 3OPLA 5AQAA 5F5YA 1OJGA 4ZTKA 4EW7A 4BQMA 5JYPA 5KIZA 4KG2A 2XRNA 2O0YA 1IFQA 3AGFA 4O01A 2VV7A 1J9MA 3TOIA 2VLGA 2YKFA 3ZG8B 1YMSA 1Q2PA 4PPRA 3OPHA 4BBVA 2VZWA 1FCOA 3BLMA 2ZM0A 1EW0A 1KGFA 2GJ3A 2A24B 2JKRI 2Y2MA 3WS2A 2UV0E 3LO7A 2JKRM 2KLIA 4LENA 3BFDA 1YLTA 2CMNA 4E3IA 1S66L 3TG9A 3UB5P 3G32A 2E8JA 3K2NA 2W3FA 2L1MA 5AVFA 2J3TC 1SDEA 5J7EA 4XUZA 4LFUA 1PZOA 3ZGAB 1OTDA 1F2KA 3ZCZA 1GHIA 2XFTA 2HDRA 2WGVA 2PRFA 4P87A 4KQOA 1ES3A 5HZHA 3OCLA 1IYOA 3KSGA 3HREA 2JKTI 4R23A 5C5KA 5GHXA 3OLOA 3HL9A 1JWZA 4PMAA 3MQQA 4HOIA 4BD0A 3LIEA 4R4SA 3SS3A 5FAQA 1CK3A 5HL1A 3R7WB 3A0SA 5TR7A 4N9LA 4KZ4A 3Q7ZA 5EM0A 5J4EA 4RX2A 5CHUA 3IBRA 3IS2A 4A5RA 3ULFA 1NYYA 1SDNA 2EX9A 5HWVA 2W0NA 1I5QA 3HUNA 1GSXA 3Q7VA 4HJ4A 3FWLA 3FKWA 4R6LA 3A0RA 4BD1A 3PAEA 5TJJA 3BECA 2L4RA 3WRTA 3BW6A 2J8YA 3JPUA 2EFXA 1XJ4A 3UN7A 4GCZA 2FFYA 4UQIM 2EX8A 4EQIA 2VV8A 2XFSA 4E6WA 1TD5A 1SZVA 3LYXA 4Y3IA 2NUTC 1KDSA 1L0DA 2QYBA 4CLCC 3VP1A 1YSPA 5HARA 4C75A 2V8CA 3FG8A 3QP6A 4R4RA 2Y2IA 1EROA 5DJUA 2C6WB 2PYRA 3L9KA 4X68A 3C30A 2J3WA 4CLCB 1HVBA 4WUJA 5DF8A 1ACFA 3GMWA 5L8MA 3BY9A 3BFFA 1G6OA 5TBMA 3T12B 4JGOA 1OTAA 5E2HA 1P9WA 1LL5A 5CXWA 1Q2QA 2Y2QA 1LLBA 3A3FA 2H0TA 3EQVA 3H82B 4OOYA 3VOLA 5DFXA 1XGIA 1FILA 2XD1A 4LRYC 1M6KA 3RTYA 1FR6A 1U60A 4L9EA 2G2WA 1IKIA 1DP8A 4UQIS 5EVEA 5FDHA 3D9YA 1FOFA 4EWFA 4ZAMA 5HPFA 4KUKA 3S22A 5EVID 4B93A 4B9OA 1BSGA 2Y2GA 3IX4A 5EUAA 3VP2A 3PBQA 1IEMA 1FSWA 3H9WA 4JLFA 5CGWA 1WYBA 1N4OA 5E2GA 3BJNA 4WBGA 4Z9QA 3GVBA 3IXDA 1L2SA 3IWOA 4IUHA 4WM9A 4RA7A 4WYYA 2QJ5A 1W63M 3LIDA 2KDKA 4EBLA 3T4OA 4EQ1A 4BBTA 4DE0A 1PW8A 5KSHA 4MNRA 4RX3A 1GHMA 3B33A 3HUMA 4WMCD 4UA6A 1ES5A 5CGXA 2HJEA 4OPRA 3U2AA 3W4QA 5GLAA 2J9PA 3I7JA 3NJAA 3IH9A 3C4OA 4IEDA 1WYCA 2J3TD 4KZ3A 4QU3A 1H3QA 3T4KA 3Q07A 1MBLA 5DF9A 4QD4A 4H6JB 4PM8A 3IBJA 2O9BA 1LI9A 4JKTA 2E8IA 4ZJ2A 3MZEA 3LI8A 2KX6A 3WS0A 3VV4A 5F82A 1C3BA 4YINA 4H8RA 1Y28A 3DBAA 4DJ2A 4CLCA 3KSHA 3H7WA 3FC7A 5HDCA 3ZG0A 3NOTC 1W7FA 5KZHA 3MQ0A 4LV2A 2V0UA 2EX6A 1YKDA 4NXGA 3UB8A 2J9OA 3NY4A 5GLDA 3EEAA 2KOIA 3NI9A 4X25A 4WMCA 1MWRA 2W3EA 3WS1A 4FCFA 3NDEA 3UDIA 3LR4A 3MMHA 2PBDP 5FATA 1OPXA 3M2KA 2PR6A 2Y4AA 5FQJA 4EBNA 1Z6FA 3QNCA 2OLVA 4HBUA 2WKQA 3N8RA 3C5AA 2Z6DA 2UWXA 1TS6A 2DMWA 1ES4A 3O5YA 4K0WA 4LV0A 2Y59A 4N1HA 2OV5A 1TVFA 3BQAA 3Q1FA 1ERQA 1TF1A 2PR5A 4OPZA 3A3JA 1ZG4A 3ITBA 2HP9A 3NECA 1PI4A 3G2YA 4WF0A 5FQQA 4WEKA 2ZQDA 3W8KA 1V9YA 5I5LA 2QWSA 4R70A 4WZ4A 1T1BA 4DRTA 3IX8A 2LB5A 3GQZA 3BEBA 3PYPA 3CPTA 5DTTA 1K6RA 1LL8A 1SCWA 2ZMVA 3LFVA 3UMDA 5EPHA 2ZOIA 3IF6C 4Q8IA 3QP4A 1S1ZA 5I94A 3V3SA 1XGJA 3UE6A 5J8XA 4S2NA 4Y0TA 3GDIA 3SZTA 5GL9A 4Y0UA 1KDWA 2O9AA 5DFYA 3EWKA 1X0OA 3T4QA 4OVDA 2C5WB 1KE0A 3IXBA 3MXSA 3LICA 3MJQA 1YLPA 2RCXA 4S2NC 4X53A 3IHAA 4X1MA 1BYWA 2V1BA 1LT0A 2QZ6A 3G35A 3EEHA 4OP8A 1DY6A 1H8MA 3CI6A 4BLMA 4I5SA 3LUQA 3HLGA 4GZBA 1DJBA 2QHKA 4OP5A 3NC8A 4QWOA 1NWZA 4YNRA
chains in the Genus database with same CATH topology
3S7QA 4MMNA 2GZAA 3OLOA 4JGQA 5DJTA 4EEUA 3UMEA 2EWVA 3KX0X 2XSSA 3MQQA 5HSQA 4HOIA 3LIEA 4WLAA 5G4ZA 3R4KA 4RQ9A 5HL6A 3R7WB 3G6OA 3A0SA 4HP4A 2NUPC 4GLQA 2K2NA 3H7WB 3F1OB 2XA7M 5DKKA 1OT9A 5J4EA 2M1CA 4ARZA 3TW8A 4DN0A 4GJ4A 1F5MA 5K5BA 2V9AA 4HIAA 3IBRA 3IS2A 1P97A 2FZ0A 1OTEA 3MXQA 4WELA 2A2LA 3ULFA 2O99A 3T4JA 2VX8A 2W0NA 5HWVA 4DJ3A 4NXBA 1GSXA 1OT6A 3KO6A 2W27A 2W1TB 5HDDA 1MZUA 1T18A 4HJ4A 3S7OA 4R6LA 3BQ8A 1V9ZA 3A0RA 3UE3A 3RFBA 1XJ6A 3KYQA 5TJJA 4HQAA 3KYZA 3CUEA 4EESA 3EGXC 2L4RA 4GS9B 2INWA 3OBFA 3BW6A 5EFWA 4NXFA 3JVVA 1XJ4A 4I39A 4IHQA 3F1PB 4I3JA 1P0ZA 4GCZA 4UQIM 1G28A 2PDRA 2VV8A 4IJGA 3B42A 3CITA 1T1CA 4P6ZM 1TD5A 4L0LA 3LYXA 4Y3IA 2NUTC 4G3KA 2QYBA 2GX5A 4CLCC 4GHIB 4OOLA 4EXOA 3C2WA 1YSPA 2YKHA 4I3IA 2HF6A 3ICYA 3F1NA 3FG8A 4PKYG 2MJ6A 3KSIA 4II7A 5DJUA 2PYRA 3NOUC 1F98A 3C30A 4KUOA 2J3WA 1S4SA 3BWLA 3CAXA 3FPWA 4CLCB 5HWTA 4WUJA 1OJ5A 4DMZA 2JKTM 2QKPA 5L8MA 3BY9A 1NLYA 1G6OA 5TBMA 4JGOA 2OWJA 1LSWA 1OTAA 2OWHA 2H28A 1P9WA 3EGDC 4IUKA 2VA0A 4LRXC 3K3CA 2W1TA 2VGLM 3EQVA 3H82B 5HWWA 4ETZA 2M7UA 3VOLA 5A8BA 5DFXA 4LRYC 2K31A 1W63Q 4NKPA 1YSQA 4HP9A 3RTYA 1GSVA 4L9EA 4Q0IA 1DP8A 4UQIS 4BJPA 3BY8A 2HJ9C 4MN7A 4UEYA 3LIBA 4P6ZS 5F68A 3OCNA 5HPFA 3LR5A 2B18A 4KUKA 4B93A 2OAQ1 2OOLA 1IOUA 4B9OA 5IS1A 3P01A 5F69A 4EEPA 4BWIA 3PBQA 4LRZE 3H9WA 3NHQA 1VB6A 1YAXA 4Y5FA 4MN6A 1XFNA 3OC2A 2VJWA 4Z1WA 2OAP1 5TBMB 3BJNA 2BASA 1T1AA 2PT7A 1WA9A 4NEED 4ETXA 4G3VA 4IUHA 3H82A 2VGLS 3C38A 3F1OA 3HJKA 3PHYA 2QJ5A 4MN5A 1W63M 3LIDA 1UWNX 2KDKA 2PD7A 2M7VA 3T4OA 1DP9A 1DRMA 1UWPX 4ME4A 4EQ1A 4BBTA 3V67A 4QPRA 5KSHA 4H6JA 4YOFA 3E0YA 4WN5A 4R3AA 2PYPA 2JHEA 3B33A 4NXEA 2EWWA 5HD3A 3SW1A 3MR0A 3TJZC 4ZRRA 2ZOHA 2HJEA 4M4XA 4K08A 3C8CA 4L9GA 3U2AA 3CUEC 3NJAA 2WKRA 2D01A 3LR0A 4OOMA 2J3TD 1TS7A 3PR6A 3PBRA 1OTIA 4MCWA 4PKYA 1H3QA 3MF0A 3T4KA 3LIAA 3T4SA 4F3LB 1MC0A 4FSFA 4HJ3A 1ZHHB 5DF9A 2P08A 4H6JB 4EU0A 5LBRA 4HNBA 3T4LA 2GNXA 2WKPA 5AVEA 4XT2B 3IBJA 3VE3A 4HHDA 2XROA 2O9BA 4WL9A 2V1AA 4WEJA 2P04A 2Z6CA 3UB9A 3LR3A 4O0PA 2W3GA 4Q0JA 4GS9A 2G7UA 4EETB 3LI8A 4R38A 2KX6A 3S7PA 3UB7A 3VV4A 4G3WA 1Y28A 2L0WA 3IS2B 3DBAA 4DJ2A 2J80A 1KOUA 1S67L 2HGVA 2Y79A 3MQOA 3CWFA 5HD5A 4CLCA 4JGRA 5DKLA 3KSHA 3H7WA 2I9VA 3EQUA 3FC7A 5HDCA 4HJ6A 3NOTC 3GECA 4KQDA 3TRCA 3MFXA 4XT2A 4PHTA 3R7WA 3MQ0A 3B47A 4BMWA 3A0VA 4EERA 2V0UA 3F1NB 4PAUA 1N9NA 2ZMFA 1YKDA 4HI4A 4NXGA 3UB8A 4EUVA 3ZYTA 1D7EA 1N9LA 2VEAA 2B02A 1DP6A 1S1YA 3RH8B 3EEAA 1STZA 2R78A 2KOIA 1P9RA 5HPIA 4CLCD 2XA7S 2HV1A 3LI9A 2W3EA 4I38A 1ZTUA 5HDSA 4CLCE 1NLZA 3LR4A 3MMHA 3PBOA 1GSWA 2W3DA 3D3OA 4F3LA 5IT5A 1OPXA 2ZBBA 3E4OA 2PR6A 5CX7A 3W2ZA 5AJGA 3NOPC 4Q0HA 1MKMA 3T50A 4FOFA 3EOIA 1N9OA 2K7SA 2WKQA 4HY8A 2FH5A 3S7NA 3PBSA 3F1PA 2Z6DA 4AFIA 1TS6A 2Y8HA 4YWZA 2DMWA 5G4YA 3O5YA 5J3WA 2JN7A 2P7JA 1UGUA 4GW9A 3FPVA 4Y2FA 2PD8A 1D06A 3BQAA 2EA9A 1TF1A 2PR5A 2W1RA 1TS8A 3E4PA 5MC7A 2O9CA 2D02A 4JGPA 3PBNA 5F5YA 4WF0A 5IU1A 1OJGA 4E04A 4WEKA 5FL3A 1LSVA 4EW7A 2QJ7A 5KIZA 1V9YA 2XRNA 2O0YA 1XFQA 1IFQA 5I5LA 2QWSA 4R70A 4L9FA 4O01A 2VV7A 1XJ2A 1T1BA 1LSXA 4I3AA 2LB5A 1XJ3A 1S4RA 3OOVA 3CLOA 3P7NA 1ODVA 2V0WA 3PYPA 2VLGA 2YKFA 4HH2A 4LLOB 1LL8A 3LFVA 2ZMVA 1JNUA 3UMDA 4MDZA 2ZOIA 3E4QA 2A24A 4CQHA 1S1ZA 4BBVA 2VZWA 1T19A 3UE6A 1EW0A 1NRJA 2GJ3A 2A24B 3HCYA 2JKRI 3UB6A 3T4TA 4ARZB 3D72A 3GDIA 3K3DA 2JKRM 2KLIA 2O9AA 2CMNA 3VE4A 5DFYA 3EWKA 1X0OA 1TS0A 2VKSA 3T4QA 1S66L 2VV6A 3PBTA 1OTBA 3K2NA 2W3FA 1F9IA 2L1MA 5AVFA 2J3TC 3LICA 4GHIA 4BBUA 3TE8A 4HH3A 3MJQA 3E98A 5J7EA 3JVUA 2W3HA 5F6AA 1BYWA 2V1BA 2LB9A 1LT0A 3KSFA 4O8GA 2PHYA 1OTDA 3EEHA 2IA2A 3HJIA 1H8MA 3CI6A 3ZQ5A 4I5SA 3LUQA 3PXPA 4KQOA 4LPZA 5HZHA 3OCLA 2QHKA 3KSGA 1VHMA 2JKTI 5C5KA 3LIFA 1NWZA 4YNRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OJ5 A;  1OTI A;  4PKY A;  3OLO A;  3LIA A;  4JGQ A;  2QKP A;  4F3L B;  2PD8 A;  5DJT A;  2P7J A;  1D06 A;  3BY9 A;  3UME A;  4EEU A;  2EA9 A;  3KX0 X;  2PR5 A;  4HJ3 A;  5TBM A;  3MQQ A;  1TS8 A;  4JGO A;  3E4P A;  5HSQ A;  2OWJ A;  1LSW A;  1OTA A;  2OWH A;  3LIE A;  4H6J B;  4HOI A;  2D02 A;  2H28 A;  4JGP A;  4WLA A;  5F5Y A;  4HNB A;  5G4Z A;  4WF0 A;  2WKP A;  5AVE A;  4RQ9 A;  4LRX C;  1OJG A;  5IU1 A;  3K3C A;  4XT2 B;  4E04 A;  1LSV A;  3H82 B;  3G6O A;  4EW7 A;  2QJ7 A;  5HWW A;  3VE3 A;  3A0S A;  4HHD A;  4HP4 A;  3VOL A;  1V9Y A;  5A8B A;  5KIZ A;  4WL9 A;  1XFQ A;  2V1A A;  3H7W B;  4LRY C;  5I5L A;  2QWS A;  4R70 A;  4L9F A;  3F1O B;  2Z6C A;  2VV7 A;  5DKK A;  1OT9 A;  3UB9 A;  2M1C A;  1XJ2 A;  1T1B A;  5J4E A;  1LSX A;  4I3A A;  4HP9 A;  3RTY A;  4GS9 A;  1XJ3 A;  1GSV A;  1S4R A;  4L9E A;  2V9A A;  3CLO A;  1ODV A;  2V0W A;  3LI8 A;  2KX6 A;  3P7N A;  3PYP A;  4HIA A;  3IBR A;  1DP8 A;  2VLG A;  4R38 A;  2YKF A;  4HH2 A;  4LLO B;  1LL8 A;  3BY8 A;  1Y28 A;  2L0W A;  3IS2 A;  1P97 A;  3SW1 A;  1OTE A;  3IS2 B;  3MXQ A;  1JNU A;  3UMD A;  3ULF A;  2ZOI A;  4DJ2 A;  3E4Q A;  2A24 A;  3LIB A;  2J80 A;  1KOU A;  1S67 L;  1S1Z A;  5F68 A;  3MQO A;  4BBV A;  2W0N A;  1T19 A;  5HWV A;  3CWF A;  5HD5 A;  4DJ3 A;  4NXB A;  4KUK A;  1GSX A;  1OT6 A;  1NWZ A;  2OOL A;  2W27 A;  4JGR A;  3UE6 A;  1EW0 A;  4B9O A;  5IS1 A;  5DKL A;  5HDD A;  5F69 A;  2GJ3 A;  1MZU A;  2A24 B;  3H7W A;  2I9V A;  1T18 A;  3FC7 A;  4HJ4 A;  5HDC A;  4EEP A;  4HJ6 A;  3NOT C;  3UB6 A;  4LRZ E;  3GEC A;  4KQD A;  4R6L A;  1V9Z A;  3A0R A;  3D72 A;  3MFX A;  4XT2 A;  3GDI A;  3H9W A;  3K3D A;  3NHQ A;  1VB6 A;  1XJ6 A;  3A0V A;  4HQA A;  4MN6 A;  4EER A;  1XFN A;  2V0U A;  3F1N B;  4EES A;  1N9N A;  2L4R A;  4GS9 B;  2INW A;  2CMN A;  4HI4 A;  3VE4 A;  5TBM B;  3EWK A;  4NXG A;  1X0O A;  1TS0 A;  5EFW A;  3UB8 A;  1S66 L;  4NXF A;  1D7E A;  2VV6 A;  1N9L A;  2VEA A;  2BAS A;  1T1A A;  1XJ4 A;  4I39 A;  2B02 A;  3F1P B;  4I3J A;  1WA9 A;  1OTB A;  1P0Z A;  4GCZ A;  1DP6 A;  1G28 A;  1S1Y A;  3RH8 B;  3H82 A;  2PDR A;  1F9I A;  2L1M A;  2R78 A;  5AVF A;  2VV8 A;  3LIC A;  4GHI A;  3F1O A;  5HWT A;  4BBU A;  4EET B;  2HV1 A;  4HH3 A;  3LI9 A;  3HJK A;  1T1C A;  3MJQ A;  3PHY A;  2QJ5 A;  4I38 A;  4MN5 A;  5J7E A;  5HDS A;  5F6A A;  3LID A;  1UWN X;  2KDK A;  2PD7 A;  1BYW A;  3UB7 A;  2V1B A;  3LYX A;  1DP9 A;  1DRM A;  1UWP X;  1LT0 A;  1GSW A;  4EQ1 A;  4GHI B;  2PHY A;  4EXO A;  3C2W A;  4BBT A;  1OTD A;  2YKH A;  4F3L A;  2ZBB A;  3E4O A;  2PR6 A;  3EEH A;  4I3I A;  3ICY A;  4H6J A;  3F1N A;  3FG8 A;  4WN5 A;  3HJI A;  2PYP A;  2JHE A;  3B33 A;  3NOP C;  4NXE A;  4R3A A;  4PKY G;  4WUJ A;  5HD3 A;  3T50 A;  3MR0 A;  3ZQ5 A;  1N9O A;  2K7S A;  2ZOH A;  5DJU A;  4I5S A;  4M4X A;  2PYR A;  2WKQ A;  4K08 A;  3C8C A;  3LUQ A;  4HY8 A;  4L9G A;  4LPZ A;  5HZH A;  3NOU C;  1F98 A;  3NJA A;  2WKR A;  3F1P A;  2Z6D A;  2QHK A;  4KUO A;  1TS6 A;  2D01 A;  1S4S A;  3BWL A;  3CAX A;  4YWZ A;  5G4Y A;  5J3W A;  3LIF A;  2JN7 A;  1UGU A;  1TS7 A;  4GW9 A; 
#chains in the Genus database with same CATH topology
 4KG5 A;  5AQ7 A;  1FCN A;  2WKI A;  3GRJ A;  4JGQ A;  5DJT A;  4EEU A;  2EWV A;  5GLC A;  2ZQ8 A;  1G5U A;  3Q7V B;  5EEC A;  5HSQ A;  3KYE A;  4WLA A;  2ZJ9 A;  5TFQ A;  3R4K A;  4X1L A;  4RQ9 A;  3A3D A;  3G6O A;  4HP4 A;  2A49 A;  3SS4 A;  4GLQ A;  1XXM A;  1XPB A;  1KGG A;  1LI0 A;  4ARZ A;  3TW8 A;  2Y2J A;  2V9A A;  3V5M A;  3HBR A;  2FFF B;  2O99 A;  2AVX A;  2ZC7 A;  2QPN A;  1HZO A;  1DJA A;  2VX8 A;  2ZM8 A;  4NXB A;  2W27 A;  2W1T B;  1T18 A;  2WZZ A;  3BQ8 A;  3IWQ A;  1V9Z A;  3UE3 A;  4ZBE A;  1BTL A;  1XJ6 A;  1VET B;  3KYZ A;  4EES A;  3OBF A;  1ES2 A;  3ZDJ A;  4NET A;  4DXB A;  1OME A;  3F1P B;  3VP3 A;  1S0W A;  1H5X A;  1LHY A;  2PDR A;  2XEP A;  3B42 A;  3BFE A;  4P6Z M;  3NDG A;  4DXC A;  4L0L A;  3FYZ A;  1H8Z A;  3ITA A;  3LCE A;  4G3K A;  3UPN A;  4OQI A;  1YM1 A;  4EXO A;  4DE2 A;  3UPO A;  3T1R A;  3IF6 B;  1CJF A;  1YLW A;  4I3I A;  4N9K A;  1FSY A;  3F1N A;  2Z2M B;  4HES A;  3ZG5 A;  2MJ6 A;  2EX2 A;  2H0Y A;  4II7 A;  2XQZ A;  4EV4 A;  4U3T A;  3NOU C;  1L3L A;  3NUL A;  1GA9 A;  3HLB A;  3HLC A;  3MSH A;  3GTC A;  4LCL A;  4PM9 A;  3K3C A;  4XXR A;  5CGS A;  2W1T A;  3DWK A;  1VEU A;  2VGL M;  4P85 A;  1SKO B;  3SH7 A;  5EVL A;  3IH8 A;  4GOG A;  2PBY A;  4KZ6 A;  4OH0 A;  4M3K A;  1D1J A;  4Q0I A;  2HDQ A;  4BL2 A;  4WZ5 C;  4BJP A;  4HBT A;  5KMW A;  1MWU A;  2HJ9 C;  3E2K A;  4N1X A;  4OQG A;  1XX2 A;  3LIB A;  5FEF A;  1DJC A;  1J3W A;  4P6Z S;  3VOY A;  3OCN A;  2OAQ 1;  2OOL A;  4QY6 A;  1K55 A;  5F69 A;  4EEP A;  3O87 A;  3VFH A;  4BWI A;  1XA1 A;  5DVA A;  2V8F A;  3MKE A;  3NHQ A;  3O3V A;  4JF5 A;  3DTK A;  1JVJ A;  2PU4 A;  1K57 A;  4OPQ A;  5DTK A;  2BAS A;  1T1A A;  1MPL A;  3D4F A;  3SS5 A;  4ETX A;  1RGY A;  3H82 A;  1BLP A;  4DDS A;  3QNB A;  3IWI A;  3F1O A;  1H8Y A;  3S4X A;  1UWN X;  2M7V A;  2HDU A;  1DP9 A;  1DRM A;  3N4I A;  3E2L A;  3VSK A;  4ME4 A;  1PIO A;  1G68 A;  4YOF A;  4WN5 A;  3MFD A;  4R3A A;  2PYP A;  2JHE A;  4NXE A;  3SW1 A;  5HD3 A;  2EXA A;  3TJZ C;  4ZRR A;  2ZOH A;  2WGW A;  4M4X A;  3C8C A;  4L9G A;  2R9X A;  3CUE C;  4JXW A;  3CJM A;  3SH8 A;  4EBP A;  4FD8 A;  2WAD A;  3LIA A;  5BOH A;  2WGW B;  3T1S A;  2BG1 A;  3WS5 A;  1AXB A;  4FSF A;  1CEG A;  2ZMA A;  5G18 A;  3TSG A;  4HNB A;  2WUQ A;  1XA7 A;  5AVE A;  1VET A;  4XT2 B;  4S2M A;  4HHD A;  2XRO A;  1FQG A;  1FR1 A;  2EFU A;  4DE1 A;  1O07 A;  4QB8 A;  5CEC A;  1NZO A;  1GCE A;  2Q0O A;  4BL3 A;  5FAS A;  3S7P A;  1S6R A;  4E3K A;  4KQR A;  1A0K A;  3OPR A;  2DRW A;  2Y79 A;  4Y15 A;  3CWF A;  3IXH A;  4KZ8 A;  2Y2H A;  2P74 A;  2V2F F;  4HJ6 A;  3AGE A;  1FCM A;  4C3Q A;  1YQS A;  4KQD A;  1KE4 A;  4PHT A;  1E4D A;  1SKO A;  4PAU A;  3N8S A;  1MY8 A;  2ZMF A;  4EUV A;  5M1A A;  3ZYT A;  4GDB A;  5M18 A;  1DP6 A;  3DTE A;  4JF6 A;  2ZQ9 A;  5HPI A;  1IYP A;  1Z09 A;  2XA7 S;  3HLW A;  4KG6 A;  3LI9 A;  4CLC D;  2Y2P A;  4E3L A;  5HDS A;  3PBO A;  3QP8 A;  1GSW A;  2W3D A;  3D3O A;  5FQI A;  3ZFZ A;  4F3L A;  2ZBB A;  5AJG A;  4P6B A;  1MKM A;  3A3E A;  3T50 A;  4FOF A;  3MZF A;  1N9O A;  2K7S A;  4GD6 A;  4HY8 A;  1XP4 A;  3PBS A;  4AFI A;  2Y8H A;  4YWZ A;  5GLB A;  4PM7 A;  2JN7 A;  1NJ4 A;  2P7J A;  4S2L A;  3VP4 A;  1D06 A;  2EA9 A;  2W1R A;  2CC1 A;  1AWI A;  4JGP A;  3PBN A;  3IF6 A;  5FQK A;  5IU1 A;  1PW1 A;  5F1G A;  2EXB A;  2Y2K A;  1XFQ A;  1MWT A;  1XJ2 A;  5HX9 A;  4I3A A;  3OOV A;  3HVF A;  4LLO B;  5AQ9 A;  1JNU A;  4K91 A;  2A24 A;  2IWD A;  1L0G A;  1T19 A;  1BUL A;  2JBF A;  3RXW A;  4ID4 A;  3HCY A;  4ARZ B;  3D72 A;  2GDN A;  5DTS A;  1E3U D;  2VKS A;  3LGO A;  3DAV A;  1MKI A;  1OTB A;  5L07 A;  4JPM A;  2PU2 A;  4BBU A;  5E2E A;  3TE8 A;  4HH3 A;  2W3H A;  2LB9 A;  3VSL A;  3DW0 A;  3QP1 A;  3AGD A;  3N7W A;  3HJI A;  3ZQ5 A;  3MBZ A;  2HP5 A;  3G30 A;  3B3X A;  3V3R A;  4X69 A;  3UDX A;  1VM1 A;  3S7Q A;  4MMN A;  2GZA A;  2ZC3 B;  5L2F A;  1IEL A;  4OKP A;  3UE1 A;  4CJN A;  5G4Z A;  3CZD A;  5GHY A;  4MBF A;  5HL6 A;  1PRQ A;  2Y91 A;  3G4P A;  5FAP A;  4E6X A;  1EI5 A;  3ZVT A;  2K2N A;  4Y17 A;  1IYQ A;  3H7W B;  4JXG A;  1OT9 A;  2M1C A;  1LL9 A;  4DN0 A;  4GJ4 A;  1KE3 A;  1BLH A;  3UNW A;  2ZC4 B;  4HEF A;  1JWV A;  2A2L A;  3VP0 A;  1W8Q A;  3WWX A;  2HZ5 A;  4DJ3 A;  3VOZ A;  5HDD A;  3S7O A;  1H0M A;  4NK3 A;  1NYM A;  5EVI C;  3RFB A;  4HQA A;  5L09 A;  3CUE A;  5FQ9 A;  1K38 A;  3EGX C;  4GS9 B;  4KZB A;  3IF5 A;  2INW A;  1PYY A;  2Y2O A;  3BFC A;  3C7U A;  4JF4 A;  1K55 C;  3FV7 A;  1P0Z A;  4OLD A;  1G28 A;  1PNE A;  5EVI B;  3ZG9 B;  4OPY A;  2WAE A;  2GX5 A;  4GHI B;  2DCF A;  3C2W A;  2YKH A;  2HF6 A;  3ICY A;  1HTZ A;  4XUX A;  2WGI A;  1K56 A;  3WS4 A;  2OLU A;  5A90 A;  1F98 A;  4KUO A;  3DWZ A;  3BWL A;  3FPW A;  1OJ5 A;  1SHV A;  4DMZ A;  2X71 A;  4GDN A;  5GHZ A;  4LV1 A;  1NLY A;  2WZX A;  3G34 A;  2OWJ A;  1LSW A;  2OWH A;  3HLD A;  3EGD C;  1K25 A;  1PWG A;  2VA0 A;  4LRX C;  5DF7 A;  2ACG A;  2HP6 A;  4ETZ A;  2M7U A;  2JKG A;  3BLS A;  3O88 A;  2BLS A;  2JC7 A;  1TDL A;  3UY6 A;  4R3B A;  3LY3 A;  1GSV A;  4P0M A;  3T1X A;  5FSR A;  3HUO A;  4LGW A;  4MN7 A;  1GA0 A;  3LR5 A;  1HD8 A;  1IOU A;  2ZL1 B;  1CI8 A;  2XGN A;  4MBK A;  3LEZ A;  4LRZ E;  3QP5 A;  3N6I A;  2VK3 A;  4Y5F A;  4MN6 A;  4FH4 A;  3OC2 A;  2VJW A;  4Z1W A;  4B4Z A;  5TBM B;  2ZC6 B;  3SH9 A;  3NBL A;  4NEE D;  4G3V A;  4DKI A;  2VGL S;  3PHY A;  1GHP A;  1UWP X;  3MZD A;  3BRM A;  1E25 A;  3V67 A;  3C4P A;  4H6J A;  3E0Y A;  1NXY A;  2EWW A;  3MR0 A;  2DNS A;  2I72 A;  4K08 A;  4DF6 A;  1YMX A;  2WKR A;  5FDS A;  2D01 A;  3LR0 A;  3C7V A;  1TS7 A;  3PR6 A;  3PBR A;  1OTI A;  4MCW A;  3MF0 A;  4OON A;  5CHM A;  5CHJ A;  3T4S A;  4F3L B;  2HDS A;  1MC0 A;  5U47 A;  2P08 A;  4S2K A;  4EU0 A;  4FUW A;  2B95 A;  1K56 D;  4IBX A;  2WKP A;  3V39 A;  1BUE A;  5A91 A;  2R9W A;  4WL9 A;  2V1A A;  1ZKJ A;  2B5R A;  2P04 A;  3UB9 A;  3LR3 A;  2W3G A;  2G7U A;  3M6H A;  4PM6 A;  4KZ5 A;  1TEM A;  4EET B;  3UB7 A;  4E3J A;  4F94 A;  3ISG A;  5HW3 A;  3IS2 B;  1E3U A;  3QP2 A;  1TDG A;  5HAQ A;  1WE4 A;  1YLY A;  3RJU A;  1KOU A;  5EOO A;  1S67 L;  4FH2 A;  3MQO A;  2Y55 A;  2P9V B;  3Q81 A;  5CEB A;  5A92 A;  3TRC A;  3MFX A;  4XT2 A;  3WRZ A;  3R7W A;  3B47 A;  2XR0 A;  2WYX A;  3A0V A;  4GNU A;  4HI4 A;  3BM6 A;  3G2Z A;  3RXX A;  1D7E A;  2WKE A;  1N9L A;  3N8L A;  2H5S A;  3UO9 A;  1KVL A;  2JE5 A;  5EM1 A;  2A3U A;  1P9R A;  4JXV A;  4RYE A;  5EVI A;  1ZTU A;  4KQQ A;  4GKU A;  1NLZ A;  1BZA A;  3E4O A;  5CX7 A;  3MS6 A;  1IYS A;  3Q82 A;  3NOP C;  2JCH A;  5E2F A;  1QMF A;  3EOI A;  5CRF A;  1YT4 A;  1CEF A;  3QHY A;  2FH5 A;  3P98 A;  3F1P A;  3M6B A;  4JBF A;  5G4Y A;  4KZ7 A;  5F83 A;  4GW9 A;  1BLC A;  1SKF A;  4S2I A;  2ZC5 B;  4Y2F A;  1ONH A;  2PD8 A;  1RCJ A;  2ZM2 A;  2ZL1 A;  4R0Q A;  4UAA A;  5M19 A;  2V20 A;  1IKG A;  1L0E A;  3MXR A;  2IWC A;  5HAP A;  4E04 A;  5FL3 A;  4D2O A;  1LSV A;  2QJ7 A;  1MWS A;  4B88 A;  4GB7 A;  4L9F A;  4JXS A;  2Z2L B;  4QHC A;  3LY4 A;  1LSX A;  1XJ3 A;  2Y2N A;  1S4R A;  4Y0O A;  4Y13 A;  2WKH A;  3CLO A;  1ODV A;  2V0W A;  3P7N A;  4OQH A;  3T1Q B;  4HH2 A;  3GV9 A;  4E3N A;  3DTI A;  1JTG A;  5FQM A;  4MDZ A;  3E4Q A;  3UE0 A;  4CQH A;  2ZQC A;  4CPK A;  1NRJ A;  4NG2 A;  3UB6 A;  3T4T A;  4DE3 A;  1CQA A;  3K3D A;  3ZVW A;  2BTF P;  3VE4 A;  1TS0 A;  1PFL A;  4OQ0 A;  2J7V A;  2X02 A;  2VV6 A;  2XLN A;  3PBT A;  4U0T A;  4KEN B;  1W8Y A;  3PAG A;  5FEG A;  1F9I A;  3BYD A;  4GHI A;  2H10 A;  3E98 A;  3JVU A;  5F6A A;  3W4O A;  3KSF A;  4O8G A;  2PHY A;  2IA2 A;  4FTX A;  1K54 A;  1YLJ A;  1N9B A;  1K4F A;  3PXP A;  4LPZ A;  5IHV A;  2IWB A;  1VHM A;  2HPB A;  4X55 A;  3LIF A;  4E3M A;  4LV3 A;  1CF0 A;  1K4E A;  3UME A;  3KX0 X;  2XSS A;  5FA7 A;  4R3J A;  2G2U A;  2PAV P;  1O7E A;  1RP5 A;  2NUP C;  1Y4O A;  1W5D A;  3F1O B;  2XA7 M;  5DKK A;  5K5B A;  1F5M A;  4HIA A;  3UPP A;  2XH9 A;  5L10 A;  4X56 A;  1P97 A;  2FZ0 A;  1OTE A;  3MXQ A;  4WEL A;  3HLE A;  3CHW P;  1PWC A;  5FAO A;  4YFM A;  3T4J A;  2P9V A;  2Y2L A;  1YPR A;  1OT6 A;  3KO6 A;  4E3O A;  3G31 A;  1MZU A;  5JYO A;  4ZJ3 A;  1MXO A;  3KYQ A;  4K0X A;  3BFG A;  4X6T A;  3O86 A;  2XK1 A;  5EFW A;  3OPP A;  4NXF A;  1ERM A;  3DTM A;  3JVV A;  4N92 A;  4I39 A;  1G6A A;  1K0K A;  4IHQ A;  5CTN A;  4I3J A;  4S2P A;  5FI7 A;  1HLU P;  4IJG A;  3CIT A;  2WAF A;  1T1C A;  4RVA A;  1Y54 A;  3IT9 A;  4OLG A;  4WZ5 A;  4PM5 A;  4OOL A;  4Y7P A;  4UHU A;  2VGJ A;  4PKY G;  3KSI A;  2X01 A;  4ZDX A;  1S4S A;  3CAX A;  3ZNY A;  3M2J A;  1QME A;  5HWT A;  5CER A;  3ZG7 B;  1NZU A;  3W4P A;  2JKT M;  5HFO A;  2QKP A;  4QJG A;  4KZ9 A;  5CTM A;  2H28 A;  1W79 A;  4UA9 A;  4IUK A;  1ZG6 A;  1BT5 A;  3PTE A;  3MKF A;  5HWW A;  1ONG A;  5FI2 A;  5A8B A;  2XD5 A;  3ZNT A;  1RGZ A;  1L0F A;  5FI6 A;  2K31 A;  1W63 Q;  4NKP A;  1YSQ A;  4HP9 A;  4BEN A;  3CG5 A;  4S2O A;  5E43 A;  3BY8 A;  1I2W A;  3CPT B;  4UEY A;  3UDF A;  3FKV A;  4MEZ A;  1M40 A;  3IXG A;  5EE8 A;  5F68 A;  5HAI A;  4S2J A;  2B18 A;  3IHB A;  5IS1 A;  3NIA A;  3P01 A;  1NRF A;  1VB6 A;  1YAX A;  1XFN A;  3U4L P;  5CED A;  4DDY A;  2OAP 1;  4MLL A;  2Q9M A;  3OZH A;  1K6S A;  1PI5 A;  4QY5 A;  2PT7 A;  1WA9 A;  1K57 C;  3LEQ A;  2ZD8 A;  3C38 A;  3HJK A;  1I2S A;  4IVK A;  4MN5 A;  2PD7 A;  4ZJ1 A;  5A93 A;  3NCK A;  1PZP A;  2ZQ7 A;  3V50 A;  3ZHH A;  1YLZ A;  1ZC2 A;  3VFF A;  4QPR A;  2WK0 A;  3S1Y A;  2VGK A;  2ZQA A;  3VMA A;  5EOE A;  1VQQ A;  4U0X A;  3SOI A;  5AQB A;  4OOM A;  1ESU A;  1PWD A;  3CMZ A;  4PKY A;  4UA7 A;  4HJ3 A;  1ZHH B;  2OSU A;  3GSG A;  5LBR A;  4R1G A;  3T4L A;  2GNX A;  4GN2 A;  3VE3 A;  4ESP A;  3HLF A;  1XKZ A;  2Q9N A;  4WEJ A;  1ALQ A;  2Z6C A;  1VEU B;  5F1F A;  1BLS A;  4O0P A;  4Q0J A;  4GS9 A;  1KVM A;  1JWP A;  5KSC A;  4R38 A;  4G3W A;  2L0W A;  2XF3 A;  4C6Y A;  2J80 A;  3A3I A;  2HGV A;  4EUZ A;  3GR2 A;  5HD5 A;  4JGR A;  4IVI A;  5DKL A;  4B4X A;  2I9V A;  3EQU A;  2XDM A;  4D60 A;  3GEC A;  5D3O A;  4BMW A;  1NY0 A;  1CI9 A;  4EER A;  1EWZ A;  3F1N B;  1N9N A;  5EV0 A;  2VEA A;  2B02 A;  1S1Y A;  4MBH A;  3RH8 B;  1STZ A;  2R78 A;  2HV1 A;  3IX3 A;  4I38 A;  4CLC E;  2ZLY A;  3IQA A;  3JYI A;  3P09 A;  3L7H A;  5IT5 A;  3W2Z A;  4Q0H A;  4KZA A;  2QMI A;  1ESI A;  5TGF A;  3S7N A;  2JKF A;  2RL3 A;  4O7D A;  5J3W A;  1UGU A;  1K54 C;  3FPV A;  1JTD A;  3FZC A;  4GD8 A;  2V1Z A;  4IBR A;  1FIK A;  1TS8 A;  3E4P A;  5MC7 A;  1KGE A;  2O9C A;  2D02 A;  4LCM A;  3OPL A;  5AQA A;  5F5Y A;  1OJG A;  4ZTK A;  4EW7 A;  4BQM A;  5JYP A;  5KIZ A;  4KG2 A;  2XRN A;  2O0Y A;  1IFQ A;  3AGF A;  4O01 A;  2VV7 A;  1J9M A;  3TOI A;  2VLG A;  2YKF A;  3ZG8 B;  1YMS A;  1Q2P A;  4PPR A;  3OPH A;  4BBV A;  2VZW A;  1FCO A;  3BLM A;  2ZM0 A;  1EW0 A;  1KGF A;  2GJ3 A;  2A24 B;  2JKR I;  2Y2M A;  3WS2 A;  2UV0 E;  3LO7 A;  2JKR M;  2KLI A;  4LEN A;  3BFD A;  1YLT A;  2CMN A;  4E3I A;  1S66 L;  3TG9 A;  3UB5 P;  3G32 A;  2E8J A;  3K2N A;  2W3F A;  2L1M A;  5AVF A;  2J3T C;  1SDE A;  5J7E A;  4XUZ A;  4LFU A;  1PZO A;  3ZGA B;  1OTD A;  1F2K A;  3ZCZ A;  1GHI A;  2XFT A;  2HDR A;  2WGV A;  2PRF A;  4P87 A;  4KQO A;  1ES3 A;  5HZH A;  3OCL A;  1IYO A;  3KSG A;  3HRE A;  2JKT I;  4R23 A;  5C5K A;  5GHX A;  3OLO A;  3HL9 A;  1JWZ A;  4PMA A;  3MQQ A;  4HOI A;  4BD0 A;  3LIE A;  4R4S A;  3SS3 A;  5FAQ A;  1CK3 A;  5HL1 A;  3R7W B;  3A0S A;  5TR7 A;  4N9L A;  4KZ4 A;  3Q7Z A;  5EM0 A;  5J4E A;  4RX2 A;  5CHU A;  3IBR A;  3IS2 A;  4A5R A;  3ULF A;  1NYY A;  1SDN A;  2EX9 A;  5HWV A;  2W0N A;  1I5Q A;  3HUN A;  1GSX A;  3Q7V A;  4HJ4 A;  3FWL A;  3FKW A;  4R6L A;  3A0R A;  4BD1 A;  3PAE A;  5TJJ A;  3BEC A;  2L4R A;  3WRT A;  3BW6 A;  2J8Y A;  3JPU A;  2EFX A;  1XJ4 A;  3UN7 A;  4GCZ A;  2FFY A;  4UQI M;  2EX8 A;  4EQI A;  2VV8 A;  2XFS A;  4E6W A;  1TD5 A;  1SZV A;  3LYX A;  4Y3I A;  2NUT C;  1KDS A;  1L0D A;  2QYB A;  4CLC C;  3VP1 A;  1YSP A;  5HAR A;  4C75 A;  2V8C A;  3FG8 A;  3QP6 A;  4R4R A;  2Y2I A;  1ERO A;  5DJU A;  2C6W B;  2PYR A;  3L9K A;  4X68 A;  3C30 A;  2J3W A;  4CLC B;  1HVB A;  4WUJ A;  5DF8 A;  1ACF A;  3GMW A;  5L8M A;  3BY9 A;  3BFF A;  1G6O A;  5TBM A;  3T12 B;  4JGO A;  1OTA A;  5E2H A;  1P9W A;  1LL5 A;  5CXW A;  1Q2Q A;  2Y2Q A;  1LLB A;  3A3F A;  2H0T A;  3EQV A;  3H82 B;  4OOY A;  3VOL A;  5DFX A;  1XGI A;  1FIL A;  2XD1 A;  4LRY C;  1M6K A;  3RTY A;  1FR6 A;  1U60 A;  4L9E A;  2G2W A;  1IKI A;  1DP8 A;  4UQI S;  5EVE A;  5FDH A;  3D9Y A;  1FOF A;  4EWF A;  4ZAM A;  5HPF A;  4KUK A;  3S22 A;  5EVI D;  4B93 A;  4B9O A;  1BSG A;  2Y2G A;  3IX4 A;  5EUA A;  3VP2 A;  3PBQ A;  1IEM A;  1FSW A;  3H9W A;  4JLF A;  5CGW A;  1WYB A;  1N4O A;  5E2G A;  3BJN A;  4WBG A;  4Z9Q A;  3GVB A;  3IXD A;  1L2S A;  3IWO A;  4IUH A;  4WM9 A;  4RA7 A;  4WYY A;  2QJ5 A;  1W63 M;  3LID A;  2KDK A;  4EBL A;  3T4O A;  4EQ1 A;  4BBT A;  4DE0 A;  1PW8 A;  5KSH A;  4MNR A;  4RX3 A;  1GHM A;  3B33 A;  3HUM A;  4WMC D;  4UA6 A;  1ES5 A;  5CGX A;  2HJE A;  4OPR A;  3U2A A;  3W4Q A;  5GLA A;  2J9P A;  3I7J A;  3NJA A;  3IH9 A;  3C4O A;  4IED A;  1WYC A;  2J3T D;  4KZ3 A;  4QU3 A;  1H3Q A;  3T4K A;  3Q07 A;  1MBL A;  5DF9 A;  4QD4 A;  4H6J B;  4PM8 A;  3IBJ A;  2O9B A;  1LI9 A;  4JKT A;  2E8I A;  4ZJ2 A;  3MZE A;  3LI8 A;  2KX6 A;  3WS0 A;  3VV4 A;  5F82 A;  1C3B A;  4YIN A;  4H8R A;  1Y28 A;  3DBA A;  4DJ2 A;  4CLC A;  3KSH A;  3H7W A;  3FC7 A;  5HDC A;  3ZG0 A;  3NOT C;  1W7F A;  5KZH A;  3MQ0 A;  4LV2 A;  2V0U A;  2EX6 A;  1YKD A;  4NXG A;  3UB8 A;  2J9O A;  3NY4 A;  5GLD A;  3EEA A;  2KOI A;  3NI9 A;  4X25 A;  4WMC A;  1MWR A;  2W3E A;  3WS1 A;  4FCF A;  3NDE A;  3UDI A;  3LR4 A;  3MMH A;  2PBD P;  5FAT A;  1OPX A;  3M2K A;  2PR6 A;  2Y4A A;  5FQJ A;  4EBN A;  1Z6F A;  3QNC A;  2OLV A;  4HBU A;  2WKQ A;  3N8R A;  3C5A A;  2Z6D A;  2UWX A;  1TS6 A;  2DMW A;  1ES4 A;  3O5Y A;  4K0W A;  4LV0 A;  2Y59 A;  4N1H A;  2OV5 A;  1TVF A;  3BQA A;  3Q1F A;  1ERQ A;  1TF1 A;  2PR5 A;  4OPZ A;  3A3J A;  1ZG4 A;  3ITB A;  2HP9 A;  3NEC A;  1PI4 A;  3G2Y A;  4WF0 A;  5FQQ A;  4WEK A;  2ZQD A;  3W8K A;  1V9Y A;  5I5L A;  2QWS A;  4R70 A;  4WZ4 A;  1T1B A;  4DRT A;  3IX8 A;  2LB5 A;  3GQZ A;  3BEB A;  3PYP A;  3CPT A;  5DTT A;  1K6R A;  1LL8 A;  1SCW A;  2ZMV A;  3LFV A;  3UMD A;  5EPH A;  2ZOI A;  3IF6 C;  4Q8I A;  3QP4 A;  1S1Z A;  5I94 A;  3V3S A;  1XGJ A;  3UE6 A;  5J8X A;  4S2N A;  4Y0T A;  3GDI A;  3SZT A;  5GL9 A;  4Y0U A;  1KDW A;  2O9A A;  5DFY A;  3EWK A;  1X0O A;  3T4Q A;  4OVD A;  2C5W B;  1KE0 A;  3IXB A;  3MXS A;  3LIC A;  3MJQ A;  1YLP A;  2RCX A;  4S2N C;  4X53 A;  3IHA A;  4X1M A;  1BYW A;  2V1B A;  1LT0 A;  2QZ6 A;  3G35 A;  3EEH A;  4OP8 A;  1DY6 A;  1H8M A;  3CI6 A;  4BLM A;  4I5S A;  3LUQ A;  3HLG A;  4GZB A;  1DJB A;  2QHK A;  4OP5 A;  3NC8 A;  4QWO A;  1NWZ A;  4YNR A; 
#chains in the Genus database with same CATH homology
 3S7Q A;  4MMN A;  2GZA A;  3OLO A;  4JGQ A;  5DJT A;  4EEU A;  3UME A;  2EWV A;  3KX0 X;  2XSS A;  3MQQ A;  5HSQ A;  4HOI A;  3LIE A;  4WLA A;  5G4Z A;  3R4K A;  4RQ9 A;  5HL6 A;  3R7W B;  3G6O A;  3A0S A;  4HP4 A;  2NUP C;  4GLQ A;  2K2N A;  3H7W B;  3F1O B;  2XA7 M;  5DKK A;  1OT9 A;  5J4E A;  2M1C A;  4ARZ A;  3TW8 A;  4DN0 A;  4GJ4 A;  1F5M A;  5K5B A;  2V9A A;  4HIA A;  3IBR A;  3IS2 A;  1P97 A;  2FZ0 A;  1OTE A;  3MXQ A;  4WEL A;  2A2L A;  3ULF A;  2O99 A;  3T4J A;  2VX8 A;  2W0N A;  5HWV A;  4DJ3 A;  4NXB A;  1GSX A;  1OT6 A;  3KO6 A;  2W27 A;  2W1T B;  5HDD A;  1MZU A;  1T18 A;  4HJ4 A;  3S7O A;  4R6L A;  3BQ8 A;  1V9Z A;  3A0R A;  3UE3 A;  3RFB A;  1XJ6 A;  3KYQ A;  5TJJ A;  4HQA A;  3KYZ A;  3CUE A;  4EES A;  3EGX C;  2L4R A;  4GS9 B;  2INW A;  3OBF A;  3BW6 A;  5EFW A;  4NXF A;  3JVV A;  1XJ4 A;  4I39 A;  4IHQ A;  3F1P B;  4I3J A;  1P0Z A;  4GCZ A;  4UQI M;  1G28 A;  2PDR A;  2VV8 A;  4IJG A;  3B42 A;  3CIT A;  1T1C A;  4P6Z M;  1TD5 A;  4L0L A;  3LYX A;  4Y3I A;  2NUT C;  4G3K A;  2QYB A;  2GX5 A;  4CLC C;  4GHI B;  4OOL A;  4EXO A;  3C2W A;  1YSP A;  2YKH A;  4I3I A;  2HF6 A;  3ICY A;  3F1N A;  3FG8 A;  4PKY G;  2MJ6 A;  3KSI A;  4II7 A;  5DJU A;  2PYR A;  3NOU C;  1F98 A;  3C30 A;  4KUO A;  2J3W A;  1S4S A;  3BWL A;  3CAX A;  3FPW A;  4CLC B;  5HWT A;  4WUJ A;  1OJ5 A;  4DMZ A;  2JKT M;  2QKP A;  5L8M A;  3BY9 A;  1NLY A;  1G6O A;  5TBM A;  4JGO A;  2OWJ A;  1LSW A;  1OTA A;  2OWH A;  2H28 A;  1P9W A;  3EGD C;  4IUK A;  2VA0 A;  4LRX C;  3K3C A;  2W1T A;  2VGL M;  3EQV A;  3H82 B;  5HWW A;  4ETZ A;  2M7U A;  3VOL A;  5A8B A;  5DFX A;  4LRY C;  2K31 A;  1W63 Q;  4NKP A;  1YSQ A;  4HP9 A;  3RTY A;  1GSV A;  4L9E A;  4Q0I A;  1DP8 A;  4UQI S;  4BJP A;  3BY8 A;  2HJ9 C;  4MN7 A;  4UEY A;  3LIB A;  4P6Z S;  5F68 A;  3OCN A;  5HPF A;  3LR5 A;  2B18 A;  4KUK A;  4B93 A;  2OAQ 1;  2OOL A;  1IOU A;  4B9O A;  5IS1 A;  3P01 A;  5F69 A;  4EEP A;  4BWI A;  3PBQ A;  4LRZ E;  3H9W A;  3NHQ A;  1VB6 A;  1YAX A;  4Y5F A;  4MN6 A;  1XFN A;  3OC2 A;  2VJW A;  4Z1W A;  2OAP 1;  5TBM B;  3BJN A;  2BAS A;  1T1A A;  2PT7 A;  1WA9 A;  4NEE D;  4ETX A;  4G3V A;  4IUH A;  3H82 A;  2VGL S;  3C38 A;  3F1O A;  3HJK A;  3PHY A;  2QJ5 A;  4MN5 A;  1W63 M;  3LID A;  1UWN X;  2KDK A;  2PD7 A;  2M7V A;  3T4O A;  1DP9 A;  1DRM A;  1UWP X;  4ME4 A;  4EQ1 A;  4BBT A;  3V67 A;  4QPR A;  5KSH A;  4H6J A;  4YOF A;  3E0Y A;  4WN5 A;  4R3A A;  2PYP A;  2JHE A;  3B33 A;  4NXE A;  2EWW A;  5HD3 A;  3SW1 A;  3MR0 A;  3TJZ C;  4ZRR A;  2ZOH A;  2HJE A;  4M4X A;  4K08 A;  3C8C A;  4L9G A;  3U2A A;  3CUE C;  3NJA A;  2WKR A;  2D01 A;  3LR0 A;  4OOM A;  2J3T D;  1TS7 A;  3PR6 A;  3PBR A;  1OTI A;  4MCW A;  4PKY A;  1H3Q A;  3MF0 A;  3T4K A;  3LIA A;  3T4S A;  4F3L B;  1MC0 A;  4FSF A;  4HJ3 A;  1ZHH B;  5DF9 A;  2P08 A;  4H6J B;  4EU0 A;  5LBR A;  4HNB A;  3T4L A;  2GNX A;  2WKP A;  5AVE A;  4XT2 B;  3IBJ A;  3VE3 A;  4HHD A;  2XRO A;  2O9B A;  4WL9 A;  2V1A A;  4WEJ A;  2P04 A;  2Z6C A;  3UB9 A;  3LR3 A;  4O0P A;  2W3G A;  4Q0J A;  4GS9 A;  2G7U A;  4EET B;  3LI8 A;  4R38 A;  2KX6 A;  3S7P A;  3UB7 A;  3VV4 A;  4G3W A;  1Y28 A;  2L0W A;  3IS2 B;  3DBA A;  4DJ2 A;  2J80 A;  1KOU A;  1S67 L;  2HGV A;  2Y79 A;  3MQO A;  3CWF A;  5HD5 A;  4CLC A;  4JGR A;  5DKL A;  3KSH A;  3H7W A;  2I9V A;  3EQU A;  3FC7 A;  5HDC A;  4HJ6 A;  3NOT C;  3GEC A;  4KQD A;  3TRC A;  3MFX A;  4XT2 A;  4PHT A;  3R7W A;  3MQ0 A;  3B47 A;  4BMW A;  3A0V A;  4EER A;  2V0U A;  3F1N B;  4PAU A;  1N9N A;  2ZMF A;  1YKD A;  4HI4 A;  4NXG A;  3UB8 A;  4EUV A;  3ZYT A;  1D7E A;  1N9L A;  2VEA A;  2B02 A;  1DP6 A;  1S1Y A;  3RH8 B;  3EEA A;  1STZ A;  2R78 A;  2KOI A;  1P9R A;  5HPI A;  4CLC D;  2XA7 S;  2HV1 A;  3LI9 A;  2W3E A;  4I38 A;  1ZTU A;  5HDS A;  4CLC E;  1NLZ A;  3LR4 A;  3MMH A;  3PBO A;  1GSW A;  2W3D A;  3D3O A;  4F3L A;  5IT5 A;  1OPX A;  2ZBB A;  3E4O A;  2PR6 A;  5CX7 A;  3W2Z A;  5AJG A;  3NOP C;  4Q0H A;  1MKM A;  3T50 A;  4FOF A;  3EOI A;  1N9O A;  2K7S A;  2WKQ A;  4HY8 A;  2FH5 A;  3S7N A;  3PBS A;  3F1P A;  2Z6D A;  4AFI A;  1TS6 A;  2Y8H A;  4YWZ A;  2DMW A;  5G4Y A;  3O5Y A;  5J3W A;  2JN7 A;  2P7J A;  1UGU A;  4GW9 A;  3FPV A;  4Y2F A;  2PD8 A;  1D06 A;  3BQA A;  2EA9 A;  1TF1 A;  2PR5 A;  2W1R A;  1TS8 A;  3E4P A;  5MC7 A;  2O9C A;  2D02 A;  4JGP A;  3PBN A;  5F5Y A;  4WF0 A;  5IU1 A;  1OJG A;  4E04 A;  4WEK A;  5FL3 A;  1LSV A;  4EW7 A;  2QJ7 A;  5KIZ A;  1V9Y A;  2XRN A;  2O0Y A;  1XFQ A;  1IFQ A;  5I5L A;  2QWS A;  4R70 A;  4L9F A;  4O01 A;  2VV7 A;  1XJ2 A;  1T1B A;  1LSX A;  4I3A A;  2LB5 A;  1XJ3 A;  1S4R A;  3OOV A;  3CLO A;  3P7N A;  1ODV A;  2V0W A;  3PYP A;  2VLG A;  2YKF A;  4HH2 A;  4LLO B;  1LL8 A;  3LFV A;  2ZMV A;  1JNU A;  3UMD A;  4MDZ A;  2ZOI A;  3E4Q A;  2A24 A;  4CQH A;  1S1Z A;  4BBV A;  2VZW A;  1T19 A;  3UE6 A;  1EW0 A;  1NRJ A;  2GJ3 A;  2A24 B;  3HCY A;  2JKR I;  3UB6 A;  3T4T A;  4ARZ B;  3D72 A;  3GDI A;  3K3D A;  2JKR M;  2KLI A;  2O9A A;  2CMN A;  3VE4 A;  5DFY A;  3EWK A;  1X0O A;  1TS0 A;  2VKS A;  3T4Q A;  1S66 L;  2VV6 A;  3PBT A;  1OTB A;  3K2N A;  2W3F A;  1F9I A;  2L1M A;  5AVF A;  2J3T C;  3LIC A;  4GHI A;  4BBU A;  3TE8 A;  4HH3 A;  3MJQ A;  3E98 A;  5J7E A;  3JVU A;  2W3H A;  5F6A A;  1BYW A;  2V1B A;  2LB9 A;  1LT0 A;  3KSF A;  4O8G A;  2PHY A;  1OTD A;  3EEH A;  2IA2 A;  3HJI A;  1H8M A;  3CI6 A;  3ZQ5 A;  4I5S A;  3LUQ A;  3PXP A;  4KQO A;  4LPZ A;  5HZH A;  3OCL A;  2QHK A;  3KSG A;  1VHM A;  2JKT I;  5C5K A;  3LIF A;  1NWZ A;  4YNR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...