3MR0A

Crystal structure of sensory box histidine kinase/response regulator from burkholderia thailandensis e264
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
134
structure length
131
Chain Sequence
ERFQLAVSGASAGLWDWNPKTGAMYLSPHFKKIMGYEDHELPDEITESIHPDDRARVLAALKAHLEHRDTYDVEYRVRTRSGDFRWIQSRGQALWNSAGEPYRMVGWIMDVTDRKRDEDALRVSREELRRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Sensory box histidine kinase/response regulator
publication title Crystal Structure of Sensory Box Histidine Kinase/Response Regulator from Burkholderia thailandensis E264
rcsb
source organism Burkholderia thailandensis
total genus 35
structure length 131
sequence length 134
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3mr0A01
1GSVA 4R3AA 5HDCA 4GS9B 2PR6A 1T1CA 3VE4A 2JN7A 1UWPX 4PKYA 1Y28A 1N9OA 2YKFA 3E4QA 1LL8A 4R38A 5J3WA 4JGPA 5HD5A 2VV6A 3EWKA 2OWJA 4I3IA 1EW0A 3RH8B 2EA9A 1S1YA 3MQOA 4I39A 3MXQA 4XT2A 1TS8A 4NXBA 4NXEA 1D7EA 4LPZA 3HJKA 2PD8A 4HOIA 2Z6DA 1F9IA 4I3AA 5HDSA 2WKRA 4I3JA 4EETB 3NOUC 4L9FA 4EW7A 5HWTA 3E4OA 5A8BA 1LSVA 3H82A 3F1PB 1TS0A 3FG8A 1G28A 1OJGA 1S4SA 4H6JB 3PHYA 2QWSA 2A24A 3F1OB 2V0UA 4EEUA 1OT9A 1DP6A 3MR0A 4YWZA 1XJ2A 2WKPA 3K3CA 1VB6A 5TBMA 1XFQA 4I5SA 4KUKA 2ZBBA 4WUJA 4L9GA 1V9YA 2V1BA 4B9OA 5HDDA 1KOUA 2ZOHA 5F68A 2QJ5A 4LLOB 1UGUA 3GDIA 3F1NB 5HWWA 2QJ7A 1LSWA 1XJ4A 2V1AA 1GSXA 1TS6A 3UE6A 3LYXA 1XJ6A 5G4YA 3GECA 1OTEA 3FC7A 1P0ZA 4XT2B 2JHEA 1T19A 4F3LA 3ZQ5A 3A0SA 1S1ZA 3VE3A 3MFXA 2L1MA 1DP9A 2KX6A 3A0VA 1DRMA 4R70A 3LI9A 3D72A 2INWA 4NXFA 5HSQA 3H82B 4GW9A 1S67L 2CMNA 3A0RA 2B02A 4HQAA 3IS2A 3NOTC 1XFNA 1ODVA 3BY8A 4HJ6A 4JGQA 1LSXA 2D02A 4WF0A 4I38A 3KX0X 4KQDA 4L9EA 2QKPA 2GJ3A 4M4XA 3ICYA 3UB9A 4PKYG 3EEHA 4HNBA 1OTDA 1OTBA 5TBMB 5DKLA 5KIZA 1TS7A 2BASA 3H7WB 2VLGA 4BBVA 3C2WA 2R78A 2OOLA 1NWZA 1OTIA 5IU1A 3P7NA 3H9WA 4HP9A 5F69A 2P7JA 3NOPC 3UB7A 1X0OA 4WLAA 4EQ1A 1P97A 1T1BA 4JGOA 3UB6A 4GHIB 1OT6A 3UMDA 3K3DA 5DKKA 3T50A 4HIAA 2I9VA 3VOLA 3G6OA 5AVFA 3BWLA 3CWFA 4F3LB 3NJAA 2V9AA 4MN5A 2D01A 3PYPA 2ZOIA 2W27A 1JNUA 4H6JA 3B33A 4EEPA 1LT0A 3UB8A 4KUOA 3IS2B 3BY9A 2V0WA 3NHQA 2KDKA 1DP8A 4R6LA 5DJUA 5J7EA 1T18A 3UMEA 1T1AA 3LIAA 2QHKA 3LUQA 4HY8A 4WL9A 4BBTA 4DJ2A 1V9ZA 5HD3A 3C8CA 4HJ3A 2VV8A 4GCZA 3CAXA 3F1NA 2H28A 2OWHA 2A24B 4HP4A 2YKHA 4GS9A 4HH3A 5F6AA 3LIBA 4NXGA 2VEAA 1F98A 4DJ3A 2WKQA 1S66L 1BYWA 3LI8A 5IS1A 3E4PA 5HZHA 5HWVA 5EFWA 3LIEA 1OTAA 2J80A 4BBUA 4HH2A 3MJQA 3LIDA 1GSWA 4LRYC 4E04A 2VV7A 5F5YA 4EXOA 2L0WA 4K08A 1OJ5A 4EERA 3IBRA 2PHYA 4HHDA 2PDRA 4RQ9A 5AVEA 3F1PA 3LIFA 4HI4A 2HV1A 3H7WA 4LRXC 2PYPA 4MN6A 2Z6CA 1D06A 3ULFA 3F1OA 1N9LA 1XJ3A 2W0NA 1N9NA 3CLOA 3LICA 2K7SA 4EESA 2M1CA 2L4RA 3HJIA 1WA9A 1UWNX 4HJ4A 3OLOA 4LRZE 5DJTA 3RTYA 5G4ZA 4JGRA 5I5LA 4GHIA 1MZUA 2PD7A 2PYRA 1S4RA 2PR5A 3SW1A 3MQQA 4WN5A 5J4EA
chains in the Genus database with same CATH superfamily
1PI4A 4GJ4A 4IVIA 3OC2A 4KG2A 3TG9A 1W7FA 1XP4A 1IYSA 2PBYA 5EPHA 5J3WA 3KO6A 1MWSA 5HD5A 3BW6A 4KZAA 2VV6A 2WZXA 3NULA 3IF6A 4WBGA 4OPRA 3MBZA 4LGWA 4NXBA 4NXEA 1D7EA 2PD8A 5FQMA 3HLCA 1CF0A 4UQIS 4HOIA 3T4OA 5HDSA 4OOYA 3KYQA 3MF0A 1XA7A 1ZG6A 3P98A 1H8ZA 4PMAA 3T12B 5HWTA 3MZFA 4GDNA 3SS3A 2ZQ8A 2KLIA 4ETZA 1PNEA 3B47A 1H8MA 4GOGA 1TEMA 1GCEA 3LR4A 3F1PB 1TS0A 3FG8A 2EWVA 5D3OA 1SDNA 1HTZA 2QWSA 3F1OB 2V0UA 4H8RA 1OT9A 4DN0A 5FQJA 4KZ7A 3K3CA 3V50A 2VA0A 4OPZA 1VB6A 5A92A 2LB5A 3A3IA 3ZFZA 2WGWA 5FQQA 1VM1A 2H0YA 4GZBA 4ARZA 4PM6A 3KSIA 4KQQA 2P74A 2ZOHA 3T1QB 2QJ5A 3V39A 1UGUA 3GDIA 2DCFA 4R4RA 3MKFA 4UA9A 1XJ4A 3DW0A 3N6IA 2V1AA 3EGDC 4O7DA 1JWZA 1TS6A 1K57A 2ZMVA 3S7OA 2GNXA 1P0ZA 4ZJ3A 4WEKA 3A3EA 4XT2B 2OLUA 3FYZA 3A0SA 1S1ZA 2PBDP 3VE3A 3BYDA 2L1MA 2XDMA 3A0VA 1LL9A 2P9VA 4NXFA 3ZG0A 5F1FA 2WADA 2W1RA 3ZHHA 1S67L 2ZQ7A 4BD0A 3A0RA 4HQAA 4U0TA 3R7WA 3FKWA 3BY8A 4OONA 5DTTA 3UN7A 1K25A 4IHQA 2A3UA 2JBFA 1ES2A 3HLFA 4K0WA 1BTLA 2QKPA 3IX3A 2XA7S 4CQHA 2R9XA 3EEHA 3KSGA 4Y3IA 3P01A 4JLFA 4OPYA 1TS7A 3H7WB 1IYOA 2WKEA 4N9KA 4BBVA 4EUVA 1CI9A 2R78A 2OOLA 1NWZA 3LY4A 3GR2A 1OTIA 5IU1A 2G7UA 2KOIA 3DTEA 1XGJA 4FTXA 3C4OA 3PBSA 2XEPA 5HAIA 1NZUA 5HL6A 3DWKA 2X71A 5FQ9A 3S7QA 5FDSA 1T1BA 4JGOA 3UDFA 1OT6A 4ZRRA 4G3WA 3UMDA 2EX6A 1QMEA 5DKKA 3FKVA 2Z2MB 5FA7A 5JYPA 4HIAA 4S2OA 3G6OA 3CWFA 4F3LB 2V9AA 4MN5A 2IWBA 1RP5A 1JNUA 3A3JA 4H6JA 2EX8A 5C5KA 2EFXA 2Y2PA 1XA1A 3UB8A 1E25A 3IWIA 4KUOA 3IF6B 2GDNA 3IS2B 1ES5A 3OPRA 1PYYA 2JKTI 2KDKA 2M7VA 1YMXA 1KGFA 4CLCE 1Y4OA 4LCMA 1SHVA 2WAFA 2EX2A 3IT9A 3Q7VA 4BENA 1NRJA 3TW8A 2BLSA 2UWXA 3QP1A 2VV8A 5CGSA 5F1GA 4KQRA 2H28A 4DE2A 4NETA 2OWHA 3G34A 1TF1A 4E3LA 3E98A 4HP4A 5EVIC 2YKHA 4WZ5A 3VP2A 1K4FA 5EM0A 4MMNA 3T4KA 5CECA 2E8JA 3IQAA 4NXGA 3CUEA 1RCJA 2Z2LB 5AJGA 5HWVA 2G2WA 4OKPA 4ARZB 4HH2A 4U3TA 4JXGA 4LFUA 2Q9MA 4KENB 4JF4A 3N8SA 4E04A 2ZLYA 3VSLA 4QHCA 2HDUA 1YSQA 4ZBEA 3G31A 3Q82A 2L0WA 5AQBA 5IT5A 1F2KA 3LR0A 1OJ5A 4EERA 4GB7A 2Y2JA 1KVLA 3W4QA 1YLJA 3JYIA 4RQ9A 3G32A 5AVEA 1G6AA 3F1PA 3UPPA 4ZDXA 2XSSA 3N8LA 1HVBA 2ACGA 4FOFA 5KMWA 4EBLA 2PT7A 1FR6A 3VSKA 2P9VB 4RX2A 1E4DA 3F1OA 5L8MA 4EESA 3R7WB 3IX8A 3U2AA 2K2NA 4O8GA 4E3OA 3NBLA 3HLBA 5FI2A 1YPRA 4QY5A 4LRZE 5DJTA 3BEBA 2Y2LA 3IHBA 4JGRA 5I5LA 4OPQA 5E2GA 5HAPA 2FFYA 3TE8A 4FCFA 5CEDA 1GSVA 5HDCA 1O07A 3VE4A 3TSGA 1K6RA 1PW8A 1Y28A 3FV7A 3T4JA 4OOLA 1YLZA 2HGVA 5HARA 4EBPA 4R1GA 3T1SA 4FUWA 2OWJA 5GL9A 4I3IA 3WS2A 3RH8B 2EA9A 3MQOA 3MXQA 4XT2A 4UA7A 3UNWA 4Y5FA 2K31A 4XUZA 5DFYA 2V2FF 3NCKA 4I3AA 1F9IA 2VX8A 5EVEA 1K57C 4I3JA 4EETB 5DF7A 2O9BA 3VP0A 1K55A 3R4KA 4E3KA 3M2JA 1W8QA 2HJ9C 5A8BA 2V20A 3ZG8B 2J9PA 4Q0HA 2VZWA 5CHJA 4G3KA 3SS4A 5M18A 3ZG5A 3DTIA 3FWLA 3G4PA 1G28A 1OJGA 4YFMA 4Y2FA 4H6JB 3PHYA 4WZ4A 3PTEA 4Y13A 3NDEA 3HUNA 5I94A 2FFFB 3Q1FA 1YLYA 1E3UA 5E2FA 4E3NA 1XGIA 1SZVA 5K5BA 5FAOA 4YWZA 3BFEA 1XJ2A 4GLQA 2P08A 4KZ8A 1KE0A 1WYBA 2G2UA 1XFQA 4JBFA 4KUKA 2ZBBA 4WUJA 3Q7VB 4L9GA 4CLCB 3VMAA 5U47A 5LBRA 3VFFA 1DJBA 3PBOA 5DTKA 3SZTA 4UHUA 1LI0A 4B9OA 1KE3A 1KOUA 2Y2IA 1NYYA 2XF3A 4JPMA 1JWPA 5HWWA 3HBRA 5L10A 5FQKA 3UE6A 5DFXA 4GD8A 3CMZA 1K56A 4OQGA 4O0PA 1K54C 3CITA 2J7VA 4F3LA 2Q0OA 2VGJA 4X56A 2V8FA 5EUAA 2KX6A 2HZ5A 1LLBA 3PR6A 4E3JA 3OOVA 1DRMA 4R70A 3U4LP 4DE1A 2DRWA 1IELA 2O9AA 3D72A 4ZTKA 4GW9A 2B02A 3QP4A 3PAGA 3IS2A 3NOTC 4JKTA 1XFNA 5JYOA 4HJ6A 1KDSA 2HPBA 1W8YA 3ZGAB 5F82A 4I38A 3KX0X 4L9EA 1VEUA 2EWWA 3IBJA 3IWOA 3BFDA 3UB9A 3BLSA 4JF6A 3MXSA 4KZ3A 4BD1A 5M1AA 3HLEA 5CTNA 2BASA 4X68A 3C2WA 5E2HA 3ZG9B 2ZC7A 3H9WA 4B4ZA 5DF9A 5KSHA 4YNRA 4RA7A 1SDEA 4CLCD 2P7JA 3PBNA 1SCWA 1FOFA 4WELA 3TOIA 4S2NA 2ZQCA 5FDHA 3MXRA 4EQ1A 4P6ZM 4QWOA 4Q0JA 2WK0A 3L9KA 3UB6A 3ZCZA 3BRMA 3K3DA 2P04A 3OCNA 1XPBA 2I9VA 2JKFA 3VOLA 3BWLA 1GHMA 3CUEC 5CGWA 1PWCA 4QU3A 2ZOIA 2V1ZA 1A0KA 2Y2MA 4GD6A 1LHYA 3ZDJA 3N8RA 4S2PA 5CTMA 3SH7A 5EM1A 1Y54A 4BMWA 1CEGA 2V0WA 5GLCA 3SS5A 1DP8A 4R6LA 3UMEA 4R4SA 4IUHA 1O7EA 3D9YA 4Y0TA 2WAEA 1H5XA 2QHKA 4P87A 3UE1A 1Q2QA 4JF5A 3LUQA 3RXWA 3A3FA 3NDGA 3C8CA 4Y7PA 4HJ3A 5L2FA 1IYQA 1JWVA 3FPVA 2IA2A 1ESUA 1C3BA 3CAXA 3F1NA 3PBRA 5A93A 2ZQDA 4R3BA 1SKFA 3S1YA 3W2ZA 2PU2A 4BLMA 2E8IA 2XR0A 3SH8A 2NUTC 3LIBA 3IXHA 3WS4A 1W63Q 1OMEA 4DJ3A 3UDIA 3IXBA 5HZHA 2Y8HA 1TD5A 1QMFA 2ZC3B 1ZTUA 3MJQA 2VK3A 1NLYA 2LB9A 3LIDA 4KZ9A 1L0GA 1GSWA 1PZOA 4BJPA 2VV7A 5F5YA 1FQGA 2RL3A 4X53A 1PWGA 4LV2A 2PDRA 2EXAA 2OAQ1 3T4QA 5BOHA 3S7NA 5EE8A 3IX4A 1Q2PA 5CXWA 4MCWA 4HI4A 3QHYA 2HV1A 5GHZA 1K55C 2QZ6A 1S6RA 3JVUA 4N92A 1EWZA 4FH4A 3VFHA 5HFOA 4WEJA 1NYMA 4KZ4A 3ULFA 1KGGA 2ZL1B 3MFDA 3PBQA 4X1MA 3M6HA 2WZZA 3LICA 2K7SA 2Y2KA 5E2EA 5HX9A 4JXWA 2R9WA 4A5RA 1YM1A 1ERQA 1WA9A 1UWNX 4Z1WA 4BQMA 3CPTB 3T4SA 1NXYA 4GN2A 3S4XA 2OAP1 4MEZA 3LEZA 1MZUA 1VEUB 2XH9A 1ES3A 4X25A 4MBKA 4S2IA 4CLCA 3DAVA 3MQQA 4WN5A 3UY6A 1E3UD 2JCHA 1N9BA 3GQZA 1T1CA 4NEED 4X69A 1MKMA 2Y2NA 3GTCA 4PKYA 2HDSA 4MBHA 4EQIA 1N9OA 3M2KA 2HP6A 4R38A 5MC7A 3DBAA 3A3DA 4PPRA 1J3WA 3P09A 3NC8A 4JGPA 2XGNA 4EV4A 1BLPA 1IEMA 3T4LA 3EWKA 1FCNA 3E2LA 2O99A 1EW0A 4Q0IA 1YT4A 1I2WA 1S1YA 4I39A 1BLHA 1MWTA 4S2LA 4LENA 3HJKA 3W8KA 3KYEA 2WKRA 4DXBA 2EFUA 4L9FA 4HBUA 2Y79A 3E4OA 4B93A 5FI7A 4ZJ2A 5CEBA 1VHMA 4LCLA 1K56D 4RYEA 2PU4A 3WRTA 3HL9A 3PXPA 4KG6A 2A24A 2OV5A 4FSFA 1STZA 1YLTA 2WGIA 3EQUA 3IF6C 4NKPA 2ZQ9A 2Y2HA 2DNSA 3PBTA 4IUKA 5L09A 1EROA 3C7UA 4UEYA 3LR5A 1NRFA 3SOIA 3MR0A 4E3MA 3VP4A 1PFLA 2ZC4B 4P0MA 4C3QA 4UAAA 2H10A 4EUZA 4EWFA 3ITAA 2FZ0A 2UV0E 1V9YA 2V1BA 3LGOA 5EECA 5HDDA 5F68A 2HP9A 2JE5A 4MBFA 4P6BA 4LLOB 3F1NB 1P9RA 3ITBA 5GHYA 1MWUA 3C7VA 4DXCA 3TRCA 2A49A 4OLDA 3N7WA 3MMHA 3JPUA 1OTEA 3FC7A 2W1TA 3UPOA 1SKOA 1T19A 3GVBA 4C75A 3ZQ5A 2CC1A 1DP9A 3ZG7B 1GHPA 3Q7ZA 2IWCA 1ESIA 3B3XA 5TGFA 3LI9A 1ALQA 5DVAA 2INWA 3UE0A 3MSHA 5HSQA 3H82B 2CMNA 3RJUA 1OPXA 1ERMA 1G6OA 4N1XA 4Y15A 3N4IA 1PW1A 1ODVA 4PHTA 1LI9A 2Y2GA 3DWZA 1FCMA 2WKIA 3GV9A 4OLGA 2PAVP 2D02A 3GRJA 2XK1A 2J3TD 1L0FA 2HP5A 5FAQA 4KQDA 5AQAA 1CEFA 4XUXA 4C6YA 2XLNA 2J8YA 2GJ3A 1G5UA 4GKUA 4PKYG 1FSYA 2ZM2A 1H8YA 3I7JA 5CGXA 1OTDA 2C6WB 1K6SA 1FIKA 1FILA 5TBMB 4DMZA 3CJMA 3QP8A 5KIZA 5EOOA 3C4PA 1EI5A 2WKHA 2VLGA 1ACFA 1VETB 2HDRA 4HP9A 5F69A 3CZDA 2EX9A 3S7PA 1H0MA 3OPLA 3UB7A 4HEFA 2MJ6A 1HD8A 4K91A 3O88A 3IWQA 1FSWA 3EOIA 3G30A 2VGLM 4N9LA 3Q81A 2QPNA 1FR1A 5AVFA 5CX7A 4Z9QA 3ISGA 1D1JA 3T1RA 3PYPA 4DF6A 2W27A 5G18A 1BT5A 3ZVWA 4U0XA 5CERA 1LT0A 3BJNA 3L7HA 3GSGA 4WMCA 3BFCA 1AWIA 1ONGA 4Q8IA 4F94A 1LL5A 3B42A 1YQSA 1BUEA 5DJUA 1JVJA 1T18A 3K2NA 3C30A 1T1AA 4QY6A 4BWIA 2W3EA 4OQHA 4JXVA 2DMWA 1ZKJA 3M6BA 4WL9A 4BBTA 3WS0A 1V9ZA 4Y17A 2BTFP 3IH9A 2ZL1A 4D2OA 5F83A 3LCEA 1GA0A 4KZBA 4X55A 3BFFA 2ZM8A 1M6KA 2XQZA 3CPTA 3MKEA 2A24B 4UQIM 1P9WA 2VKSA 4X6TA 3OCLA 5TJJA 4O01A 3DTMA 3RXXA 1Z09A 3LFVA 4QJGA 5F6AA 4OP8A 3IF5A 5CRFA 5KZHA 1F98A 1S66L 1BYWA 5DTSA 4CLCC 5IS1A 3HREA 5EFWA 3UPNA 4PM5A 2Y59A 1MWRA 1MXOA 2J9OA 3HLDA 3EGXC 3W4OA 1MY8A 4BL3A 4LRYC 5CHMA 3FPWA 4EXOA 4JXSA 1BULA 1IOUA 4WZ5C 1PI5A 4B88A 4NK3A 2PHYA 4HHDA 3QP5A 2W1TB 3BFGA 3PAEA 1SKOB 4RX3A 4P6ZS 3IXGA 3OPPA 2ZC6B 3LIFA 3AGFA 5FEFA 2JKGA 2PYPA 2XFTA 4MN6A 3LEQA 4Y0UA 1D06A 1XXMA 2C5WB 5FEGA 5TFQA 1XJ3A 1N9NA 3CLOA 4ZAMA 2B5RA 3LY3A 4LV1A 3KSFA 2L4RA 1YSPA 2XROA 1L3LA 3IH8A 2HDQA 4E6WA 4KQOA 1ZC2A 3TJZC 4HJ4A 3O5YA 3HUMA 3RTYA 4GHIA 4S2KA 3DTKA 2PYRA 1IKIA 1S4RA 2PR5A 4KG5A 2W3HA 4MN7A 3MZEA 4R3AA 2JC7A 4GS9B 2PR6A 3D3OA 2JN7A 1UWPX 3O86A 4CPKA 4L0LA 2YKFA 2HJEA 5FL3A 3E4QA 3CG5A 1LL8A 4KZ6A 3ZYTA 3W4PA 3NI9A 1IYPA 2W3DA 2JKRM 3NIAA 3BLMA 5EV0A 2XA7M 5HAQA 4NG2A 5FASA 1TS8A 4LPZA 2AVXA 2Z6DA 4RVAA 2NUPC 3C5AA 2W3GA 4DDYA 2IWDA 3NOUC 3GMWA 1BLCA 4EW7A 4G3VA 1LSVA 3H82A 3G35A 3BQAA 2B95A 4D60A 4P85A 4PM8A 4MNRA 2Y55A 3NECA 1S4SA 3QNCA 5EOEA 1L2SA 2O0YA 3NY4A 2VGKA 4EEUA 5EVIB 5AQ7A 1DP6A 3MQ0A 1K54A 3MS6A 2WKPA 4HESA 5TBMA 1ZHHB 4E6XA 4I5SA 1VETA 1FCOA 1HLUP 3BECA 3WS1A 2VJWA 1DJAA 2ZMAA 3KYZA 4IBXA 5IHVA 1MBLA 4M3KA 3UO9A 1YAXA 2QJ7A 1LSWA 4MLLA 3FZCA 2XD5A 1GSXA 3LYXA 3ZVTA 1XJ6A 1N4OA 2I72A 1S0WA 3EQVA 5G4YA 5GLBA 1VQQA 4OH0A 3GECA 1NZOA 2Y2QA 3OBFA 4DE0A 5FQIA 2B18A 2JHEA 1YMSA 1K0KA 2HF6A 3MFXA 1KGEA 3QNBA 4E3IA 3Q07A 3VP3A 2M7UA 4OP5A 2J3WA 1GHIA 4YOFA 1I5QA 3V67A 5FATA 3HCYA 3IHAA 5HW3A 4YINA 5J8XA 3T4TA 1TDGA 2ZMFA 2XD1A 3JVVA 1NY0A 4R3JA 1L0EA 4JGQA 3UE3A 1LSXA 4CJNA 4WF0A 4ETXA 2QMIA 1MPLA 3O3VA 5EVLA 2Y2OA 5AQ9A 1G68A 4M4XA 4QPRA 3ICYA 4IEDA 2X01A 4WMCD 4XXRA 2GZAA 1J9MA 1KE4A 4DRTA 4HNBA 1XX2A 1OTBA 5EVID 5GHXA 4X1LA 5DKLA 5GLDA 3QP6A 1DY6A 2WGWB 2Y91A 4R0QA 3AGEA 3P7NA 3O87A 3C38A 4ZJ1A 2WYXA 1XKZA 2BG1A 4LV0A 5GLAA 1IFQA 2XRNA 3S22A 3NOPC 1PRQA 1DJCA 4OVDA 1CJFA 3CHWP 1PWDA 1X0OA 3HVFA 3V3SA 4GDBA 1F5MA 4WLAA 1YLWA 2RCXA 5HPIA 4BL2A 1P97A 3LO7A 3VOZA 4GHIB 4WM9A 3KSHA 1JTGA 2ZQAA 3AGDA 3T50A 1ZG4A 1MKIA 1PIOA 4FH2A 1HZOA 5A90A 1NLZA 4ID4A 3VOYA 3NJAA 2Q9NA 3E0YA 1L0DA 2D01A 2QYBA 1I2SA 4Y0OA 5KSCA 3WWXA 2WGVA 4ESPA 2ZM0A 1IKGA 3B33A 4EEPA 3ZNTA 2ZD8A 3EEAA 1BZAA 4WYYA 4MDZA 3VV4A 2PRFA 3OPHA 3CI6A 3BY9A 4S2NC 1CK3A 3NHQA 5J7EA 2EXBA 3RFBA 3HLGA 1YLPA 3LIAA 1H3QA 1Z6FA 1WYCA 2XFSA 3ZNYA 1U60A 3BQ8A 4HY8A 4DJ2A 1AXBA 5HD3A 4QD4A 4KZ5A 5TR7A 3VP1A 4FD8A 2J3TC 4S2JA 5M19A 3HUOA 2JKRI 4IVKA 4GCZA 3V3RA 4IBRA 4DDSA 1MC0A 4PM9A 3LR3A 5A91A 4N1HA 2WUQA 1K4EA 4HBTA 4PAUA 3UB5P 1PZPA 3BM6A 3V5MA 2O9CA 1TDLA 1BSGA 3D4FA 4K0XA 1TVFA 4GS9A 4HH3A 3HLWA 1BLSA 4B4XA 3QP2A 2VEAA 4GNUA 5HL1A 4II7A 4IJGA 2GX5A 2WKQA 3MZDA 3LI8A 3E4PA 2OSUA 4ME4A 4OOMA 3LIEA 1OTAA 2J80A 4BBUA 4R23A 1W63M 2ZC5B 4EU0A 2H5SA 4S2MA 2H0TA 2FH5A 2Y4AA 1ES4A 1KVMA 5L07A 1NJ4A 2V8CA 4QB8A 1GA9A 5CHUA 2OLVA 3IXDA 5HPFA 4K08A 1KDWA 1JTDA 3IBRA 3OZHA 5DF8A 4EBNA 3E2KA 5FSRA 2X02A 5E43A 3WS5A 1K38A 1M40A 1CI8A 4OQIA 3H7WA 1ONHA 4LRXC 3G2YA 2Z6CA 2VGLS 1RGYA 5FI6A 4AFIA 4PM7A 1N9LA 2W0NA 5EVIA 1W5DA 2A2LA 2M1CA 5FAPA 4LV3A 4DKIA 4UA6A 1YKDA 2ZJ9A 3HJIA 3SH9A 1WE4A 1W79A 3OLOA 3WRZA 2W3FA 3G2ZA 1RGZA 5G4ZA 1CQAA 2PD7A 2JKTM 3T1XA 3SW1A 4OQ0A 3UDXA 4DE3A 5J4EA
chains in the Genus database with same CATH topology
1GSVA 4MN7A 4R3AA 5HDCA 4GJ4A 4GS9B 2PR6A 1T1CA 3OC2A 3VE4A 3D3OA 2JN7A 1UWPX 4NEED 1MKMA 4PKYA 1Y28A 3T4JA 1N9OA 4OOLA 4L0LA 2YKFA 2HJEA 5FL3A 3E4QA 1LL8A 4R38A 5MC7A 5J3WA 3KO6A 2HGVA 3DBAA 3ZYTA 4JGPA 2W3DA 5HD5A 3BW6A 2VV6A 3T4LA 2JKRM 3EWKA 2OWJA 2O99A 4I3IA 1EW0A 3RH8B 2XA7M 4Q0IA 2EA9A 1S1YA 3MQOA 4I39A 3MXQA 4XT2A 1TS8A 4NXBA 4NXEA 4Y5FA 1D7EA 4LPZA 3HJKA 2PD8A 2K31A 5DFYA 4UQIS 4HOIA 2Z6DA 1F9IA 2VX8A 4I3AA 5HDSA 2NUPC 3T4OA 2W3GA 2WKRA 4I3JA 4EETB 2O9BA 3KYQA 3MF0A 3NOUC 4L9FA 3R4KA 4EW7A 2Y79A 5HWTA 3E4OA 4G3VA 2HJ9C 1LSVA 3H82A 5A8BA 2KLIA 4B93A 4ETZA 3BQAA 3B47A 1H8MA 4Q0HA 2VZWA 4G3KA 3LR4A 1VHMA 3F1PB 1TS0A 3FG8A 2EWVA 1G28A 1OJGA 4Y2FA 1S4SA 4H6JB 3PHYA 2O0YA 2QWSA 3PXPA 2A24A 3F1OB 4FSFA 1STZA 3EQUA 4NKPA 2V0UA 4EEUA 3PBTA 1OT9A 4IUKA 4DN0A 5K5BA 4UEYA 3LR5A 1DP6A 3MQ0A 3MR0A 4YWZA 1XJ2A 4GLQA 2WKPA 3K3CA 2VA0A 2P08A 1VB6A 5TBMA 1ZHHB 1XFQA 2LB5A 4I5SA 4KUKA 2ZBBA 4WUJA 4L9GA 4CLCB 5LBRA 2FZ0A 3PBOA 1V9YA 4ARZA 2V1BA 2VJWA 4B9OA 3KSIA 5HDDA 1KOUA 2ZOHA 3KYZA 5F68A 2QJ5A 4LLOB 1UGUA 3GDIA 3F1NB 1P9RA 5HWWA 1YAXA 2QJ7A 1LSWA 1XJ4A 3TRCA 2V1AA 3EGDC 1GSXA 1TS6A 3UE6A 3LYXA 5DFXA 1XJ6A 2ZMVA 3EQVA 3MMHA 5G4YA 3S7OA 3GECA 1OTEA 2GNXA 3FC7A 3OBFA 1P0ZA 4O0PA 2W1TA 4WEKA 2B18A 3CITA 4XT2B 2JHEA 1T19A 4F3LA 3ZQ5A 3A0SA 1S1ZA 2HF6A 3VE3A 3MFXA 2L1MA 1DP9A 2KX6A 3PR6A 3A0VA 2M7UA 3OOVA 1DRMA 4R70A 3LI9A 2J3WA 4YOFA 2O9AA 3D72A 2INWA 3V67A 4NXFA 5HSQA 3HCYA 2W1RA 3H82B 4GW9A 1S67L 2CMNA 3A0RA 3T4TA 2B02A 4HQAA 2ZMFA 3IS2A 3NOTC 1OPXA 1G6OA 3R7WA 1XFNA 3JVVA 1ODVA 3BY8A 4PHTA 4HJ6A 4IHQA 4JGQA 3UE3A 1LSXA 2D02A 2J3TD 4WF0A 4I38A 4ETXA 3KX0X 4KQDA 4L9EA 2EWWA 2QKPA 3IBJA 2XA7S 4CQHA 2GJ3A 4M4XA 4QPRA 3ICYA 3UB9A 4PKYG 2GZAA 3EEHA 4HNBA 3KSGA 4Y3IA 1OTDA 1OTBA 3P01A 5TBMB 4DMZA 5DKLA 5KIZA 1TS7A 2BASA 3H7WB 2VLGA 4BBVA 4EUVA 3C2WA 2R78A 2OOLA 1NWZA 1OTIA 5IU1A 2G7UA 3P7NA 3H9WA 5DF9A 4HP9A 3C38A 2KOIA 5F69A 5KSHA 4YNRA 3S7PA 1IFQA 4CLCD 2XRNA 2P7JA 3PBNA 3NOPC 3UB7A 4WELA 3PBSA 1X0OA 5HL6A 2MJ6A 1F5MA 4WLAA 4EQ1A 4P6ZM 3S7QA 5HPIA 4Q0JA 1P97A 1T1BA 4JGOA 3UB6A 4GHIB 1OT6A 4ZRRA 3KSHA 4G3WA 3UMDA 3EOIA 3K3DA 2P04A 5DKKA 3T50A 2VGLM 3OCNA 4HIAA 2I9VA 1NLZA 3VOLA 3G6OA 5AVFA 3BWLA 5CX7A 3CWFA 4F3LB 3NJAA 3CUEC 2V9AA 4MN5A 3E0YA 2D01A 2QYBA 3PYPA 2ZOIA 2W27A 1JNUA 4H6JA 3B33A 4EEPA 1LT0A 5C5KA 3BJNA 3EEAA 3UB8A 4MDZA 3VV4A 4KUOA 3B42A 3CI6A 3IS2B 4BMWA 3BY9A 2V0WA 2JKTI 3NHQA 2KDKA 2M7VA 1DP8A 4R6LA 5DJUA 5J7EA 3K2NA 1T18A 3UMEA 3RFBA 3C30A 4IUHA 4CLCE 1T1AA 3LIAA 4BWIA 2W3EA 1H3QA 2QHKA 2DMWA 3LUQA 3BQ8A 4HY8A 4WL9A 4BBTA 4DJ2A 1V9ZA 5HD3A 3C8CA 1NRJA 4HJ3A 3TW8A 2J3TC 3FPVA 2JKRI 2IA2A 2VV8A 4GCZA 3CAXA 3F1NA 1MC0A 3LR3A 2H28A 3PBRA 2OWHA 1TF1A 2A24B 3E98A 4UQIM 4PAUA 1P9WA 2VKSA 3W2ZA 4HP4A 3OCLA 2YKHA 5TJJA 2O9CA 4O01A 4MMNA 3T4KA 3LFVA 2NUTC 4GS9A 4HH3A 5F6AA 3LIBA 4NXGA 2VEAA 3CUEA 1F98A 1W63Q 4DJ3A 4II7A 4IJGA 2GX5A 1S66L 1BYWA 2WKQA 5AJGA 3LI8A 4CLCC 5IS1A 3E4PA 4OOMA 4ME4A 5HZHA 5HWVA 5EFWA 3LIEA 1OTAA 2J80A 2Y8HA 4BBUA 1W63M 4EU0A 4ARZB 1TD5A 4HH2A 1ZTUA 2FH5A 3MJQA 3EGXC 1NLYA 2LB9A 3LIDA 1GSWA 4BJPA 4LRYC 4E04A 2VV7A 3FPWA 5F5YA 4EXOA 1YSQA 1IOUA 5HPFA 2L0WA 4K08A 5IT5A 3LR0A 1OJ5A 4EERA 3IBRA 2PHYA 4HHDA 2PDRA 2OAQ1 2W1TB 3T4QA 4P6ZS 3S7NA 4RQ9A 5AVEA 3F1PA 3LIFA 4MCWA 2XSSA 4HI4A 2HV1A 3H7WA 4FOFA 3JVUA 4LRXC 2PT7A 2PYPA 4MN6A 2Z6CA 2VGLS 4WEJA 1D06A 3ULFA 3F1OA 4AFIA 1N9LA 1XJ3A 2W0NA 1N9NA 3PBQA 3CLOA 5L8MA 3LICA 2K7SA 4EESA 2A2LA 2M1CA 3R7WB 3KSFA 2L4RA 1YSPA 2XROA 1YKDA 3HJIA 3U2AA 2K2NA 4KQOA 4O8GA 3TJZC 1WA9A 1UWNX 4HJ4A 4Z1WA 3OLOA 3T4SA 3O5YA 2W3FA 4LRZE 5DJTA 3RTYA 5G4ZA 2OAP1 4JGRA 5I5LA 4GHIA 1MZUA 2PD7A 2JKTM 2PYRA 1S4RA 2PR5A 4CLCA 3SW1A 3MQQA 4WN5A 3TE8A 2W3HA 5J4EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GSV A;  4R3A A;  5HDC A;  4GS9 B;  2PR6 A;  1T1C A;  3VE4 A;  2JN7 A;  1UWP X;  4PKY A;  1Y28 A;  1N9O A;  2YKF A;  3E4Q A;  1LL8 A;  4R38 A;  5J3W A;  4JGP A;  5HD5 A;  2VV6 A;  3EWK A;  2OWJ A;  4I3I A;  1EW0 A;  3RH8 B;  2EA9 A;  1S1Y A;  3MQO A;  4I39 A;  3MXQ A;  4XT2 A;  1TS8 A;  4NXB A;  4NXE A;  1D7E A;  4LPZ A;  3HJK A;  2PD8 A;  4HOI A;  2Z6D A;  1F9I A;  4I3A A;  5HDS A;  2WKR A;  4I3J A;  4EET B;  3NOU C;  4L9F A;  4EW7 A;  5HWT A;  3E4O A;  5A8B A;  1LSV A;  3H82 A;  3F1P B;  1TS0 A;  3FG8 A;  1G28 A;  1OJG A;  1S4S A;  4H6J B;  3PHY A;  2QWS A;  2A24 A;  3F1O B;  2V0U A;  4EEU A;  1OT9 A;  1DP6 A;  3MR0 A;  4YWZ A;  1XJ2 A;  2WKP A;  3K3C A;  1VB6 A;  5TBM A;  1XFQ A;  4I5S A;  4KUK A;  2ZBB A;  4WUJ A;  4L9G A;  1V9Y A;  2V1B A;  4B9O A;  5HDD A;  1KOU A;  2ZOH A;  5F68 A;  2QJ5 A;  4LLO B;  1UGU A;  3GDI A;  3F1N B;  5HWW A;  2QJ7 A;  1LSW A;  1XJ4 A;  2V1A A;  1GSX A;  1TS6 A;  3UE6 A;  3LYX A;  1XJ6 A;  5G4Y A;  3GEC A;  1OTE A;  3FC7 A;  1P0Z A;  4XT2 B;  2JHE A;  1T19 A;  4F3L A;  3ZQ5 A;  3A0S A;  1S1Z A;  3VE3 A;  3MFX A;  2L1M A;  1DP9 A;  2KX6 A;  3A0V A;  1DRM A;  4R70 A;  3LI9 A;  3D72 A;  2INW A;  4NXF A;  5HSQ A;  3H82 B;  4GW9 A;  1S67 L;  2CMN A;  3A0R A;  2B02 A;  4HQA A;  3IS2 A;  3NOT C;  1XFN A;  1ODV A;  3BY8 A;  4HJ6 A;  4JGQ A;  1LSX A;  2D02 A;  4WF0 A;  4I38 A;  3KX0 X;  4KQD A;  4L9E A;  2QKP A;  2GJ3 A;  4M4X A;  3ICY A;  3UB9 A;  4PKY G;  3EEH A;  4HNB A;  1OTD A;  1OTB A;  5TBM B;  5DKL A;  5KIZ A;  1TS7 A;  2BAS A;  3H7W B;  2VLG A;  4BBV A;  3C2W A;  2R78 A;  2OOL A;  1NWZ A;  1OTI A;  5IU1 A;  3P7N A;  3H9W A;  4HP9 A;  5F69 A;  2P7J A;  3NOP C;  3UB7 A;  1X0O A;  4WLA A;  4EQ1 A;  1P97 A;  1T1B A;  4JGO A;  3UB6 A;  4GHI B;  1OT6 A;  3UMD A;  3K3D A;  5DKK A;  3T50 A;  4HIA A;  2I9V A;  3VOL A;  3G6O A;  5AVF A;  3BWL A;  3CWF A;  4F3L B;  3NJA A;  2V9A A;  4MN5 A;  2D01 A;  3PYP A;  2ZOI A;  2W27 A;  1JNU A;  4H6J A;  3B33 A;  4EEP A;  1LT0 A;  3UB8 A;  4KUO A;  3IS2 B;  3BY9 A;  2V0W A;  3NHQ A;  2KDK A;  1DP8 A;  4R6L A;  5DJU A;  5J7E A;  1T18 A;  3UME A;  1T1A A;  3LIA A;  2QHK A;  3LUQ A;  4HY8 A;  4WL9 A;  4BBT A;  4DJ2 A;  1V9Z A;  5HD3 A;  3C8C A;  4HJ3 A;  2VV8 A;  4GCZ A;  3CAX A;  3F1N A;  2H28 A;  2OWH A;  2A24 B;  4HP4 A;  2YKH A;  4GS9 A;  4HH3 A;  5F6A A;  3LIB A;  4NXG A;  2VEA A;  1F98 A;  4DJ3 A;  2WKQ A;  1S66 L;  1BYW A;  3LI8 A;  5IS1 A;  3E4P A;  5HZH A;  5HWV A;  5EFW A;  3LIE A;  1OTA A;  2J80 A;  4BBU A;  4HH2 A;  3MJQ A;  3LID A;  1GSW A;  4LRY C;  4E04 A;  2VV7 A;  5F5Y A;  4EXO A;  2L0W A;  4K08 A;  1OJ5 A;  4EER A;  3IBR A;  2PHY A;  4HHD A;  2PDR A;  4RQ9 A;  5AVE A;  3F1P A;  3LIF A;  4HI4 A;  2HV1 A;  3H7W A;  4LRX C;  2PYP A;  4MN6 A;  2Z6C A;  1D06 A;  3ULF A;  3F1O A;  1N9L A;  1XJ3 A;  2W0N A;  1N9N A;  3CLO A;  3LIC A;  2K7S A;  4EES A;  2M1C A;  2L4R A;  3HJI A;  1WA9 A;  1UWN X;  4HJ4 A;  3OLO A;  4LRZ E;  5DJT A;  3RTY A;  5G4Z A;  4JGR A;  5I5L A;  4GHI A;  1MZU A;  2PD7 A;  2PYR A;  1S4R A;  2PR5 A;  3SW1 A;  3MQQ A;  4WN5 A;  5J4E A; 
#chains in the Genus database with same CATH topology
 1PI4 A;  4GJ4 A;  4IVI A;  3OC2 A;  4KG2 A;  3TG9 A;  1W7F A;  1XP4 A;  1IYS A;  2PBY A;  5EPH A;  5J3W A;  3KO6 A;  1MWS A;  5HD5 A;  3BW6 A;  4KZA A;  2VV6 A;  2WZX A;  3NUL A;  3IF6 A;  4WBG A;  4OPR A;  3MBZ A;  4LGW A;  4NXB A;  4NXE A;  1D7E A;  2PD8 A;  5FQM A;  3HLC A;  1CF0 A;  4UQI S;  4HOI A;  3T4O A;  5HDS A;  4OOY A;  3KYQ A;  3MF0 A;  1XA7 A;  1ZG6 A;  3P98 A;  1H8Z A;  4PMA A;  3T12 B;  5HWT A;  3MZF A;  4GDN A;  3SS3 A;  2ZQ8 A;  2KLI A;  4ETZ A;  1PNE A;  3B47 A;  1H8M A;  4GOG A;  1TEM A;  1GCE A;  3LR4 A;  3F1P B;  1TS0 A;  3FG8 A;  2EWV A;  5D3O A;  1SDN A;  1HTZ A;  2QWS A;  3F1O B;  2V0U A;  4H8R A;  1OT9 A;  4DN0 A;  5FQJ A;  4KZ7 A;  3K3C A;  3V50 A;  2VA0 A;  4OPZ A;  1VB6 A;  5A92 A;  2LB5 A;  3A3I A;  3ZFZ A;  2WGW A;  5FQQ A;  1VM1 A;  2H0Y A;  4GZB A;  4ARZ A;  4PM6 A;  3KSI A;  4KQQ A;  2P74 A;  2ZOH A;  3T1Q B;  2QJ5 A;  3V39 A;  1UGU A;  3GDI A;  2DCF A;  4R4R A;  3MKF A;  4UA9 A;  1XJ4 A;  3DW0 A;  3N6I A;  2V1A A;  3EGD C;  4O7D A;  1JWZ A;  1TS6 A;  1K57 A;  2ZMV A;  3S7O A;  2GNX A;  1P0Z A;  4ZJ3 A;  4WEK A;  3A3E A;  4XT2 B;  2OLU A;  3FYZ A;  3A0S A;  1S1Z A;  2PBD P;  3VE3 A;  3BYD A;  2L1M A;  2XDM A;  3A0V A;  1LL9 A;  2P9V A;  4NXF A;  3ZG0 A;  5F1F A;  2WAD A;  2W1R A;  3ZHH A;  1S67 L;  2ZQ7 A;  4BD0 A;  3A0R A;  4HQA A;  4U0T A;  3R7W A;  3FKW A;  3BY8 A;  4OON A;  5DTT A;  3UN7 A;  1K25 A;  4IHQ A;  2A3U A;  2JBF A;  1ES2 A;  3HLF A;  4K0W A;  1BTL A;  2QKP A;  3IX3 A;  2XA7 S;  4CQH A;  2R9X A;  3EEH A;  3KSG A;  4Y3I A;  3P01 A;  4JLF A;  4OPY A;  1TS7 A;  3H7W B;  1IYO A;  2WKE A;  4N9K A;  4BBV A;  4EUV A;  1CI9 A;  2R78 A;  2OOL A;  1NWZ A;  3LY4 A;  3GR2 A;  1OTI A;  5IU1 A;  2G7U A;  2KOI A;  3DTE A;  1XGJ A;  4FTX A;  3C4O A;  3PBS A;  2XEP A;  5HAI A;  1NZU A;  5HL6 A;  3DWK A;  2X71 A;  5FQ9 A;  3S7Q A;  5FDS A;  1T1B A;  4JGO A;  3UDF A;  1OT6 A;  4ZRR A;  4G3W A;  3UMD A;  2EX6 A;  1QME A;  5DKK A;  3FKV A;  2Z2M B;  5FA7 A;  5JYP A;  4HIA A;  4S2O A;  3G6O A;  3CWF A;  4F3L B;  2V9A A;  4MN5 A;  2IWB A;  1RP5 A;  1JNU A;  3A3J A;  4H6J A;  2EX8 A;  5C5K A;  2EFX A;  2Y2P A;  1XA1 A;  3UB8 A;  1E25 A;  3IWI A;  4KUO A;  3IF6 B;  2GDN A;  3IS2 B;  1ES5 A;  3OPR A;  1PYY A;  2JKT I;  2KDK A;  2M7V A;  1YMX A;  1KGF A;  4CLC E;  1Y4O A;  4LCM A;  1SHV A;  2WAF A;  2EX2 A;  3IT9 A;  3Q7V A;  4BEN A;  1NRJ A;  3TW8 A;  2BLS A;  2UWX A;  3QP1 A;  2VV8 A;  5CGS A;  5F1G A;  4KQR A;  2H28 A;  4DE2 A;  4NET A;  2OWH A;  3G34 A;  1TF1 A;  4E3L A;  3E98 A;  4HP4 A;  5EVI C;  2YKH A;  4WZ5 A;  3VP2 A;  1K4F A;  5EM0 A;  4MMN A;  3T4K A;  5CEC A;  2E8J A;  3IQA A;  4NXG A;  3CUE A;  1RCJ A;  2Z2L B;  5AJG A;  5HWV A;  2G2W A;  4OKP A;  4ARZ B;  4HH2 A;  4U3T A;  4JXG A;  4LFU A;  2Q9M A;  4KEN B;  4JF4 A;  3N8S A;  4E04 A;  2ZLY A;  3VSL A;  4QHC A;  2HDU A;  1YSQ A;  4ZBE A;  3G31 A;  3Q82 A;  2L0W A;  5AQB A;  5IT5 A;  1F2K A;  3LR0 A;  1OJ5 A;  4EER A;  4GB7 A;  2Y2J A;  1KVL A;  3W4Q A;  1YLJ A;  3JYI A;  4RQ9 A;  3G32 A;  5AVE A;  1G6A A;  3F1P A;  3UPP A;  4ZDX A;  2XSS A;  3N8L A;  1HVB A;  2ACG A;  4FOF A;  5KMW A;  4EBL A;  2PT7 A;  1FR6 A;  3VSK A;  2P9V B;  4RX2 A;  1E4D A;  3F1O A;  5L8M A;  4EES A;  3R7W B;  3IX8 A;  3U2A A;  2K2N A;  4O8G A;  4E3O A;  3NBL A;  3HLB A;  5FI2 A;  1YPR A;  4QY5 A;  4LRZ E;  5DJT A;  3BEB A;  2Y2L A;  3IHB A;  4JGR A;  5I5L A;  4OPQ A;  5E2G A;  5HAP A;  2FFY A;  3TE8 A;  4FCF A;  5CED A;  1GSV A;  5HDC A;  1O07 A;  3VE4 A;  3TSG A;  1K6R A;  1PW8 A;  1Y28 A;  3FV7 A;  3T4J A;  4OOL A;  1YLZ A;  2HGV A;  5HAR A;  4EBP A;  4R1G A;  3T1S A;  4FUW A;  2OWJ A;  5GL9 A;  4I3I A;  3WS2 A;  3RH8 B;  2EA9 A;  3MQO A;  3MXQ A;  4XT2 A;  4UA7 A;  3UNW A;  4Y5F A;  2K31 A;  4XUZ A;  5DFY A;  2V2F F;  3NCK A;  4I3A A;  1F9I A;  2VX8 A;  5EVE A;  1K57 C;  4I3J A;  4EET B;  5DF7 A;  2O9B A;  3VP0 A;  1K55 A;  3R4K A;  4E3K A;  3M2J A;  1W8Q A;  2HJ9 C;  5A8B A;  2V20 A;  3ZG8 B;  2J9P A;  4Q0H A;  2VZW A;  5CHJ A;  4G3K A;  3SS4 A;  5M18 A;  3ZG5 A;  3DTI A;  3FWL A;  3G4P A;  1G28 A;  1OJG A;  4YFM A;  4Y2F A;  4H6J B;  3PHY A;  4WZ4 A;  3PTE A;  4Y13 A;  3NDE A;  3HUN A;  5I94 A;  2FFF B;  3Q1F A;  1YLY A;  1E3U A;  5E2F A;  4E3N A;  1XGI A;  1SZV A;  5K5B A;  5FAO A;  4YWZ A;  3BFE A;  1XJ2 A;  4GLQ A;  2P08 A;  4KZ8 A;  1KE0 A;  1WYB A;  2G2U A;  1XFQ A;  4JBF A;  4KUK A;  2ZBB A;  4WUJ A;  3Q7V B;  4L9G A;  4CLC B;  3VMA A;  5U47 A;  5LBR A;  3VFF A;  1DJB A;  3PBO A;  5DTK A;  3SZT A;  4UHU A;  1LI0 A;  4B9O A;  1KE3 A;  1KOU A;  2Y2I A;  1NYY A;  2XF3 A;  4JPM A;  1JWP A;  5HWW A;  3HBR A;  5L10 A;  5FQK A;  3UE6 A;  5DFX A;  4GD8 A;  3CMZ A;  1K56 A;  4OQG A;  4O0P A;  1K54 C;  3CIT A;  2J7V A;  4F3L A;  2Q0O A;  2VGJ A;  4X56 A;  2V8F A;  5EUA A;  2KX6 A;  2HZ5 A;  1LLB A;  3PR6 A;  4E3J A;  3OOV A;  1DRM A;  4R70 A;  3U4L P;  4DE1 A;  2DRW A;  1IEL A;  2O9A A;  3D72 A;  4ZTK A;  4GW9 A;  2B02 A;  3QP4 A;  3PAG A;  3IS2 A;  3NOT C;  4JKT A;  1XFN A;  5JYO A;  4HJ6 A;  1KDS A;  2HPB A;  1W8Y A;  3ZGA B;  5F82 A;  4I38 A;  3KX0 X;  4L9E A;  1VEU A;  2EWW A;  3IBJ A;  3IWO A;  3BFD A;  3UB9 A;  3BLS A;  4JF6 A;  3MXS A;  4KZ3 A;  4BD1 A;  5M1A A;  3HLE A;  5CTN A;  2BAS A;  4X68 A;  3C2W A;  5E2H A;  3ZG9 B;  2ZC7 A;  3H9W A;  4B4Z A;  5DF9 A;  5KSH A;  4YNR A;  4RA7 A;  1SDE A;  4CLC D;  2P7J A;  3PBN A;  1SCW A;  1FOF A;  4WEL A;  3TOI A;  4S2N A;  2ZQC A;  5FDH A;  3MXR A;  4EQ1 A;  4P6Z M;  4QWO A;  4Q0J A;  2WK0 A;  3L9K A;  3UB6 A;  3ZCZ A;  3BRM A;  3K3D A;  2P04 A;  3OCN A;  1XPB A;  2I9V A;  2JKF A;  3VOL A;  3BWL A;  1GHM A;  3CUE C;  5CGW A;  1PWC A;  4QU3 A;  2ZOI A;  2V1Z A;  1A0K A;  2Y2M A;  4GD6 A;  1LHY A;  3ZDJ A;  3N8R A;  4S2P A;  5CTM A;  3SH7 A;  5EM1 A;  1Y54 A;  4BMW A;  1CEG A;  2V0W A;  5GLC A;  3SS5 A;  1DP8 A;  4R6L A;  3UME A;  4R4S A;  4IUH A;  1O7E A;  3D9Y A;  4Y0T A;  2WAE A;  1H5X A;  2QHK A;  4P87 A;  3UE1 A;  1Q2Q A;  4JF5 A;  3LUQ A;  3RXW A;  3A3F A;  3NDG A;  3C8C A;  4Y7P A;  4HJ3 A;  5L2F A;  1IYQ A;  1JWV A;  3FPV A;  2IA2 A;  1ESU A;  1C3B A;  3CAX A;  3F1N A;  3PBR A;  5A93 A;  2ZQD A;  4R3B A;  1SKF A;  3S1Y A;  3W2Z A;  2PU2 A;  4BLM A;  2E8I A;  2XR0 A;  3SH8 A;  2NUT C;  3LIB A;  3IXH A;  3WS4 A;  1W63 Q;  1OME A;  4DJ3 A;  3UDI A;  3IXB A;  5HZH A;  2Y8H A;  1TD5 A;  1QMF A;  2ZC3 B;  1ZTU A;  3MJQ A;  2VK3 A;  1NLY A;  2LB9 A;  3LID A;  4KZ9 A;  1L0G A;  1GSW A;  1PZO A;  4BJP A;  2VV7 A;  5F5Y A;  1FQG A;  2RL3 A;  4X53 A;  1PWG A;  4LV2 A;  2PDR A;  2EXA A;  2OAQ 1;  3T4Q A;  5BOH A;  3S7N A;  5EE8 A;  3IX4 A;  1Q2P A;  5CXW A;  4MCW A;  4HI4 A;  3QHY A;  2HV1 A;  5GHZ A;  1K55 C;  2QZ6 A;  1S6R A;  3JVU A;  4N92 A;  1EWZ A;  4FH4 A;  3VFH A;  5HFO A;  4WEJ A;  1NYM A;  4KZ4 A;  3ULF A;  1KGG A;  2ZL1 B;  3MFD A;  3PBQ A;  4X1M A;  3M6H A;  2WZZ A;  3LIC A;  2K7S A;  2Y2K A;  5E2E A;  5HX9 A;  4JXW A;  2R9W A;  4A5R A;  1YM1 A;  1ERQ A;  1WA9 A;  1UWN X;  4Z1W A;  4BQM A;  3CPT B;  3T4S A;  1NXY A;  4GN2 A;  3S4X A;  2OAP 1;  4MEZ A;  3LEZ A;  1MZU A;  1VEU B;  2XH9 A;  1ES3 A;  4X25 A;  4MBK A;  4S2I A;  4CLC A;  3DAV A;  3MQQ A;  4WN5 A;  3UY6 A;  1E3U D;  2JCH A;  1N9B A;  3GQZ A;  1T1C A;  4NEE D;  4X69 A;  1MKM A;  2Y2N A;  3GTC A;  4PKY A;  2HDS A;  4MBH A;  4EQI A;  1N9O A;  3M2K A;  2HP6 A;  4R38 A;  5MC7 A;  3DBA A;  3A3D A;  4PPR A;  1J3W A;  3P09 A;  3NC8 A;  4JGP A;  2XGN A;  4EV4 A;  1BLP A;  1IEM A;  3T4L A;  3EWK A;  1FCN A;  3E2L A;  2O99 A;  1EW0 A;  4Q0I A;  1YT4 A;  1I2W A;  1S1Y A;  4I39 A;  1BLH A;  1MWT A;  4S2L A;  4LEN A;  3HJK A;  3W8K A;  3KYE A;  2WKR A;  4DXB A;  2EFU A;  4L9F A;  4HBU A;  2Y79 A;  3E4O A;  4B93 A;  5FI7 A;  4ZJ2 A;  5CEB A;  1VHM A;  4LCL A;  1K56 D;  4RYE A;  2PU4 A;  3WRT A;  3HL9 A;  3PXP A;  4KG6 A;  2A24 A;  2OV5 A;  4FSF A;  1STZ A;  1YLT A;  2WGI A;  3EQU A;  3IF6 C;  4NKP A;  2ZQ9 A;  2Y2H A;  2DNS A;  3PBT A;  4IUK A;  5L09 A;  1ERO A;  3C7U A;  4UEY A;  3LR5 A;  1NRF A;  3SOI A;  3MR0 A;  4E3M A;  3VP4 A;  1PFL A;  2ZC4 B;  4P0M A;  4C3Q A;  4UAA A;  2H10 A;  4EUZ A;  4EWF A;  3ITA A;  2FZ0 A;  2UV0 E;  1V9Y A;  2V1B A;  3LGO A;  5EEC A;  5HDD A;  5F68 A;  2HP9 A;  2JE5 A;  4MBF A;  4P6B A;  4LLO B;  3F1N B;  1P9R A;  3ITB A;  5GHY A;  1MWU A;  3C7V A;  4DXC A;  3TRC A;  2A49 A;  4OLD A;  3N7W A;  3MMH A;  3JPU A;  1OTE A;  3FC7 A;  2W1T A;  3UPO A;  1SKO A;  1T19 A;  3GVB A;  4C75 A;  3ZQ5 A;  2CC1 A;  1DP9 A;  3ZG7 B;  1GHP A;  3Q7Z A;  2IWC A;  1ESI A;  3B3X A;  5TGF A;  3LI9 A;  1ALQ A;  5DVA A;  2INW A;  3UE0 A;  3MSH A;  5HSQ A;  3H82 B;  2CMN A;  3RJU A;  1OPX A;  1ERM A;  1G6O A;  4N1X A;  4Y15 A;  3N4I A;  1PW1 A;  1ODV A;  4PHT A;  1LI9 A;  2Y2G A;  3DWZ A;  1FCM A;  2WKI A;  3GV9 A;  4OLG A;  2PAV P;  2D02 A;  3GRJ A;  2XK1 A;  2J3T D;  1L0F A;  2HP5 A;  5FAQ A;  4KQD A;  5AQA A;  1CEF A;  4XUX A;  4C6Y A;  2XLN A;  2J8Y A;  2GJ3 A;  1G5U A;  4GKU A;  4PKY G;  1FSY A;  2ZM2 A;  1H8Y A;  3I7J A;  5CGX A;  1OTD A;  2C6W B;  1K6S A;  1FIK A;  1FIL A;  5TBM B;  4DMZ A;  3CJM A;  3QP8 A;  5KIZ A;  5EOO A;  3C4P A;  1EI5 A;  2WKH A;  2VLG A;  1ACF A;  1VET B;  2HDR A;  4HP9 A;  5F69 A;  3CZD A;  2EX9 A;  3S7P A;  1H0M A;  3OPL A;  3UB7 A;  4HEF A;  2MJ6 A;  1HD8 A;  4K91 A;  3O88 A;  3IWQ A;  1FSW A;  3EOI A;  3G30 A;  2VGL M;  4N9L A;  3Q81 A;  2QPN A;  1FR1 A;  5AVF A;  5CX7 A;  4Z9Q A;  3ISG A;  1D1J A;  3T1R A;  3PYP A;  4DF6 A;  2W27 A;  5G18 A;  1BT5 A;  3ZVW A;  4U0X A;  5CER A;  1LT0 A;  3BJN A;  3L7H A;  3GSG A;  4WMC A;  3BFC A;  1AWI A;  1ONG A;  4Q8I A;  4F94 A;  1LL5 A;  3B42 A;  1YQS A;  1BUE A;  5DJU A;  1JVJ A;  1T18 A;  3K2N A;  3C30 A;  1T1A A;  4QY6 A;  4BWI A;  2W3E A;  4OQH A;  4JXV A;  2DMW A;  1ZKJ A;  3M6B A;  4WL9 A;  4BBT A;  3WS0 A;  1V9Z A;  4Y17 A;  2BTF P;  3IH9 A;  2ZL1 A;  4D2O A;  5F83 A;  3LCE A;  1GA0 A;  4KZB A;  4X55 A;  3BFF A;  2ZM8 A;  1M6K A;  2XQZ A;  3CPT A;  3MKE A;  2A24 B;  4UQI M;  1P9W A;  2VKS A;  4X6T A;  3OCL A;  5TJJ A;  4O01 A;  3DTM A;  3RXX A;  1Z09 A;  3LFV A;  4QJG A;  5F6A A;  4OP8 A;  3IF5 A;  5CRF A;  5KZH A;  1F98 A;  1S66 L;  1BYW A;  5DTS A;  4CLC C;  5IS1 A;  3HRE A;  5EFW A;  3UPN A;  4PM5 A;  2Y59 A;  1MWR A;  1MXO A;  2J9O A;  3HLD A;  3EGX C;  3W4O A;  1MY8 A;  4BL3 A;  4LRY C;  5CHM A;  3FPW A;  4EXO A;  4JXS A;  1BUL A;  1IOU A;  4WZ5 C;  1PI5 A;  4B88 A;  4NK3 A;  2PHY A;  4HHD A;  3QP5 A;  2W1T B;  3BFG A;  3PAE A;  1SKO B;  4RX3 A;  4P6Z S;  3IXG A;  3OPP A;  2ZC6 B;  3LIF A;  3AGF A;  5FEF A;  2JKG A;  2PYP A;  2XFT A;  4MN6 A;  3LEQ A;  4Y0U A;  1D06 A;  1XXM A;  2C5W B;  5FEG A;  5TFQ A;  1XJ3 A;  1N9N A;  3CLO A;  4ZAM A;  2B5R A;  3LY3 A;  4LV1 A;  3KSF A;  2L4R A;  1YSP A;  2XRO A;  1L3L A;  3IH8 A;  2HDQ A;  4E6W A;  4KQO A;  1ZC2 A;  3TJZ C;  4HJ4 A;  3O5Y A;  3HUM A;  3RTY A;  4GHI A;  4S2K A;  3DTK A;  2PYR A;  1IKI A;  1S4R A;  2PR5 A;  4KG5 A;  2W3H A;  4MN7 A;  3MZE A;  4R3A A;  2JC7 A;  4GS9 B;  2PR6 A;  3D3O A;  2JN7 A;  1UWP X;  3O86 A;  4CPK A;  4L0L A;  2YKF A;  2HJE A;  5FL3 A;  3E4Q A;  3CG5 A;  1LL8 A;  4KZ6 A;  3ZYT A;  3W4P A;  3NI9 A;  1IYP A;  2W3D A;  2JKR M;  3NIA A;  3BLM A;  5EV0 A;  2XA7 M;  5HAQ A;  4NG2 A;  5FAS A;  1TS8 A;  4LPZ A;  2AVX A;  2Z6D A;  4RVA A;  2NUP C;  3C5A A;  2W3G A;  4DDY A;  2IWD A;  3NOU C;  3GMW A;  1BLC A;  4EW7 A;  4G3V A;  1LSV A;  3H82 A;  3G35 A;  3BQA A;  2B95 A;  4D60 A;  4P85 A;  4PM8 A;  4MNR A;  2Y55 A;  3NEC A;  1S4S A;  3QNC A;  5EOE A;  1L2S A;  2O0Y A;  3NY4 A;  2VGK A;  4EEU A;  5EVI B;  5AQ7 A;  1DP6 A;  3MQ0 A;  1K54 A;  3MS6 A;  2WKP A;  4HES A;  5TBM A;  1ZHH B;  4E6X A;  4I5S A;  1VET A;  1FCO A;  1HLU P;  3BEC A;  3WS1 A;  2VJW A;  1DJA A;  2ZMA A;  3KYZ A;  4IBX A;  5IHV A;  1MBL A;  4M3K A;  3UO9 A;  1YAX A;  2QJ7 A;  1LSW A;  4MLL A;  3FZC A;  2XD5 A;  1GSX A;  3LYX A;  3ZVT A;  1XJ6 A;  1N4O A;  2I72 A;  1S0W A;  3EQV A;  5G4Y A;  5GLB A;  1VQQ A;  4OH0 A;  3GEC A;  1NZO A;  2Y2Q A;  3OBF A;  4DE0 A;  5FQI A;  2B18 A;  2JHE A;  1YMS A;  1K0K A;  2HF6 A;  3MFX A;  1KGE A;  3QNB A;  4E3I A;  3Q07 A;  3VP3 A;  2M7U A;  4OP5 A;  2J3W A;  1GHI A;  4YOF A;  1I5Q A;  3V67 A;  5FAT A;  3HCY A;  3IHA A;  5HW3 A;  4YIN A;  5J8X A;  3T4T A;  1TDG A;  2ZMF A;  2XD1 A;  3JVV A;  1NY0 A;  4R3J A;  1L0E A;  4JGQ A;  3UE3 A;  1LSX A;  4CJN A;  4WF0 A;  4ETX A;  2QMI A;  1MPL A;  3O3V A;  5EVL A;  2Y2O A;  5AQ9 A;  1G68 A;  4M4X A;  4QPR A;  3ICY A;  4IED A;  2X01 A;  4WMC D;  4XXR A;  2GZA A;  1J9M A;  1KE4 A;  4DRT A;  4HNB A;  1XX2 A;  1OTB A;  5EVI D;  5GHX A;  4X1L A;  5DKL A;  5GLD A;  3QP6 A;  1DY6 A;  2WGW B;  2Y91 A;  4R0Q A;  3AGE A;  3P7N A;  3O87 A;  3C38 A;  4ZJ1 A;  2WYX A;  1XKZ A;  2BG1 A;  4LV0 A;  5GLA A;  1IFQ A;  2XRN A;  3S22 A;  3NOP C;  1PRQ A;  1DJC A;  4OVD A;  1CJF A;  3CHW P;  1PWD A;  1X0O A;  3HVF A;  3V3S A;  4GDB A;  1F5M A;  4WLA A;  1YLW A;  2RCX A;  5HPI A;  4BL2 A;  1P97 A;  3LO7 A;  3VOZ A;  4GHI B;  4WM9 A;  3KSH A;  1JTG A;  2ZQA A;  3AGD A;  3T50 A;  1ZG4 A;  1MKI A;  1PIO A;  4FH2 A;  1HZO A;  5A90 A;  1NLZ A;  4ID4 A;  3VOY A;  3NJA A;  2Q9N A;  3E0Y A;  1L0D A;  2D01 A;  2QYB A;  1I2S A;  4Y0O A;  5KSC A;  3WWX A;  2WGV A;  4ESP A;  2ZM0 A;  1IKG A;  3B33 A;  4EEP A;  3ZNT A;  2ZD8 A;  3EEA A;  1BZA A;  4WYY A;  4MDZ A;  3VV4 A;  2PRF A;  3OPH A;  3CI6 A;  3BY9 A;  4S2N C;  1CK3 A;  3NHQ A;  5J7E A;  2EXB A;  3RFB A;  3HLG A;  1YLP A;  3LIA A;  1H3Q A;  1Z6F A;  1WYC A;  2XFS A;  3ZNY A;  1U60 A;  3BQ8 A;  4HY8 A;  4DJ2 A;  1AXB A;  5HD3 A;  4QD4 A;  4KZ5 A;  5TR7 A;  3VP1 A;  4FD8 A;  2J3T C;  4S2J A;  5M19 A;  3HUO A;  2JKR I;  4IVK A;  4GCZ A;  3V3R A;  4IBR A;  4DDS A;  1MC0 A;  4PM9 A;  3LR3 A;  5A91 A;  4N1H A;  2WUQ A;  1K4E A;  4HBT A;  4PAU A;  3UB5 P;  1PZP A;  3BM6 A;  3V5M A;  2O9C A;  1TDL A;  1BSG A;  3D4F A;  4K0X A;  1TVF A;  4GS9 A;  4HH3 A;  3HLW A;  1BLS A;  4B4X A;  3QP2 A;  2VEA A;  4GNU A;  5HL1 A;  4II7 A;  4IJG A;  2GX5 A;  2WKQ A;  3MZD A;  3LI8 A;  3E4P A;  2OSU A;  4ME4 A;  4OOM A;  3LIE A;  1OTA A;  2J80 A;  4BBU A;  4R23 A;  1W63 M;  2ZC5 B;  4EU0 A;  2H5S A;  4S2M A;  2H0T A;  2FH5 A;  2Y4A A;  1ES4 A;  1KVM A;  5L07 A;  1NJ4 A;  2V8C A;  4QB8 A;  1GA9 A;  5CHU A;  2OLV A;  3IXD A;  5HPF A;  4K08 A;  1KDW A;  1JTD A;  3IBR A;  3OZH A;  5DF8 A;  4EBN A;  3E2K A;  5FSR A;  2X02 A;  5E43 A;  3WS5 A;  1K38 A;  1M40 A;  1CI8 A;  4OQI A;  3H7W A;  1ONH A;  4LRX C;  3G2Y A;  2Z6C A;  2VGL S;  1RGY A;  5FI6 A;  4AFI A;  4PM7 A;  1N9L A;  2W0N A;  5EVI A;  1W5D A;  2A2L A;  2M1C A;  5FAP A;  4LV3 A;  4DKI A;  4UA6 A;  1YKD A;  2ZJ9 A;  3HJI A;  3SH9 A;  1WE4 A;  1W79 A;  3OLO A;  3WRZ A;  2W3F A;  3G2Z A;  1RGZ A;  5G4Z A;  1CQA A;  2PD7 A;  2JKT M;  3T1X A;  3SW1 A;  4OQ0 A;  3UDX A;  4DE3 A;  5J4E A; 
#chains in the Genus database with same CATH homology
 1GSV A;  4MN7 A;  4R3A A;  5HDC A;  4GJ4 A;  4GS9 B;  2PR6 A;  1T1C A;  3OC2 A;  3VE4 A;  3D3O A;  2JN7 A;  1UWP X;  4NEE D;  1MKM A;  4PKY A;  1Y28 A;  3T4J A;  1N9O A;  4OOL A;  4L0L A;  2YKF A;  2HJE A;  5FL3 A;  3E4Q A;  1LL8 A;  4R38 A;  5MC7 A;  5J3W A;  3KO6 A;  2HGV A;  3DBA A;  3ZYT A;  4JGP A;  2W3D A;  5HD5 A;  3BW6 A;  2VV6 A;  3T4L A;  2JKR M;  3EWK A;  2OWJ A;  2O99 A;  4I3I A;  1EW0 A;  3RH8 B;  2XA7 M;  4Q0I A;  2EA9 A;  1S1Y A;  3MQO A;  4I39 A;  3MXQ A;  4XT2 A;  1TS8 A;  4NXB A;  4NXE A;  4Y5F A;  1D7E A;  4LPZ A;  3HJK A;  2PD8 A;  2K31 A;  5DFY A;  4UQI S;  4HOI A;  2Z6D A;  1F9I A;  2VX8 A;  4I3A A;  5HDS A;  2NUP C;  3T4O A;  2W3G A;  2WKR A;  4I3J A;  4EET B;  2O9B A;  3KYQ A;  3MF0 A;  3NOU C;  4L9F A;  3R4K A;  4EW7 A;  2Y79 A;  5HWT A;  3E4O A;  4G3V A;  2HJ9 C;  1LSV A;  3H82 A;  5A8B A;  2KLI A;  4B93 A;  4ETZ A;  3BQA A;  3B47 A;  1H8M A;  4Q0H A;  2VZW A;  4G3K A;  3LR4 A;  1VHM A;  3F1P B;  1TS0 A;  3FG8 A;  2EWV A;  1G28 A;  1OJG A;  4Y2F A;  1S4S A;  4H6J B;  3PHY A;  2O0Y A;  2QWS A;  3PXP A;  2A24 A;  3F1O B;  4FSF A;  1STZ A;  3EQU A;  4NKP A;  2V0U A;  4EEU A;  3PBT A;  1OT9 A;  4IUK A;  4DN0 A;  5K5B A;  4UEY A;  3LR5 A;  1DP6 A;  3MQ0 A;  3MR0 A;  4YWZ A;  1XJ2 A;  4GLQ A;  2WKP A;  3K3C A;  2VA0 A;  2P08 A;  1VB6 A;  5TBM A;  1ZHH B;  1XFQ A;  2LB5 A;  4I5S A;  4KUK A;  2ZBB A;  4WUJ A;  4L9G A;  4CLC B;  5LBR A;  2FZ0 A;  3PBO A;  1V9Y A;  4ARZ A;  2V1B A;  2VJW A;  4B9O A;  3KSI A;  5HDD A;  1KOU A;  2ZOH A;  3KYZ A;  5F68 A;  2QJ5 A;  4LLO B;  1UGU A;  3GDI A;  3F1N B;  1P9R A;  5HWW A;  1YAX A;  2QJ7 A;  1LSW A;  1XJ4 A;  3TRC A;  2V1A A;  3EGD C;  1GSX A;  1TS6 A;  3UE6 A;  3LYX A;  5DFX A;  1XJ6 A;  2ZMV A;  3EQV A;  3MMH A;  5G4Y A;  3S7O A;  3GEC A;  1OTE A;  2GNX A;  3FC7 A;  3OBF A;  1P0Z A;  4O0P A;  2W1T A;  4WEK A;  2B18 A;  3CIT A;  4XT2 B;  2JHE A;  1T19 A;  4F3L A;  3ZQ5 A;  3A0S A;  1S1Z A;  2HF6 A;  3VE3 A;  3MFX A;  2L1M A;  1DP9 A;  2KX6 A;  3PR6 A;  3A0V A;  2M7U A;  3OOV A;  1DRM A;  4R70 A;  3LI9 A;  2J3W A;  4YOF A;  2O9A A;  3D72 A;  2INW A;  3V67 A;  4NXF A;  5HSQ A;  3HCY A;  2W1R A;  3H82 B;  4GW9 A;  1S67 L;  2CMN A;  3A0R A;  3T4T A;  2B02 A;  4HQA A;  2ZMF A;  3IS2 A;  3NOT C;  1OPX A;  1G6O A;  3R7W A;  1XFN A;  3JVV A;  1ODV A;  3BY8 A;  4PHT A;  4HJ6 A;  4IHQ A;  4JGQ A;  3UE3 A;  1LSX A;  2D02 A;  2J3T D;  4WF0 A;  4I38 A;  4ETX A;  3KX0 X;  4KQD A;  4L9E A;  2EWW A;  2QKP A;  3IBJ A;  2XA7 S;  4CQH A;  2GJ3 A;  4M4X A;  4QPR A;  3ICY A;  3UB9 A;  4PKY G;  2GZA A;  3EEH A;  4HNB A;  3KSG A;  4Y3I A;  1OTD A;  1OTB A;  3P01 A;  5TBM B;  4DMZ A;  5DKL A;  5KIZ A;  1TS7 A;  2BAS A;  3H7W B;  2VLG A;  4BBV A;  4EUV A;  3C2W A;  2R78 A;  2OOL A;  1NWZ A;  1OTI A;  5IU1 A;  2G7U A;  3P7N A;  3H9W A;  5DF9 A;  4HP9 A;  3C38 A;  2KOI A;  5F69 A;  5KSH A;  4YNR A;  3S7P A;  1IFQ A;  4CLC D;  2XRN A;  2P7J A;  3PBN A;  3NOP C;  3UB7 A;  4WEL A;  3PBS A;  1X0O A;  5HL6 A;  2MJ6 A;  1F5M A;  4WLA A;  4EQ1 A;  4P6Z M;  3S7Q A;  5HPI A;  4Q0J A;  1P97 A;  1T1B A;  4JGO A;  3UB6 A;  4GHI B;  1OT6 A;  4ZRR A;  3KSH A;  4G3W A;  3UMD A;  3EOI A;  3K3D A;  2P04 A;  5DKK A;  3T50 A;  2VGL M;  3OCN A;  4HIA A;  2I9V A;  1NLZ A;  3VOL A;  3G6O A;  5AVF A;  3BWL A;  5CX7 A;  3CWF A;  4F3L B;  3NJA A;  3CUE C;  2V9A A;  4MN5 A;  3E0Y A;  2D01 A;  2QYB A;  3PYP A;  2ZOI A;  2W27 A;  1JNU A;  4H6J A;  3B33 A;  4EEP A;  1LT0 A;  5C5K A;  3BJN A;  3EEA A;  3UB8 A;  4MDZ A;  3VV4 A;  4KUO A;  3B42 A;  3CI6 A;  3IS2 B;  4BMW A;  3BY9 A;  2V0W A;  2JKT I;  3NHQ A;  2KDK A;  2M7V A;  1DP8 A;  4R6L A;  5DJU A;  5J7E A;  3K2N A;  1T18 A;  3UME A;  3RFB A;  3C30 A;  4IUH A;  4CLC E;  1T1A A;  3LIA A;  4BWI A;  2W3E A;  1H3Q A;  2QHK A;  2DMW A;  3LUQ A;  3BQ8 A;  4HY8 A;  4WL9 A;  4BBT A;  4DJ2 A;  1V9Z A;  5HD3 A;  3C8C A;  1NRJ A;  4HJ3 A;  3TW8 A;  2J3T C;  3FPV A;  2JKR I;  2IA2 A;  2VV8 A;  4GCZ A;  3CAX A;  3F1N A;  1MC0 A;  3LR3 A;  2H28 A;  3PBR A;  2OWH A;  1TF1 A;  2A24 B;  3E98 A;  4UQI M;  4PAU A;  1P9W A;  2VKS A;  3W2Z A;  4HP4 A;  3OCL A;  2YKH A;  5TJJ A;  2O9C A;  4O01 A;  4MMN A;  3T4K A;  3LFV A;  2NUT C;  4GS9 A;  4HH3 A;  5F6A A;  3LIB A;  4NXG A;  2VEA A;  3CUE A;  1F98 A;  1W63 Q;  4DJ3 A;  4II7 A;  4IJG A;  2GX5 A;  1S66 L;  1BYW A;  2WKQ A;  5AJG A;  3LI8 A;  4CLC C;  5IS1 A;  3E4P A;  4OOM A;  4ME4 A;  5HZH A;  5HWV A;  5EFW A;  3LIE A;  1OTA A;  2J80 A;  2Y8H A;  4BBU A;  1W63 M;  4EU0 A;  4ARZ B;  1TD5 A;  4HH2 A;  1ZTU A;  2FH5 A;  3MJQ A;  3EGX C;  1NLY A;  2LB9 A;  3LID A;  1GSW A;  4BJP A;  4LRY C;  4E04 A;  2VV7 A;  3FPW A;  5F5Y A;  4EXO A;  1YSQ A;  1IOU A;  5HPF A;  2L0W A;  4K08 A;  5IT5 A;  3LR0 A;  1OJ5 A;  4EER A;  3IBR A;  2PHY A;  4HHD A;  2PDR A;  2OAQ 1;  2W1T B;  3T4Q A;  4P6Z S;  3S7N A;  4RQ9 A;  5AVE A;  3F1P A;  3LIF A;  4MCW A;  2XSS A;  4HI4 A;  2HV1 A;  3H7W A;  4FOF A;  3JVU A;  4LRX C;  2PT7 A;  2PYP A;  4MN6 A;  2Z6C A;  2VGL S;  4WEJ A;  1D06 A;  3ULF A;  3F1O A;  4AFI A;  1N9L A;  1XJ3 A;  2W0N A;  1N9N A;  3PBQ A;  3CLO A;  5L8M A;  3LIC A;  2K7S A;  4EES A;  2A2L A;  2M1C A;  3R7W B;  3KSF A;  2L4R A;  1YSP A;  2XRO A;  1YKD A;  3HJI A;  3U2A A;  2K2N A;  4KQO A;  4O8G A;  3TJZ C;  1WA9 A;  1UWN X;  4HJ4 A;  4Z1W A;  3OLO A;  3T4S A;  3O5Y A;  2W3F A;  4LRZ E;  5DJT A;  3RTY A;  5G4Z A;  2OAP 1;  4JGR A;  5I5L A;  4GHI A;  1MZU A;  2PD7 A;  2JKT M;  2PYR A;  1S4R A;  2PR5 A;  4CLC A;  3SW1 A;  3MQQ A;  4WN5 A;  3TE8 A;  2W3H A;  5J4E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...