5G18A

Direct observation of active-site protonation states in a class a beta lactamase with a monobactam substrate
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
261
structure length
261
Chain Sequence
NSVQQQLEALEKSSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTAPTLNTAIPGDPRDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQPEQKAENRNDILAAAAKIVTHGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-LACTAMASE CTX-M-97
publication title Active-Site Protonation States in an Acyl-Enzyme Intermediate of a Class A beta-Lactamase with a Monobactam Substrate.
pubmed doi rcsb
source organism Escherichia coli
total genus 88
structure length 261
sequence length 261
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2016-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5g18A00
2ZQ9A 4JXVA 2FFYA 5EVIA 1KGEA 2WKHA 5EECA 3M6BA 3DTMA 3PBSA 4WM9A 3P09A 3W8KA 2XQZA 4R4RA 3DWKA 1K56D 3IXDA 5EVLA 3ITBA 2ZQDA 1L0EA 3BFDA 3C7UA 3C4PA 4QY5A 5DF7A 1YLZA 5GHYA 3V5MA 4LV0A 4OOLA 2IWDA 5DF8A 5CEBA 1HZOA 3UE1A 5JYPA 3VFHA 1PZOA 4R3BA 3S22A 3N7WA 1E25A 3WRTA 1ERMA 1L0DA 1PW1A 2ZC5B 1U60A 2ZD8A 4FCFA 5FI6A 1GCEA 2WKEA 4ZBEA 1BLCA 4GD6A 2QZ6A 4U0TA 3G31A 2WZXA 1CI9A 4OLGA 5CGSA 5EVID 3IF6C 3O88A 4Q8IA 1PI5A 2Y91A 1DJAA 4S2OA 4EV4A 3VP2A 3M2JA 2EX6A 4DDSA 4R23A 3VP4A 3WRZA 3LO7A 3VMAA 1ES3A 2R9WA 3HREA 3IF5A 3C4OA 1ES4A 2Y2GA 1JWVA 2V1ZA 2WGVA 3SS5A 4EBNA 5E2HA 4NETA 4KG5A 3Q1FA 1I5QA 4E3IA 1BSGA 3V3RA 2Q9NA 3MKEA 4MLLA 1O7EA 5F83A 4EUZA 1FR6A 1FSWA 1TDGA 5CECA 5FASA 4JLFA 4JXGA 1WYCA 2EX9A 1LL5A 1PWGA 4JF6A 3ZFZA 2H0YA 1G6AA 4EQIA 1DY6A 1ES5A 3IQAA 5EOOA 1K54A 3PBOA 5AQAA 4E3MA 4R4SA 4N9KA 3V3SA 3WS0A 2HP9A 5CGXA 3CJMA 1BT5A 1DJCA 3ZDJA 4B4ZA 3HLGA 4GKUA 4OPRA 5A92A 4QB8A 2WYXA 3HUNA 2J7VA 2HDRA 3BRMA 2J9PA 1E4DA 5GL9A 1M40A 3OPLA 2ZJ9A 3OPHA 1YQSA 5FI2A 5FQMA 1FQGA 3GR2A 5GLCA 4PM5A 3SH8A 5J8XA 4KZBA 4LCMA 4KG6A 4BD1A 1L0GA 4P85A 2BLSA 1MY8A 4JF4A 3GV9A 4P6BA 3FKVA 5CHUA 3FYZA 5U47A 4KQRA 4OH0A 4LV2A 5GLDA 2OSUA 2PU2A 1ESIA 4FD8A 4OPQA 4RA7A 1TVFA 5CHJA 3ZNYA 3RXWA 3UDXA 3G2YA 3G30A 2P9VA 4GNUA 5TGFA 2VGJA 1GHMA 3FKWA 3N8RA 4PPRA 3VFFA 3VSKA 4DKIA 1JWZA 4WZ5A 4DE2A 3IWQA 3IF6A 2OV5A 2HP6A 5DF9A 5A91A 5TR7A 3G4PA 4ZAMA 4IBXA 5FAPA 2PBYA 2ZMAA 4QJGA 5FAQA 2Q9MA 1MPLA 4FH4A 3O3VA 1BLHA 4F94A 3DWZA 2JC7A 1ZG4A 2ZLYA 4P87A 3UDFA 2WGIA 2CC1A 4OP5A 3GRJA 4OOMA 4HBTA 3FWLA 1ESUA 3PBNA 3BFFA 4E3LA 2WKIA 3W4PA 3ZNTA 4OONA 1IKGA 4XXRA 5KMWA 2X71A 3BM6A 3HLDA 1KE4A 1MKIA 2WAFA 4EBLA 4BD0A 4JBFA 2Y2PA 2FFFB 3HLWA 1LI9A 1K4FA 1Q2QA 1Z6FA 1KE3A 2VGKA 4S2JA 1K57A 2ZC7A 4GOGA 1H8YA 3NDEA 3UE3A 5HARA 5FQQA 3OZHA 3BEBA 5CRFA 1H8ZA 3A3JA 4WZ4A 4Z9QA 4GB7A 2OLVA 3IHBA 2XH9A 4HBUA 4X68A 4EWFA 3GTCA 4UAAA 4OQHA 3HLCA 2Y2MA 4K91A 3M2KA 1SKFA 3B3XA 1M6KA 1CEFA 1LI0A 3NI9A 4N92A 4WMCD 5DVAA 4JF5A 2WGWB 4KG2A 2H0TA 1H5XA 4S2PA 5FQJA 1NRFA 4OLDA 4S2NC 2Y2IA 3HL9A 1K38A 3MFDA 2ZC6B 1W8QA 1PI4A 1C3BA 4N1HA 1MWRA 2XDMA 1JWPA 4Y7PA 1EWZA 1J9MA 3N4IA 4DXCA 2XF3A 4KZ6A 3VSLA 4R3JA 3LY3A 5A93A 1IYOA 1ES2A 4A5RA 5CXWA 3FZCA 4D2OA 3NCKA 4LENA 4DE3A 2B5RA 3HLFA 1XP4A 4C6YA 3W4OA 2H10A 4CJNA 4DE1A 4WELA 3NIAA 3Q7VB 2EFXA 2HP5A 3A3IA 2XK1A 4ID4A 4KZAA 4ZTKA 4X55A 4DE0A 3VOYA 3PBQA 4JXSA 1FCNA 3CMZA 4ZJ2A 4IEDA 1IYSA 1QMEA 4OKPA 3GSGA 3VP3A 3Q81A 4CPKA 1EROA 1JTDA 1K4EA 3MZEA 3TSGA 1YLYA 1SCWA 1KGGA 1K55C 5FA7A 4M3KA 4BJPA 3HLBA 3IH8A 4O7DA 4R0QA 5CTMA 4QY6A 1ZC2A 2R9XA 1IELA 2EX2A 5HL1A 1IYQA 2Y2JA 3EQVA 4S2LA 1I2SA 5G18A 1CI8A 3PAEA 1S0WA 3WWXA 1NJ4A 5E2GA 4H8RA 3QNBA 4GDNA 2C6WB 1K25A 3G32A 1ZG6A 3VP0A 4DF6A 2XGNA 2XFSA 3UY6A 1KDWA 2EX8A 1W8YA 3LCEA 4K0XA 5I94A 3GQZA 5EPHA 2XD1A 3SS3A 5D3OA 4WBGA 4GD8A 4DXBA 3PBRA 4GDBA 3MKFA 1MBLA 1W79A 2OLUA 4PMAA 2I72A 5DTSA 4S2NA 2Y2OA 4IBRA 3V50A 1MXOA 4OQ0A 3A3FA 2GDNA 4X69A 3VOZA 3IXHA 5E2EA 4WEKA 3ZCZA 1RP5A 3WS5A 5KSCA 1K6SA 4OPYA 3G2ZA 3C7VA 5JYOA 1ALQA 2J9OA 2Y55A 1NY0A 3TG9A 3HUMA 4KZ7A 1MWUA 3UO9A 4UHUA 4GN2A 4E3NA 3PBTA 4S2KA 3SH7A 2XLNA 3IXGA 2IWBA 3PAGA 3ZHHA 1ERQA 5EUAA 1KDSA 4X56A 4KZ8A 5DTTA 1IYPA 2HDSA 1ONGA 3HUOA 1BULA 3AGDA 4PM7A 4XUZA 3ZVTA 4C3QA 3G34A 1L0FA 1OMEA 5F82A 4QHCA 1FR1A 3E2LA 1HVBA 3Q07A 1W5DA 1WE4A 3C5AA 3Q82A 4E3JA 1XA1A 2XR0A 4L0LA 1PZPA 2BG1A 1XPBA 3A3DA 1IKIA 1RGZA 3M6HA 4JKTA 4ZDXA 2WGWA 4N1XA 1W7FA 1GHIA 3E2KA 3MZFA 4MEZA 5L2FA 1XXMA 2H5SA 5FI7A 3EQUA 3N8SA 2Y2HA 3IHAA 1ONHA 1MWTA 2G2UA 4BL2A 3NY4A 1Q2PA 4QU3A 5FQIA 3MXSA 1NYYA 4FSFA 1GHPA 1K56A 5A90A 2PU4A 5F1FA 3NDGA 3IWOA 3GVBA 3JYIA 3ZG5A 4C75A 4Y0OA 3IXBA 4LCLA 3IH9A 3P98A 4PM9A 1XX2A 1VM1A 4KZ3A 2A3UA 4PM6A 4KZ5A 4KENB 5HAPA 3OC2A 1LHYA 4Y0UA 1VQQA 3Q7VA 4BENA 1K54C 2Z2LB 5DTKA 3AGFA 4S2IA 1FCMA 2UWXA 1AXBA 3OPRA 2RL3A 1SDNA 3UDIA 1MWSA 4UA9A 3ITAA 1CK3A 4EBPA 1DJBA 4B4XA 1FCOA 1N4OA 5AQ7A 3ZVWA 3S4XA 1GA0A 3IT9A 5FQKA 3BYDA 4BQMA 1EI5A 3UPOA 2WADA 3UNWA 2HPBA 4OQGA 3OCNA 3WS2A 3BECA 1HD8A 1XKZA 4LV3A 4WEJA 4DDYA 2WZZA 5HAIA 1BLPA 3SS4A 5HAQA 2E8IA 5IHVA 4DRTA 2P74A 3UPPA 1ZKJA 4GZBA 1G68A 1WYBA 1Y54A 3HLEA 1SHVA 4LV1A 5GLAA 2ZQ7A 2X01A 5M19A 5EVIB 3RXXA 4KZ9A 5E2FA 2JBFA 5M1AA 5KSHA 2RCXA 3QNCA 4IVKA 4OOYA 1YLPA 3D4FA 3LY4A 4WZ5C 4ZJ3A 1FOFA 2X02A 1LLBA 2Y4AA 3DW0A 5GHZA 2ZM2A 1YLTA 5FAOA 1SDEA 3IWIA 3ZGAB 1JVJA 1YMXA 2ZQCA 3NBLA 3N8LA 3G35A 4BL3A 3MXRA 2ZC3B 5FSRA 1PIOA 1PWDA 1PYYA 1L2SA 4JPMA 4S2MA 3SOIA 4KQOA 1KVLA 1XA7A 3BFCA 4NK3A 3ZG0A 4N9LA 1QMFA 1BZAA 1NYMA 2DRWA 1HTZA 1TEMA 2ZC4B 5CTNA 2ZM0A 4R1GA 3QHYA 3BLMA 5FDHA 2Y2LA 4OQIA 2Y2QA 1S6RA 2ZQAA 2Y2KA 4HEFA 4WYYA 3Q7ZA 4RX2A 3LEZA 4YINA 3MBZA 5EOEA 5M18A 3CZDA 1XGJA 3S1YA 4IVIA 3OPPA 3WS1A 3ISGA 5CERA 4MBKA 3ZG8B 2HDQA 2JCHA 1K57C 5EVIC 5KZHA 4E3KA 4E6WA 5GHXA 3WS4A 4E6XA 2C5WB 2EXAA 2DCFA 1BLSA 4P0MA 1GA9A 3RJUA 1KVMA 3PTEA 1FSYA 5E43A 3HBRA 1YT4A 4QD4A 4OPZA 2EXBA 2DNSA 2J8YA 3MZDA 1RGYA 2A49A 1KE0A 4OVDA 4RX3A 5CGWA 3AGEA 1RCJA 3UE0A 5EE8A 1NZUA 4MBHA 1NZOA 1BTLA 3HVFA 3OCLA 5F1GA 2WUQA 3CG5A 3VP1A 1E3UA 4B88A 2Y59A 4YFMA 4KZ4A 3W4QA 2Y2NA 3I7JA 4MNRA 4PM8A 5AQBA 5HFOA 5FQ9A 3BLSA 3UN7A 1YM1A 1JTGA 3NC8A 1O07A 4RVAA 2XD5A 1NXYA 1CEGA 1LL9A 3A3EA 4RYEA 2WAEA 1YLJA 5TFQA 3SH9A 1YMSA 1K55A 1PW8A 1YLWA 5HX9A 2QPNA 2G2WA 4BLMA 4E3OA 5BOHA 4ZJ1A 2IWCA 4Y0TA 2ZM8A 4FH2A 4XUXA 3TOIA 5FATA 1I2WA 2HDUA 2WK0A 4HESA 2QMIA 2V2FF 1E3UD 1K6RA 4WMCA 1XGIA 5CHMA 2JE5A 4U3TA 3BFGA 4JXWA 1BUEA 3V39A 2P9VB 4K0WA 3N6IA 5GLBA 3GMWA 5CEDA 3UPNA 5HW3A 2EFUA 2XEPA 4U0XA 4UA6A 1IEMA 4X53A 1N9BA 1PWCA 3O87A 2Z2MB 3IF6B 3FV7A 2ZQ8A 3ZG7B 4X6TA 4UA7A 4OP8A 5AQ9A 4KQQA 1TDLA 3BFEA 4MBFA 3ZG9B 2V20A 2XFTA 3O86A 1KGFA
chains in the Genus database with same CATH superfamily
4CQHA 1KGEA 2WKHA 3OBFA 3DTMA 3PBSA 5L09A 3P09A 5L07A 5EVLA 3ITBA 4X25A 2ZQDA 3C7UA 3QP5A 2W1RA 3V5MA 4LV0A 2IWDA 2OWJA 3S22A 3N7WA 1ZHHB 2ZD8A 4FCFA 5FI6A 1GCEA 1BLCA 5CX7A 1S1ZA 3MFXA 4U0TA 3UB9A 3UMEA 2XA7S 4OLGA 5CGSA 2NUPC 1PI5A 3NOPC 5FDSA 3D9YA 3LI8A 3M2JA 2EX6A 1Y4OA 4DDSA 1ES3A 1VB6A 1DP6A 3Q1FA 1TD5A 1AWIA 3MKEA 5CECA 4R3AA 1FSWA 4LLOB 4JLFA 4EQIA 3ZFZA 1ES5A 3PBOA 5AQAA 5CGXA 4GKUA 5A92A 3CPTB 3JPUA 1T1AA 2HZ5A 1FQGA 3SH8A 2O99A 3DTEA 4P6BA 4OH0A 5CHJA 1ESIA 3ZNYA 1TVFA 3UDXA 2P9VA 4R38A 4PPRA 1T1CA 2HV1A 3IWQA 2Y79A 3IF6A 2HP6A 1KOUA 4IBXA 5FAPA 2PBYA 4QJGA 5FAQA 3QP6A 4F94A 1OJGA 4OP5A 3GRJA 2QKPA 3FWLA 3ZNTA 4OONA 1TF1A 2X71A 1H8MA 4JBFA 5HDCA 1LI9A 1K4FA 1LT0A 3UE3A 3NHQA 3BEBA 5HWTA 2OLVA 3GTCA 4UAAA 4K91A 3F1PA 4N92A 4WMCD 1TS7A 1NRFA 2QJ5A 3JVUA 2Y2IA 3MFDA 4KUOA 1W8QA 1PI4A 1MWRA 4NEED 1JWPA 1OT6A 1J9MA 1TS8A 3N4IA 4DXCA 1P9RA 4KZ6A 3E4QA 4FTXA 1DRMA 4LGWA 5CXWA 3W4OA 4DE1A 4MDZA 3Q7VB 2HP5A 4LRYC 3B42A 2XK1A 4ID4A 4KZAA 4DE0A 3T1RA 3VOYA 1FCNA 3CMZA 1IYSA 3LGOA 3C8CA 3TSGA 2VGLS 1SCWA 3CPTA 1K55C 4O7DA 5HL1A 4QY6A 4M4XA 1NRJA 1STZA 5TBMB 4S2LA 3EGXC 1S0WA 3WWXA 1H0MA 3IBRA 5E2GA 4GDNA 3BQ8A 2C6WB 1ZG6A 2H28A 4K0XA 3UB5P 5I94A 2OOLA 4WBGA 5IS1A 4NXBA 4K08A 3F1NB 4OQ0A 4EEUA 4HHDA 1PNEA 3T4JA 2Y55A 3O5YA 2QWSA 4KZ7A 2ZL1B 3E98A 4L9GA 3PAGA 4X56A 3L9KA 2HDSA 1XFNA 5HZHA 1BULA 4PM7A 3TRCA 3G34A 4I38A 1F2KA 2XR0A 4L0LA 1P9WA 4JKTA 1G6OA 4DJ2A 4N1XA 1GHIA 3MZFA 1YSQA 5FI7A 3KSIA 2Y2HA 2ZOHA 2G2UA 3NY4A 4QU3A 4FSFA 1NYYA 1GHPA 3MSHA 2PU4A 3UB7A 1OT9A 3JYIA 4C75A 4LCLA 5HPIA 4HIAA 3CWFA 3LUQA 3Q7VA 1K54C 4Y13A 3AGFA 3LR0A 3ITAA 4B4XA 4CLCE 1N4OA 3ZVWA 1N9NA 3BYDA 4BQMA 2WKPA 5TBMA 3C38A 4LV3A 4WEJA 5HAIA 1BLPA 3SS4A 4ETZA 5HAQA 3UPPA 1ZKJA 1WYBA 1Y54A 3HLEA 4LV1A 5HD3A 5M19A 5EVIB 3R7WB 2W1TA 3D4FA 4ZJ3A 1FOFA 3OLOA 2ZM2A 4Q0HA 5FAOA 3ZGAB 1PYYA 2VK3A 4JPMA 2PT7A 3MJQA 2P04A 2LB5A 4B93A 3NOUC 4NK3A 3F1NA 1BZAA 1NYMA 1HTZA 2ZC4B 1NWZA 3QHYA 2A2LA 3LIAA 4OQIA 2Y2QA 2ZQAA 3P7NA 4WYYA 2ZL1A 3Q7ZA 3WS1A 3T4TA 2JCHA 2CMNA 4P0MA 1KVMA 3PTEA 5F68A 2J8YA 3MZDA 1KE0A 4OVDA 1RCJA 3V67A 4X1LA 2D01A 1NZOA 1BTLA 3OCLA 3T4QA 5HSQA 2Y59A 2O0YA 2W0NA 2Y2NA 2O9BA 3I7JA 1JTGA 4JGRA 2XD5A 4RYEA 2WAEA 2PDRA 2G2WA 4XT2B 4Y15A 1YKDA 4Y5FA 2ZM8A 3TOIA 5FATA 1I2WA 2FZ0A 2Y8HA 3VV4A 2WK0A 4Y3IA 1XJ6A 2PRFA 4K0WA 2KOIA 1IEMA 2M1CA 1PWCA 4I3IA 3O87A 3FV7A 3CITA 1YPRA 4OP8A 1TDLA 4MBFA 1KGFA 4JXVA 5EVIA 5HDDA 3R7WA 3EEHA 3M6BA 4R4RA 1K56D 3K3CA 2QYBA 3PR6A 3BFDA 4OOLA 5DF8A 4HQAA 1HZOA 3DTKA 3VFHA 4IHQA 4R3BA 1ERMA 1L0DA 1U60A 4G3WA 5F6AA 2QZ6A 1V9YA 2K31A 1CI9A 5EVID 3O88A 2DMWA 3C30A 2W3DA 2Y91A 4MN5A 4EV4A 1LL8A 3MMHA 3WRZA 3LO7A 3VMAA 2R9WA 1WA9A 3HREA 2QHKA 3C4OA 1ES4A 2V1ZA 2VV7A 3SS5A 4EBNA 5E2HA 4E3IA 3V3RA 3NJAA 2UV0E 3KX0X 5AVEA 2VV8A 4JXGA 1WYCA 1LL5A 4X1MA 1G6AA 1DY6A 2NUTC 4N9KA 3V3SA 2HP9A 3CJMA 1DJCA 4B4ZA 3HLGA 3HUNA 2J7VA 3LIDA 5GL9A 4PKYG 1M40A 3OPLA 3OPHA 2L4RA 3EOIA 1YQSA 4GW9A 3GR2A 3CHWP 4KZBA 4KG6A 3C2WA 3FPWA 4H6JB 1MY8A 4JF4A 3GV9A 4KQRA 4LV2A 4FD8A 1G28A 4GNUA 2HJEA 4DKIA 1XJ3A 4WZ5A 2YKFA 5DF9A 5A91A 4ZAMA 4FH4A 3O3VA 4G3VA 1BLHA 4P87A 4ETXA 2WGIA 4YNRA 3BFFA 2GZAA 3W4PA 5KMWA 4XXRA 4KUKA 3BM6A 1KE4A 3LIFA 3T1QB 4BD0A 2FFFB 1Q2QA 1KE3A 2VKSA 2R78A 1K57A 2O9CA 2ZC7A 4S2JA 4B9OA 1H8ZA 4HH2A 5FEGA 4EWFA 4OQHA 3HLCA 2Y2MA 3M2KA 5DVAA 2PYRA 3BJNA 3BY8A 2H0TA 3KYZA 3KYQA 4OLDA 4S2NC 2HJ9C 3T4KA 2XDMA 4Y7PA 1EWZA 2V8CA 5AVFA 2XF3A 4UQIM 4HI4A 4MCWA 3NCKA 4LENA 3RFBA 3F1PB 4CJNA 2H10A 2EFXA 4ZTKA 2M7UA 4ZJ2A 4OKPA 3Q81A 4O01A 1J3WA 1EROA 1JTDA 1K4EA 3MZEA 3D72A 1KGGA 1GSXA 5FA7A 4M3KA 4BJPA 1OTBA 4R0QA 1ZC2A 2J80A 1IYQA 3EQVA 3S7PA 4IUHA 1CI8A 2OAQ1 2Q0OA 1NJ4A 3QNBA 5C5KA 3G32A 3VP0A 1G5UA 4H6JA 4Y2FA 1NLYA 1OJ5A 3LYXA 3LCEA 2QJ7A 5EPHA 3P01A 3SS3A 1OPXA 3PBRA 4GDBA 3MKFA 1MBLA 1LSVA 1W79A 2I72A 4IBRA 3KSFA 3H7WA 3V50A 1MXOA 2WKRA 4X69A 4WUJA 5E2EA 3S7OA 1RP5A 4OPYA 3G2ZA 3CAXA 3CLOA 3MQQA 2J9OA 3HUMA 2IWBA 4P6ZM 1ERQA 1KDSA 4KZ8A 5DTTA 3HUOA 4XUZA 3ZVTA 4C3QA 5G4ZA 2AVXA 3G6OA 3Q82A 1WE4A 2VLGA 3ICYA 1XPBA 2JKRI 1D7EA 3LICA 4QWOA 3E2KA 5L2FA 3N8SA 3IHAA 4BWIA 5HWWA 3MXSA 4KQDA 5F1FA 3NDGA 3IWOA 2BTFP 2Z6DA 3IH9A 3P98A 2A3UA 3CUEA 2MJ6A 1LHYA 4Y0UA 1VQQA 2Z2LB 2UWXA 1AXBA 1D06A 1SDNA 1MWSA 4UA9A 1EW0A 1HLUP 5DFYA 5AQ7A 5HL6A 4D60A 2WKQA 2PAVP 5EVEA 3DAVA 4OQGA 3OCNA 1HD8A 4PKYA 3LEQA 4JGPA 2E8IA 4GZBA 5GLAA 1G68A 2X01A 2ZQ7A 3RXXA 5E2FA 2I9VA 5KSHA 1OTDA 2RCXA 2VX8A 3QNCA 2E8JA 1LLBA 2Y4AA 3DW0A 1YLTA 1SDEA 3R4KA 1YMXA 4E04A 3N8LA 3NULA 3MXRA 5FSRA 2YKHA 1PIOA 2B18A 4KQOA 3SOIA 1LSWA 1W63Q 1QMFA 3SZTA 4Y17A 2W1TB 4LFUA 2VJWA 3TE8A 4BMWA 2PR5A 2Y2KA 3LEZA 3MBZA 3EEAA 4EU0A 1XGJA 3ZG8B 4MBKA 5GHXA 3WS4A 1BLSA 2JKFA 3T4OA 1IOUA 2PBDP 4OPZA 3E4OA 2EXBA 1N9OA 4NKPA 3PXPA 4RX3A 5CGWA 3AGEA 3F1OB 5F1GA 2WUQA 3CG5A 3VP1A 1E3UA 4B88A 3JVVA 4KZ4A 4R70A 5HFOA 4PM8A 5FQ9A 3BLSA 4EERA 1O07A 1CEGA 1LL9A 2V1BA 5TFQA 3SH9A 5HX9A 4QPRA 2HDUA 3LR3A 1E3UD 1K6RA 1P0ZA 3BFGA 1S67L 2W3EA 4AFIA 5HW3A 3KSGA 2EA9A 2ZQ8A 4GS9B 2XFTA 2VZWA 3GDIA 2FFYA 4GJ4A 5TJJA 5EECA 4WM9A 2XQZA 3QP1A 2W3HA 1L0EA 3C4PA 2VEAA 1YLZA 5GHYA 1IFQA 3NECA 3UE1A 5JYPA 1LSXA 1E25A 3WRTA 2ZC5B 3LFVA 2K7SA 4GD6A 3FPVA 3LI9A 4Q8IA 2PR6A 4EEPA 3VP2A 2KLIA 3KYEA 4GHIB 3E4PA 4IUKA 1PRQA 2EWWA 5HWVA 2HF6A 3IF5A 1JWVA 2PD8A 2WGVA 4NETA 1I5QA 5J3WA 2Q9NA 4MLLA 1O7EA 4EUZA 1FR6A 1TDGA 3E0YA 3IBJA 5FASA 1XFQA 5DKKA 3F1OA 1PWGA 2H0YA 1VHMA 5DJUA 1Z09A 3IQAA 3QP2A 4E3MA 3H9WA 3S7NA 4QB8A 3BRMA 2ZJ9A 5FI2A 5GLCA 4PM5A 5J8XA 4R6LA 1VEUB 2ACGA 1S4SA 2BLSA 3FKVA 4HJ4A 3FYZA 5U47A 2OSUA 4RA7A 1OTEA 3RXWA 3G30A 5FEFA 3KSHA 2VGJA 1GHMA 3FKWA 1JWZA 4DE2A 1TS6A 2OV5A 4GS9A 3G4PA 4L9EA 2G7UA 4LPZA 4CLCC 3DWZA 2JC7A 2ZLYA 3IS2B 2CC1A 5EFWA 3B33A 4E3LA 2WKIA 1UGUA 2A24A 2JN7A 3TW8A 3HLDA 3H82A 4ESPA 3LR4A 4GLQA 1VETB 2Y2PA 3HLWA 1Z6FA 4GOGA 3NDEA 5FQQA 3FG8A 5CRFA 5A8BA 4EXOA 3IHBA 2XH9A 4HBUA 3IX3A 4BL3A 3B3XA 3LIBA 4JF5A 2WGWB 1H5XA 4S2PA 1K38A 4GHIA 1N9LA 2ZC6B 4N1HA 1XJ2A 1CF0A 3DBAA 4MMNA 3VSLA 1ES2A 4DN0A 3FZCA 2PD7A 4DE3A 4EW7A 2B5RA 1CQAA 3HLFA 1XP4A 1OTIA 3A0VA 4C6YA 3NIAA 4X55A 3PBQA 3FC7A 4PAUA 4IEDA 2GJ3A 4CPKA 5MC7A 3BY9A 3B47A 1YLYA 5CTMA 1IELA 1I2SA 5G18A 1S4RA 4NXGA 1VEUA 3HJIA 1K25A 4O0PA 4DJ3A 1A0KA 2D02A 2XFSA 1KDWA 1D1JA 3GQZA 5D3OA 4GD8A 1YSPA 2W3GA 1S66L 4HP4A 2PHYA 4PMAA 1L3LA 4S2NA 2Y2OA 2J3TD 3IS2A 3VOZA 3IXHA 4WEKA 3WS5A 3C7VA 4IJGA 5JYOA 1ALQA 1W63M 2GNXA 1NY0A 3UO9A 2XA7M 4GN2A 4E3NA 3MQOA 4S2KA 3ZHHA 4II7A 1IYPA 1VETA 1ONGA 4FUWA 1MC0A 3AGDA 3H7WB 1T19A 1OMEA 5F82A 4QHCA 4E3JA 1XA1A 2BG1A 3A3DA 3M6HA 2WGWA 1W7FA 1XXMA 1SZVA 4UEYA 1MWTA 4BL2A 3MS6A 3U2AA 3GVBA 3ZG5A 2JKTI 3BWLA 1XX2A 4PM6A 4KENB 4GCZA 1TS0A 3OC2A 3VE4A 4BENA 4BBTA 4S2IA 1FCMA 3OPRA 3UDIA 1CK3A 1FCOA 3S4XA 2GX5A 1S1YA 3IT9A 5FQKA 1EI5A 2FH5A 3UNWA 1T18A 2HPBA 1H3QA 3WS2A 4Q0JA 4LRXC 4DDYA 2OWHA 2WZZA 5EM0A 5IHVA 4DRTA 5LBRA 2P74A 5TR7A 4ARZB 1SHVA 2JBFA 4IVKA 1YLPA 4WZ5C 5GHZA 3IWIA 3NBLA 3G35A 4WN5A 3BW6A 1PWDA 2M7VA 1L2SA 3S7QA 4S2MA 1KVLA 1XA7A 1FIKA 3A0SA 4N9LA 2DRWA 1TEMA 3HJKA 4L9FA 2ZM0A 4R1GA 3UB8A 5FDHA 4NG2A 1S6RA 3T50A 3UB6A 5EOEA 5M18A 4RX2A 2P7JA 3CZDA 4WLAA 3S1YA 4IVIA 5K5BA 3ISGA 2HDQA 1K57C 4E3KA 4E6WA 4I5SA 4E6XA 1YAXA 2DCFA 2JKRM 3RJUA 1FSYA 5E43A 3HBRA 4HOIA 3T1SA 2EWVA 3UE0A 5EE8A 1NZUA 4I3JA 4MN6A 4MBHA 3HVFA 5F69A 4YFMA 4UQIS 3W4QA 4MNRA 1YM1A 2XRNA 3NC8A 4RVAA 3PYPA 1NXYA 3A3EA 2VGLM 1YMSA 1K55A 2QPNA 4BLMA 4E3OA 4ZJ1A 2IWCA 4Y0TA 4XUXA 4WMCA 5CHMA 2JE5A 4U3TA 1BUEA 5GLBA 3GMWA 1GSWA 5KIZA 4U0XA 4UA6A 1N9BA 4EQ1A 2Z2MB 1XJ4A 4UA7A 3BFEA 4ARZA 3O86A 2PYPA 2ZQ9A 4NXEA 2P08A 3W8KA 1MZUA 3DWKA 3IXDA 2ZMVA 5DF7A 4QY5A 1PFLA 5CEBA 1PZOA 2V9AA 1PW1A 1UWNX 3RH8B 2VA0A 2V8FA 2WKEA 4ZBEA 4FOFA 3G31A 2WZXA 3GECA 4PHTA 3MR0A 3IF6C 4P6ZS 1DJAA 4S2OA 4R23A 3VP4A 2J3WA 2Y2GA 3D3OA 3SW1A 4KG5A 1BSGA 5EM1A 5F83A 3TJZC 3LIEA 1NLZA 3RTYA 2EX9A 3MQ0A 4JF6A 5EOOA 1K54A 4R4SA 3ULFA 3WS0A 1BT5A 3CUEC 3ZDJA 4OPRA 4CLCB 2WYXA 1JNUA 2HDRA 2J9PA 1E4DA 5FQMA 5L8MA 4LCMA 4BD1A 2W3FA 2Z6CA 2HGVA 1L0GA 4P85A 3LR5A 2B02A 5CHUA 5GLDA 4HP9A 2PU2A 4OPQA 4WF0A 3G2YA 3K2NA 5IT5A 5TGFA 3N8RA 3VSKA 3VFFA 2V0WA 3IX8A 2ZMAA 2Q9MA 1MPLA 1ZG4A 3UDFA 5J4EA 3MXQA 3U4LP 4OOMA 4HBTA 1ESUA 3PBNA 3W2ZA 3DTIA 1IKGA 3BQAA 1BYWA 1ZTUA 1MKIA 2WAFA 4EBLA 2VGKA 4BBVA 1H8YA 5HARA 3OZHA 3A3JA 4WZ4A 4Z9QA 4GB7A 5L10A 2IA2A 4X68A 4EESA 4HNBA 1SKFA 3NI9A 1M6KA 1CEFA 1LI0A 2A24B 4KG2A 5FQJA 3T4LA 3HL9A 3H82B 2W27A 1C3BA 3IX4A 5DKLA 4R3JA 3LY3A 5A93A 1IYOA 5IU1A 4A5RA 4D2OA 5J7EA 4WELA 4HH3A 3A3IA 4WL9A 5DJTA 4JXSA 3T12B 3KO6A 4HY8A 3VP3A 1QMEA 3GSGA 4F3LB 3T1XA 4CLCA 3HLBA 3IH8A 1GSVA 2R9XA 2EX2A 2Y2JA 3PAEA 4H8RA 5HD5A 4DF6A 2XGNA 3UY6A 2EX8A 1W8YA 3A0RA 2XD1A 3UMDA 4DXBA 2LB9A 4CLCD 1P97A 2L0WA 2OLUA 4YWZA 5DTSA 3A3FA 2GDNA 3K3DA 3ZCZA 2INWA 5KSCA 1ACFA 1K6SA 3CI6A 2V0UA 3TG9A 1MWUA 4UHUA 3VOLA 1F9IA 3PBTA 3SH7A 2XLNA 3IXGA 4YOFA 5EUAA 3L7HA 4I3AA 3ZQ5A 1L0FA 2BASA 1FR1A 3E2LA 1HVBA 3Q07A 1W5DA 3C5AA 1V9ZA 3EWKA 3QP8A 1PZPA 1F5MA 1IKIA 1RGZA 1UWPX 4ZDXA 4MEZA 4EUVA 4BBUA 2H5SA 3EQUA 1ONHA 2XROA 1Q2PA 5FQIA 5A90A 1K56A 4Y0OA 3IXBA 4HJ3A 4PM9A 1VM1A 4KZ3A 4NXFA 4RQ9A 4KZ5A 4Q0IA 5HAPA 2JHEA 5DTKA 1DP8A 1K0KA 4DMZA 1FILA 2RL3A 5F5YA 4LRZE 1F98A 4EBPA 1DJBA 2KX6A 4F3LA 1SKOB 1GA0A 3UPOA 2WADA 3BECA 1XKZA 4MN7A 3QP4A 2K2NA 2O9AA 3NOTC 3OOVA 3EGDC 1OTAA 3ZYTA 4KZ9A 5M1AA 4OOYA 3LY4A 3VE3A 2X02A 1CJFA 1JVJA 2ZQCA 2ZC3B 3HCYA 2ZOIA 2ZMFA 2JKGA 4O8GA 3BFCA 3ZG0A 2L1MA 5CTNA 4Z1WA 4I39A 3PHYA 5FL3A 3BLMA 1T1BA 2Y2LA 4HEFA 4YINA 3OPPA 5CERA 5KZHA 5EVIC 2C5WB 2EXAA 5DFXA 1GA9A 1YT4A 4QD4A 5HDSA 5I5LA 2DNSA 4EETB 1RGYA 2A49A 2B95A 3T4SA 3UE6A 4XT2A 2JKTM 1DP9A 4HJ6A 5HPFA 2V1AA 1Y28A 5AQBA 3UN7A 2OAP1 4ZRRA 2XSSA 1YLJA 4ME4A 1PW8A 1YLWA 5AJGA 5BOHA 1X0OA 4G3KA 1ODVA 4FH2A 5G4YA 5EV0A 4HESA 2QMIA 1SKOA 2V2FF 1XGIA 3MF0A 4JGOA 4JXWA 3V39A 2J3TC 1MKMA 2P9VB 3N6IA 5CEDA 2ZBBA 3UPNA 2EFUA 2XEPA 4JGQA 2VV6A 4X53A 2KDKA 3IF6B 3ZG7B 4X6TA 5AQ9A 4KQQA 3ZG9B 2V20A
chains in the Genus database with same CATH topology
2ZQ9A 4JXVA 2FFYA 5EVIA 1KGEA 2WKHA 5EECA 3M6BA 3DTMA 3PBSA 4WM9A 3P09A 3W8KA 2XQZA 4R4RA 3DWKA 1K56D 3IXDA 5EVLA 3ITBA 2ZQDA 1L0EA 3BFDA 3C7UA 3C4PA 4QY5A 5DF7A 1YLZA 5GHYA 3V5MA 4LV0A 4OOLA 2IWDA 5DF8A 5CEBA 1HZOA 3UE1A 5JYPA 3VFHA 1PZOA 4R3BA 3S22A 3N7WA 1E25A 3WRTA 1ERMA 1L0DA 1PW1A 2ZC5B 1U60A 2ZD8A 4FCFA 5FI6A 1GCEA 2WKEA 4ZBEA 1BLCA 4GD6A 2QZ6A 4U0TA 3G31A 2WZXA 1CI9A 4OLGA 5CGSA 5EVID 3IF6C 3O88A 4Q8IA 1PI5A 2Y91A 1DJAA 4S2OA 4EV4A 3VP2A 3M2JA 2EX6A 4DDSA 4R23A 3VP4A 3WRZA 3LO7A 3VMAA 1ES3A 2R9WA 3HREA 3IF5A 3C4OA 1ES4A 2Y2GA 1JWVA 2V1ZA 2WGVA 3SS5A 4EBNA 5E2HA 4NETA 4KG5A 3Q1FA 1I5QA 4E3IA 1BSGA 3V3RA 2Q9NA 3MKEA 4MLLA 1O7EA 5F83A 4EUZA 1FR6A 1FSWA 1TDGA 5CECA 5FASA 4JLFA 4JXGA 1WYCA 2EX9A 1LL5A 1PWGA 4JF6A 3ZFZA 2H0YA 1G6AA 4EQIA 1DY6A 1ES5A 3IQAA 5EOOA 1K54A 3PBOA 5AQAA 4E3MA 4R4SA 4N9KA 3V3SA 3WS0A 2HP9A 5CGXA 3CJMA 1BT5A 1DJCA 3ZDJA 4B4ZA 3HLGA 4GKUA 4OPRA 5A92A 4QB8A 2WYXA 3HUNA 2J7VA 2HDRA 3BRMA 2J9PA 1E4DA 5GL9A 1M40A 3OPLA 2ZJ9A 3OPHA 1YQSA 5FI2A 5FQMA 1FQGA 3GR2A 5GLCA 4PM5A 3SH8A 5J8XA 4KZBA 4LCMA 4KG6A 4BD1A 1L0GA 4P85A 2BLSA 1MY8A 4JF4A 3GV9A 4P6BA 3FKVA 5CHUA 3FYZA 5U47A 4KQRA 4OH0A 4LV2A 5GLDA 2OSUA 2PU2A 1ESIA 4FD8A 4OPQA 4RA7A 1TVFA 5CHJA 3ZNYA 3RXWA 3UDXA 3G2YA 3G30A 2P9VA 4GNUA 5TGFA 2VGJA 1GHMA 3FKWA 3N8RA 4PPRA 3VFFA 3VSKA 4DKIA 1JWZA 4WZ5A 4DE2A 3IWQA 3IF6A 2OV5A 2HP6A 5DF9A 5A91A 5TR7A 3G4PA 4ZAMA 4IBXA 5FAPA 2PBYA 2ZMAA 4QJGA 5FAQA 2Q9MA 1MPLA 4FH4A 3O3VA 1BLHA 4F94A 3DWZA 2JC7A 1ZG4A 2ZLYA 4P87A 3UDFA 2WGIA 2CC1A 4OP5A 3GRJA 4OOMA 4HBTA 3FWLA 1ESUA 3PBNA 3BFFA 4E3LA 2WKIA 3W4PA 3ZNTA 4OONA 1IKGA 4XXRA 5KMWA 2X71A 3BM6A 3HLDA 1KE4A 1MKIA 2WAFA 4EBLA 4BD0A 4JBFA 2Y2PA 2FFFB 3HLWA 1LI9A 1K4FA 1Q2QA 1Z6FA 1KE3A 2VGKA 4S2JA 1K57A 2ZC7A 4GOGA 1H8YA 3NDEA 3UE3A 5HARA 5FQQA 3OZHA 3BEBA 5CRFA 1H8ZA 3A3JA 4WZ4A 4Z9QA 4GB7A 2OLVA 3IHBA 2XH9A 4HBUA 4X68A 4EWFA 3GTCA 4UAAA 4OQHA 3HLCA 2Y2MA 4K91A 3M2KA 1SKFA 3B3XA 1M6KA 1CEFA 1LI0A 3NI9A 4N92A 4WMCD 5DVAA 4JF5A 2WGWB 4KG2A 2H0TA 1H5XA 4S2PA 5FQJA 1NRFA 4OLDA 4S2NC 2Y2IA 3HL9A 1K38A 3MFDA 2ZC6B 1W8QA 1PI4A 1C3BA 4N1HA 1MWRA 2XDMA 1JWPA 4Y7PA 1EWZA 1J9MA 3N4IA 4DXCA 2XF3A 4KZ6A 3VSLA 4R3JA 3LY3A 5A93A 1IYOA 1ES2A 4A5RA 5CXWA 3FZCA 4D2OA 3NCKA 4LENA 4DE3A 2B5RA 3HLFA 1XP4A 4C6YA 3W4OA 2H10A 4CJNA 4DE1A 4WELA 3NIAA 3Q7VB 2EFXA 2HP5A 3A3IA 2XK1A 4ID4A 4KZAA 4ZTKA 4X55A 4DE0A 3VOYA 3PBQA 4JXSA 1FCNA 3CMZA 4ZJ2A 4IEDA 1IYSA 1QMEA 4OKPA 3GSGA 3VP3A 3Q81A 4CPKA 1EROA 1JTDA 1K4EA 3MZEA 3TSGA 1YLYA 1SCWA 1KGGA 1K55C 5FA7A 4M3KA 4BJPA 3HLBA 3IH8A 4O7DA 4R0QA 5CTMA 4QY6A 1ZC2A 2R9XA 1IELA 2EX2A 5HL1A 1IYQA 2Y2JA 3EQVA 4S2LA 1I2SA 5G18A 1CI8A 3PAEA 1S0WA 3WWXA 1NJ4A 5E2GA 4H8RA 3QNBA 4GDNA 2C6WB 1K25A 3G32A 1ZG6A 3VP0A 4DF6A 2XGNA 2XFSA 3UY6A 1KDWA 2EX8A 1W8YA 3LCEA 4K0XA 5I94A 3GQZA 5EPHA 2XD1A 3SS3A 5D3OA 4WBGA 4GD8A 4DXBA 3PBRA 4GDBA 3MKFA 1MBLA 1W79A 2OLUA 4PMAA 2I72A 5DTSA 4S2NA 2Y2OA 4IBRA 3V50A 1MXOA 4OQ0A 3A3FA 2GDNA 4X69A 3VOZA 3IXHA 5E2EA 4WEKA 3ZCZA 1RP5A 3WS5A 5KSCA 1K6SA 4OPYA 3G2ZA 3C7VA 5JYOA 1ALQA 2J9OA 2Y55A 1NY0A 3TG9A 3HUMA 4KZ7A 1MWUA 3UO9A 4UHUA 4GN2A 4E3NA 3PBTA 4S2KA 3SH7A 2XLNA 3IXGA 2IWBA 3PAGA 3ZHHA 1ERQA 5EUAA 1KDSA 4X56A 4KZ8A 5DTTA 1IYPA 2HDSA 1ONGA 3HUOA 1BULA 3AGDA 4PM7A 4XUZA 3ZVTA 4C3QA 3G34A 1L0FA 1OMEA 5F82A 4QHCA 1FR1A 3E2LA 1HVBA 3Q07A 1W5DA 1WE4A 3C5AA 3Q82A 4E3JA 1XA1A 2XR0A 4L0LA 1PZPA 2BG1A 1XPBA 3A3DA 1IKIA 1RGZA 3M6HA 4JKTA 4ZDXA 2WGWA 4N1XA 1W7FA 1GHIA 3E2KA 3MZFA 4MEZA 5L2FA 1XXMA 2H5SA 5FI7A 3EQUA 3N8SA 2Y2HA 3IHAA 1ONHA 1MWTA 2G2UA 4BL2A 3NY4A 1Q2PA 4QU3A 5FQIA 3MXSA 1NYYA 4FSFA 1GHPA 1K56A 5A90A 2PU4A 5F1FA 3NDGA 3IWOA 3GVBA 3JYIA 3ZG5A 4C75A 4Y0OA 3IXBA 4LCLA 3IH9A 3P98A 4PM9A 1XX2A 1VM1A 4KZ3A 2A3UA 4PM6A 4KZ5A 4KENB 5HAPA 3OC2A 1LHYA 4Y0UA 1VQQA 3Q7VA 4BENA 1K54C 2Z2LB 5DTKA 3AGFA 4S2IA 1FCMA 2UWXA 1AXBA 3OPRA 2RL3A 1SDNA 3UDIA 1MWSA 4UA9A 3ITAA 1CK3A 4EBPA 1DJBA 4B4XA 1FCOA 1N4OA 5AQ7A 3ZVWA 3S4XA 1GA0A 3IT9A 5FQKA 3BYDA 4BQMA 1EI5A 3UPOA 2WADA 3UNWA 2HPBA 4OQGA 3OCNA 3WS2A 3BECA 1HD8A 1XKZA 4LV3A 4WEJA 4DDYA 2WZZA 5HAIA 1BLPA 3SS4A 5HAQA 2E8IA 5IHVA 4DRTA 2P74A 3UPPA 1ZKJA 4GZBA 1G68A 1WYBA 1Y54A 3HLEA 1SHVA 4LV1A 5GLAA 2ZQ7A 2X01A 5M19A 5EVIB 3RXXA 4KZ9A 5E2FA 2JBFA 5M1AA 5KSHA 2RCXA 3QNCA 4IVKA 4OOYA 1YLPA 3D4FA 3LY4A 4WZ5C 4ZJ3A 1FOFA 2X02A 1LLBA 2Y4AA 3DW0A 5GHZA 2ZM2A 1YLTA 5FAOA 1SDEA 3IWIA 3ZGAB 1JVJA 1YMXA 2ZQCA 3NBLA 3N8LA 3G35A 4BL3A 3MXRA 2ZC3B 5FSRA 1PIOA 1PWDA 1PYYA 1L2SA 4JPMA 4S2MA 3SOIA 4KQOA 1KVLA 1XA7A 3BFCA 4NK3A 3ZG0A 4N9LA 1QMFA 1BZAA 1NYMA 2DRWA 1HTZA 1TEMA 2ZC4B 5CTNA 2ZM0A 4R1GA 3QHYA 3BLMA 5FDHA 2Y2LA 4OQIA 2Y2QA 1S6RA 2ZQAA 2Y2KA 4HEFA 4WYYA 3Q7ZA 4RX2A 3LEZA 4YINA 3MBZA 5EOEA 5M18A 3CZDA 1XGJA 3S1YA 4IVIA 3OPPA 3WS1A 3ISGA 5CERA 4MBKA 3ZG8B 2HDQA 2JCHA 1K57C 5EVIC 5KZHA 4E3KA 4E6WA 5GHXA 3WS4A 4E6XA 2C5WB 2EXAA 2DCFA 1BLSA 4P0MA 1GA9A 3RJUA 1KVMA 3PTEA 1FSYA 5E43A 3HBRA 1YT4A 4QD4A 4OPZA 2EXBA 2DNSA 2J8YA 3MZDA 1RGYA 2A49A 1KE0A 4OVDA 4RX3A 5CGWA 3AGEA 1RCJA 3UE0A 5EE8A 1NZUA 4MBHA 1NZOA 1BTLA 3HVFA 3OCLA 5F1GA 2WUQA 3CG5A 3VP1A 1E3UA 4B88A 2Y59A 4YFMA 4KZ4A 3W4QA 2Y2NA 3I7JA 4MNRA 4PM8A 5AQBA 5HFOA 5FQ9A 3BLSA 3UN7A 1YM1A 1JTGA 3NC8A 1O07A 4RVAA 2XD5A 1NXYA 1CEGA 1LL9A 3A3EA 4RYEA 2WAEA 1YLJA 5TFQA 3SH9A 1YMSA 1K55A 1PW8A 1YLWA 5HX9A 2QPNA 2G2WA 4BLMA 4E3OA 5BOHA 4ZJ1A 2IWCA 4Y0TA 2ZM8A 4FH2A 4XUXA 3TOIA 5FATA 1I2WA 2HDUA 2WK0A 4HESA 2QMIA 2V2FF 1E3UD 1K6RA 4WMCA 1XGIA 5CHMA 2JE5A 4U3TA 3BFGA 4JXWA 1BUEA 3V39A 2P9VB 4K0WA 3N6IA 5GLBA 3GMWA 5CEDA 3UPNA 5HW3A 2EFUA 2XEPA 4U0XA 4UA6A 1IEMA 4X53A 1N9BA 1PWCA 3O87A 2Z2MB 3IF6B 3FV7A 2ZQ8A 3ZG7B 4X6TA 4UA7A 4OP8A 5AQ9A 4KQQA 1TDLA 3BFEA 4MBFA 3ZG9B 2V20A 2XFTA 3O86A 1KGFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZQ9 A;  4JXV A;  2FFY A;  5EVI A;  1KGE A;  2WKH A;  5EEC A;  3M6B A;  3DTM A;  3PBS A;  4WM9 A;  3P09 A;  3W8K A;  2XQZ A;  4R4R A;  3DWK A;  1K56 D;  3IXD A;  5EVL A;  3ITB A;  2ZQD A;  1L0E A;  3BFD A;  3C7U A;  3C4P A;  4QY5 A;  5DF7 A;  1YLZ A;  5GHY A;  3V5M A;  4LV0 A;  4OOL A;  2IWD A;  5DF8 A;  5CEB A;  1HZO A;  3UE1 A;  5JYP A;  3VFH A;  1PZO A;  4R3B A;  3S22 A;  3N7W A;  1E25 A;  3WRT A;  1ERM A;  1L0D A;  1PW1 A;  2ZC5 B;  1U60 A;  2ZD8 A;  4FCF A;  5FI6 A;  1GCE A;  2WKE A;  4ZBE A;  1BLC A;  4GD6 A;  2QZ6 A;  4U0T A;  3G31 A;  2WZX A;  1CI9 A;  4OLG A;  5CGS A;  5EVI D;  3IF6 C;  3O88 A;  4Q8I A;  1PI5 A;  2Y91 A;  1DJA A;  4S2O A;  4EV4 A;  3VP2 A;  3M2J A;  2EX6 A;  4DDS A;  4R23 A;  3VP4 A;  3WRZ A;  3LO7 A;  3VMA A;  1ES3 A;  2R9W A;  3HRE A;  3IF5 A;  3C4O A;  1ES4 A;  2Y2G A;  1JWV A;  2V1Z A;  2WGV A;  3SS5 A;  4EBN A;  5E2H A;  4NET A;  4KG5 A;  3Q1F A;  1I5Q A;  4E3I A;  1BSG A;  3V3R A;  2Q9N A;  3MKE A;  4MLL A;  1O7E A;  5F83 A;  4EUZ A;  1FR6 A;  1FSW A;  1TDG A;  5CEC A;  5FAS A;  4JLF A;  4JXG A;  1WYC A;  2EX9 A;  1LL5 A;  1PWG A;  4JF6 A;  3ZFZ A;  2H0Y A;  1G6A A;  4EQI A;  1DY6 A;  1ES5 A;  3IQA A;  5EOO A;  1K54 A;  3PBO A;  5AQA A;  4E3M A;  4R4S A;  4N9K A;  3V3S A;  3WS0 A;  2HP9 A;  5CGX A;  3CJM A;  1BT5 A;  1DJC A;  3ZDJ A;  4B4Z A;  3HLG A;  4GKU A;  4OPR A;  5A92 A;  4QB8 A;  2WYX A;  3HUN A;  2J7V A;  2HDR A;  3BRM A;  2J9P A;  1E4D A;  5GL9 A;  1M40 A;  3OPL A;  2ZJ9 A;  3OPH A;  1YQS A;  5FI2 A;  5FQM A;  1FQG A;  3GR2 A;  5GLC A;  4PM5 A;  3SH8 A;  5J8X A;  4KZB A;  4LCM A;  4KG6 A;  4BD1 A;  1L0G A;  4P85 A;  2BLS A;  1MY8 A;  4JF4 A;  3GV9 A;  4P6B A;  3FKV A;  5CHU A;  3FYZ A;  5U47 A;  4KQR A;  4OH0 A;  4LV2 A;  5GLD A;  2OSU A;  2PU2 A;  1ESI A;  4FD8 A;  4OPQ A;  4RA7 A;  1TVF A;  5CHJ A;  3ZNY A;  3RXW A;  3UDX A;  3G2Y A;  3G30 A;  2P9V A;  4GNU A;  5TGF A;  2VGJ A;  1GHM A;  3FKW A;  3N8R A;  4PPR A;  3VFF A;  3VSK A;  4DKI A;  1JWZ A;  4WZ5 A;  4DE2 A;  3IWQ A;  3IF6 A;  2OV5 A;  2HP6 A;  5DF9 A;  5A91 A;  5TR7 A;  3G4P A;  4ZAM A;  4IBX A;  5FAP A;  2PBY A;  2ZMA A;  4QJG A;  5FAQ A;  2Q9M A;  1MPL A;  4FH4 A;  3O3V A;  1BLH A;  4F94 A;  3DWZ A;  2JC7 A;  1ZG4 A;  2ZLY A;  4P87 A;  3UDF A;  2WGI A;  2CC1 A;  4OP5 A;  3GRJ A;  4OOM A;  4HBT A;  3FWL A;  1ESU A;  3PBN A;  3BFF A;  4E3L A;  2WKI A;  3W4P A;  3ZNT A;  4OON A;  1IKG A;  4XXR A;  5KMW A;  2X71 A;  3BM6 A;  3HLD A;  1KE4 A;  1MKI A;  2WAF A;  4EBL A;  4BD0 A;  4JBF A;  2Y2P A;  2FFF B;  3HLW A;  1LI9 A;  1K4F A;  1Q2Q A;  1Z6F A;  1KE3 A;  2VGK A;  4S2J A;  1K57 A;  2ZC7 A;  4GOG A;  1H8Y A;  3NDE A;  3UE3 A;  5HAR A;  5FQQ A;  3OZH A;  3BEB A;  5CRF A;  1H8Z A;  3A3J A;  4WZ4 A;  4Z9Q A;  4GB7 A;  2OLV A;  3IHB A;  2XH9 A;  4HBU A;  4X68 A;  4EWF A;  3GTC A;  4UAA A;  4OQH A;  3HLC A;  2Y2M A;  4K91 A;  3M2K A;  1SKF A;  3B3X A;  1M6K A;  1CEF A;  1LI0 A;  3NI9 A;  4N92 A;  4WMC D;  5DVA A;  4JF5 A;  2WGW B;  4KG2 A;  2H0T A;  1H5X A;  4S2P A;  5FQJ A;  1NRF A;  4OLD A;  4S2N C;  2Y2I A;  3HL9 A;  1K38 A;  3MFD A;  2ZC6 B;  1W8Q A;  1PI4 A;  1C3B A;  4N1H A;  1MWR A;  2XDM A;  1JWP A;  4Y7P A;  1EWZ A;  1J9M A;  3N4I A;  4DXC A;  2XF3 A;  4KZ6 A;  3VSL A;  4R3J A;  3LY3 A;  5A93 A;  1IYO A;  1ES2 A;  4A5R A;  5CXW A;  3FZC A;  4D2O A;  3NCK A;  4LEN A;  4DE3 A;  2B5R A;  3HLF A;  1XP4 A;  4C6Y A;  3W4O A;  2H10 A;  4CJN A;  4DE1 A;  4WEL A;  3NIA A;  3Q7V B;  2EFX A;  2HP5 A;  3A3I A;  2XK1 A;  4ID4 A;  4KZA A;  4ZTK A;  4X55 A;  4DE0 A;  3VOY A;  3PBQ A;  4JXS A;  1FCN A;  3CMZ A;  4ZJ2 A;  4IED A;  1IYS A;  1QME A;  4OKP A;  3GSG A;  3VP3 A;  3Q81 A;  4CPK A;  1ERO A;  1JTD A;  1K4E A;  3MZE A;  3TSG A;  1YLY A;  1SCW A;  1KGG A;  1K55 C;  5FA7 A;  4M3K A;  4BJP A;  3HLB A;  3IH8 A;  4O7D A;  4R0Q A;  5CTM A;  4QY6 A;  1ZC2 A;  2R9X A;  1IEL A;  2EX2 A;  5HL1 A;  1IYQ A;  2Y2J A;  3EQV A;  4S2L A;  1I2S A;  5G18 A;  1CI8 A;  3PAE A;  1S0W A;  3WWX A;  1NJ4 A;  5E2G A;  4H8R A;  3QNB A;  4GDN A;  2C6W B;  1K25 A;  3G32 A;  1ZG6 A;  3VP0 A;  4DF6 A;  2XGN A;  2XFS A;  3UY6 A;  1KDW A;  2EX8 A;  1W8Y A;  3LCE A;  4K0X A;  5I94 A;  3GQZ A;  5EPH A;  2XD1 A;  3SS3 A;  5D3O A;  4WBG A;  4GD8 A;  4DXB A;  3PBR A;  4GDB A;  3MKF A;  1MBL A;  1W79 A;  2OLU A;  4PMA A;  2I72 A;  5DTS A;  4S2N A;  2Y2O A;  4IBR A;  3V50 A;  1MXO A;  4OQ0 A;  3A3F A;  2GDN A;  4X69 A;  3VOZ A;  3IXH A;  5E2E A;  4WEK A;  3ZCZ A;  1RP5 A;  3WS5 A;  5KSC A;  1K6S A;  4OPY A;  3G2Z A;  3C7V A;  5JYO A;  1ALQ A;  2J9O A;  2Y55 A;  1NY0 A;  3TG9 A;  3HUM A;  4KZ7 A;  1MWU A;  3UO9 A;  4UHU A;  4GN2 A;  4E3N A;  3PBT A;  4S2K A;  3SH7 A;  2XLN A;  3IXG A;  2IWB A;  3PAG A;  3ZHH A;  1ERQ A;  5EUA A;  1KDS A;  4X56 A;  4KZ8 A;  5DTT A;  1IYP A;  2HDS A;  1ONG A;  3HUO A;  1BUL A;  3AGD A;  4PM7 A;  4XUZ A;  3ZVT A;  4C3Q A;  3G34 A;  1L0F A;  1OME A;  5F82 A;  4QHC A;  1FR1 A;  3E2L A;  1HVB A;  3Q07 A;  1W5D A;  1WE4 A;  3C5A A;  3Q82 A;  4E3J A;  1XA1 A;  2XR0 A;  4L0L A;  1PZP A;  2BG1 A;  1XPB A;  3A3D A;  1IKI A;  1RGZ A;  3M6H A;  4JKT A;  4ZDX A;  2WGW A;  4N1X A;  1W7F A;  1GHI A;  3E2K A;  3MZF A;  4MEZ A;  5L2F A;  1XXM A;  2H5S A;  5FI7 A;  3EQU A;  3N8S A;  2Y2H A;  3IHA A;  1ONH A;  1MWT A;  2G2U A;  4BL2 A;  3NY4 A;  1Q2P A;  4QU3 A;  5FQI A;  3MXS A;  1NYY A;  4FSF A;  1GHP A;  1K56 A;  5A90 A;  2PU4 A;  5F1F A;  3NDG A;  3IWO A;  3GVB A;  3JYI A;  3ZG5 A;  4C75 A;  4Y0O A;  3IXB A;  4LCL A;  3IH9 A;  3P98 A;  4PM9 A;  1XX2 A;  1VM1 A;  4KZ3 A;  2A3U A;  4PM6 A;  4KZ5 A;  4KEN B;  5HAP A;  3OC2 A;  1LHY A;  4Y0U A;  1VQQ A;  3Q7V A;  4BEN A;  1K54 C;  2Z2L B;  5DTK A;  3AGF A;  4S2I A;  1FCM A;  2UWX A;  1AXB A;  3OPR A;  2RL3 A;  1SDN A;  3UDI A;  1MWS A;  4UA9 A;  3ITA A;  1CK3 A;  4EBP A;  1DJB A;  4B4X A;  1FCO A;  1N4O A;  5AQ7 A;  3ZVW A;  3S4X A;  1GA0 A;  3IT9 A;  5FQK A;  3BYD A;  4BQM A;  1EI5 A;  3UPO A;  2WAD A;  3UNW A;  2HPB A;  4OQG A;  3OCN A;  3WS2 A;  3BEC A;  1HD8 A;  1XKZ A;  4LV3 A;  4WEJ A;  4DDY A;  2WZZ A;  5HAI A;  1BLP A;  3SS4 A;  5HAQ A;  2E8I A;  5IHV A;  4DRT A;  2P74 A;  3UPP A;  1ZKJ A;  4GZB A;  1G68 A;  1WYB A;  1Y54 A;  3HLE A;  1SHV A;  4LV1 A;  5GLA A;  2ZQ7 A;  2X01 A;  5M19 A;  5EVI B;  3RXX A;  4KZ9 A;  5E2F A;  2JBF A;  5M1A A;  5KSH A;  2RCX A;  3QNC A;  4IVK A;  4OOY A;  1YLP A;  3D4F A;  3LY4 A;  4WZ5 C;  4ZJ3 A;  1FOF A;  2X02 A;  1LLB A;  2Y4A A;  3DW0 A;  5GHZ A;  2ZM2 A;  1YLT A;  5FAO A;  1SDE A;  3IWI A;  3ZGA B;  1JVJ A;  1YMX A;  2ZQC A;  3NBL A;  3N8L A;  3G35 A;  4BL3 A;  3MXR A;  2ZC3 B;  5FSR A;  1PIO A;  1PWD A;  1PYY A;  1L2S A;  4JPM A;  4S2M A;  3SOI A;  4KQO A;  1KVL A;  1XA7 A;  3BFC A;  4NK3 A;  3ZG0 A;  4N9L A;  1QMF A;  1BZA A;  1NYM A;  2DRW A;  1HTZ A;  1TEM A;  2ZC4 B;  5CTN A;  2ZM0 A;  4R1G A;  3QHY A;  3BLM A;  5FDH A;  2Y2L A;  4OQI A;  2Y2Q A;  1S6R A;  2ZQA A;  2Y2K A;  4HEF A;  4WYY A;  3Q7Z A;  4RX2 A;  3LEZ A;  4YIN A;  3MBZ A;  5EOE A;  5M18 A;  3CZD A;  1XGJ A;  3S1Y A;  4IVI A;  3OPP A;  3WS1 A;  3ISG A;  5CER A;  4MBK A;  3ZG8 B;  2HDQ A;  2JCH A;  1K57 C;  5EVI C;  5KZH A;  4E3K A;  4E6W A;  5GHX A;  3WS4 A;  4E6X A;  2C5W B;  2EXA A;  2DCF A;  1BLS A;  4P0M A;  1GA9 A;  3RJU A;  1KVM A;  3PTE A;  1FSY A;  5E43 A;  3HBR A;  1YT4 A;  4QD4 A;  4OPZ A;  2EXB A;  2DNS A;  2J8Y A;  3MZD A;  1RGY A;  2A49 A;  1KE0 A;  4OVD A;  4RX3 A;  5CGW A;  3AGE A;  1RCJ A;  3UE0 A;  5EE8 A;  1NZU A;  4MBH A;  1NZO A;  1BTL A;  3HVF A;  3OCL A;  5F1G A;  2WUQ A;  3CG5 A;  3VP1 A;  1E3U A;  4B88 A;  2Y59 A;  4YFM A;  4KZ4 A;  3W4Q A;  2Y2N A;  3I7J A;  4MNR A;  4PM8 A;  5AQB A;  5HFO A;  5FQ9 A;  3BLS A;  3UN7 A;  1YM1 A;  1JTG A;  3NC8 A;  1O07 A;  4RVA A;  2XD5 A;  1NXY A;  1CEG A;  1LL9 A;  3A3E A;  4RYE A;  2WAE A;  1YLJ A;  5TFQ A;  3SH9 A;  1YMS A;  1K55 A;  1PW8 A;  1YLW A;  5HX9 A;  2QPN A;  2G2W A;  4BLM A;  4E3O A;  5BOH A;  4ZJ1 A;  2IWC A;  4Y0T A;  2ZM8 A;  4FH2 A;  4XUX A;  3TOI A;  5FAT A;  1I2W A;  2HDU A;  2WK0 A;  4HES A;  2QMI A;  2V2F F;  1E3U D;  1K6R A;  4WMC A;  1XGI A;  5CHM A;  2JE5 A;  4U3T A;  3BFG A;  4JXW A;  1BUE A;  3V39 A;  2P9V B;  4K0W A;  3N6I A;  5GLB A;  3GMW A;  5CED A;  3UPN A;  5HW3 A;  2EFU A;  2XEP A;  4U0X A;  4UA6 A;  1IEM A;  4X53 A;  1N9B A;  1PWC A;  3O87 A;  2Z2M B;  3IF6 B;  3FV7 A;  2ZQ8 A;  3ZG7 B;  4X6T A;  4UA7 A;  4OP8 A;  5AQ9 A;  4KQQ A;  1TDL A;  3BFE A;  4MBF A;  3ZG9 B;  2V20 A;  2XFT A;  3O86 A;  1KGF A; 
#chains in the Genus database with same CATH topology
 4CQH A;  1KGE A;  2WKH A;  3OBF A;  3DTM A;  3PBS A;  5L09 A;  3P09 A;  5L07 A;  5EVL A;  3ITB A;  4X25 A;  2ZQD A;  3C7U A;  3QP5 A;  2W1R A;  3V5M A;  4LV0 A;  2IWD A;  2OWJ A;  3S22 A;  3N7W A;  1ZHH B;  2ZD8 A;  4FCF A;  5FI6 A;  1GCE A;  1BLC A;  5CX7 A;  1S1Z A;  3MFX A;  4U0T A;  3UB9 A;  3UME A;  2XA7 S;  4OLG A;  5CGS A;  2NUP C;  1PI5 A;  3NOP C;  5FDS A;  3D9Y A;  3LI8 A;  3M2J A;  2EX6 A;  1Y4O A;  4DDS A;  1ES3 A;  1VB6 A;  1DP6 A;  3Q1F A;  1TD5 A;  1AWI A;  3MKE A;  5CEC A;  4R3A A;  1FSW A;  4LLO B;  4JLF A;  4EQI A;  3ZFZ A;  1ES5 A;  3PBO A;  5AQA A;  5CGX A;  4GKU A;  5A92 A;  3CPT B;  3JPU A;  1T1A A;  2HZ5 A;  1FQG A;  3SH8 A;  2O99 A;  3DTE A;  4P6B A;  4OH0 A;  5CHJ A;  1ESI A;  3ZNY A;  1TVF A;  3UDX A;  2P9V A;  4R38 A;  4PPR A;  1T1C A;  2HV1 A;  3IWQ A;  2Y79 A;  3IF6 A;  2HP6 A;  1KOU A;  4IBX A;  5FAP A;  2PBY A;  4QJG A;  5FAQ A;  3QP6 A;  4F94 A;  1OJG A;  4OP5 A;  3GRJ A;  2QKP A;  3FWL A;  3ZNT A;  4OON A;  1TF1 A;  2X71 A;  1H8M A;  4JBF A;  5HDC A;  1LI9 A;  1K4F A;  1LT0 A;  3UE3 A;  3NHQ A;  3BEB A;  5HWT A;  2OLV A;  3GTC A;  4UAA A;  4K91 A;  3F1P A;  4N92 A;  4WMC D;  1TS7 A;  1NRF A;  2QJ5 A;  3JVU A;  2Y2I A;  3MFD A;  4KUO A;  1W8Q A;  1PI4 A;  1MWR A;  4NEE D;  1JWP A;  1OT6 A;  1J9M A;  1TS8 A;  3N4I A;  4DXC A;  1P9R A;  4KZ6 A;  3E4Q A;  4FTX A;  1DRM A;  4LGW A;  5CXW A;  3W4O A;  4DE1 A;  4MDZ A;  3Q7V B;  2HP5 A;  4LRY C;  3B42 A;  2XK1 A;  4ID4 A;  4KZA A;  4DE0 A;  3T1R A;  3VOY A;  1FCN A;  3CMZ A;  1IYS A;  3LGO A;  3C8C A;  3TSG A;  2VGL S;  1SCW A;  3CPT A;  1K55 C;  4O7D A;  5HL1 A;  4QY6 A;  4M4X A;  1NRJ A;  1STZ A;  5TBM B;  4S2L A;  3EGX C;  1S0W A;  3WWX A;  1H0M A;  3IBR A;  5E2G A;  4GDN A;  3BQ8 A;  2C6W B;  1ZG6 A;  2H28 A;  4K0X A;  3UB5 P;  5I94 A;  2OOL A;  4WBG A;  5IS1 A;  4NXB A;  4K08 A;  3F1N B;  4OQ0 A;  4EEU A;  4HHD A;  1PNE A;  3T4J A;  2Y55 A;  3O5Y A;  2QWS A;  4KZ7 A;  2ZL1 B;  3E98 A;  4L9G A;  3PAG A;  4X56 A;  3L9K A;  2HDS A;  1XFN A;  5HZH A;  1BUL A;  4PM7 A;  3TRC A;  3G34 A;  4I38 A;  1F2K A;  2XR0 A;  4L0L A;  1P9W A;  4JKT A;  1G6O A;  4DJ2 A;  4N1X A;  1GHI A;  3MZF A;  1YSQ A;  5FI7 A;  3KSI A;  2Y2H A;  2ZOH A;  2G2U A;  3NY4 A;  4QU3 A;  4FSF A;  1NYY A;  1GHP A;  3MSH A;  2PU4 A;  3UB7 A;  1OT9 A;  3JYI A;  4C75 A;  4LCL A;  5HPI A;  4HIA A;  3CWF A;  3LUQ A;  3Q7V A;  1K54 C;  4Y13 A;  3AGF A;  3LR0 A;  3ITA A;  4B4X A;  4CLC E;  1N4O A;  3ZVW A;  1N9N A;  3BYD A;  4BQM A;  2WKP A;  5TBM A;  3C38 A;  4LV3 A;  4WEJ A;  5HAI A;  1BLP A;  3SS4 A;  4ETZ A;  5HAQ A;  3UPP A;  1ZKJ A;  1WYB A;  1Y54 A;  3HLE A;  4LV1 A;  5HD3 A;  5M19 A;  5EVI B;  3R7W B;  2W1T A;  3D4F A;  4ZJ3 A;  1FOF A;  3OLO A;  2ZM2 A;  4Q0H A;  5FAO A;  3ZGA B;  1PYY A;  2VK3 A;  4JPM A;  2PT7 A;  3MJQ A;  2P04 A;  2LB5 A;  4B93 A;  3NOU C;  4NK3 A;  3F1N A;  1BZA A;  1NYM A;  1HTZ A;  2ZC4 B;  1NWZ A;  3QHY A;  2A2L A;  3LIA A;  4OQI A;  2Y2Q A;  2ZQA A;  3P7N A;  4WYY A;  2ZL1 A;  3Q7Z A;  3WS1 A;  3T4T A;  2JCH A;  2CMN A;  4P0M A;  1KVM A;  3PTE A;  5F68 A;  2J8Y A;  3MZD A;  1KE0 A;  4OVD A;  1RCJ A;  3V67 A;  4X1L A;  2D01 A;  1NZO A;  1BTL A;  3OCL A;  3T4Q A;  5HSQ A;  2Y59 A;  2O0Y A;  2W0N A;  2Y2N A;  2O9B A;  3I7J A;  1JTG A;  4JGR A;  2XD5 A;  4RYE A;  2WAE A;  2PDR A;  2G2W A;  4XT2 B;  4Y15 A;  1YKD A;  4Y5F A;  2ZM8 A;  3TOI A;  5FAT A;  1I2W A;  2FZ0 A;  2Y8H A;  3VV4 A;  2WK0 A;  4Y3I A;  1XJ6 A;  2PRF A;  4K0W A;  2KOI A;  1IEM A;  2M1C A;  1PWC A;  4I3I A;  3O87 A;  3FV7 A;  3CIT A;  1YPR A;  4OP8 A;  1TDL A;  4MBF A;  1KGF A;  4JXV A;  5EVI A;  5HDD A;  3R7W A;  3EEH A;  3M6B A;  4R4R A;  1K56 D;  3K3C A;  2QYB A;  3PR6 A;  3BFD A;  4OOL A;  5DF8 A;  4HQA A;  1HZO A;  3DTK A;  3VFH A;  4IHQ A;  4R3B A;  1ERM A;  1L0D A;  1U60 A;  4G3W A;  5F6A A;  2QZ6 A;  1V9Y A;  2K31 A;  1CI9 A;  5EVI D;  3O88 A;  2DMW A;  3C30 A;  2W3D A;  2Y91 A;  4MN5 A;  4EV4 A;  1LL8 A;  3MMH A;  3WRZ A;  3LO7 A;  3VMA A;  2R9W A;  1WA9 A;  3HRE A;  2QHK A;  3C4O A;  1ES4 A;  2V1Z A;  2VV7 A;  3SS5 A;  4EBN A;  5E2H A;  4E3I A;  3V3R A;  3NJA A;  2UV0 E;  3KX0 X;  5AVE A;  2VV8 A;  4JXG A;  1WYC A;  1LL5 A;  4X1M A;  1G6A A;  1DY6 A;  2NUT C;  4N9K A;  3V3S A;  2HP9 A;  3CJM A;  1DJC A;  4B4Z A;  3HLG A;  3HUN A;  2J7V A;  3LID A;  5GL9 A;  4PKY G;  1M40 A;  3OPL A;  3OPH A;  2L4R A;  3EOI A;  1YQS A;  4GW9 A;  3GR2 A;  3CHW P;  4KZB A;  4KG6 A;  3C2W A;  3FPW A;  4H6J B;  1MY8 A;  4JF4 A;  3GV9 A;  4KQR A;  4LV2 A;  4FD8 A;  1G28 A;  4GNU A;  2HJE A;  4DKI A;  1XJ3 A;  4WZ5 A;  2YKF A;  5DF9 A;  5A91 A;  4ZAM A;  4FH4 A;  3O3V A;  4G3V A;  1BLH A;  4P87 A;  4ETX A;  2WGI A;  4YNR A;  3BFF A;  2GZA A;  3W4P A;  5KMW A;  4XXR A;  4KUK A;  3BM6 A;  1KE4 A;  3LIF A;  3T1Q B;  4BD0 A;  2FFF B;  1Q2Q A;  1KE3 A;  2VKS A;  2R78 A;  1K57 A;  2O9C A;  2ZC7 A;  4S2J A;  4B9O A;  1H8Z A;  4HH2 A;  5FEG A;  4EWF A;  4OQH A;  3HLC A;  2Y2M A;  3M2K A;  5DVA A;  2PYR A;  3BJN A;  3BY8 A;  2H0T A;  3KYZ A;  3KYQ A;  4OLD A;  4S2N C;  2HJ9 C;  3T4K A;  2XDM A;  4Y7P A;  1EWZ A;  2V8C A;  5AVF A;  2XF3 A;  4UQI M;  4HI4 A;  4MCW A;  3NCK A;  4LEN A;  3RFB A;  3F1P B;  4CJN A;  2H10 A;  2EFX A;  4ZTK A;  2M7U A;  4ZJ2 A;  4OKP A;  3Q81 A;  4O01 A;  1J3W A;  1ERO A;  1JTD A;  1K4E A;  3MZE A;  3D72 A;  1KGG A;  1GSX A;  5FA7 A;  4M3K A;  4BJP A;  1OTB A;  4R0Q A;  1ZC2 A;  2J80 A;  1IYQ A;  3EQV A;  3S7P A;  4IUH A;  1CI8 A;  2OAQ 1;  2Q0O A;  1NJ4 A;  3QNB A;  5C5K A;  3G32 A;  3VP0 A;  1G5U A;  4H6J A;  4Y2F A;  1NLY A;  1OJ5 A;  3LYX A;  3LCE A;  2QJ7 A;  5EPH A;  3P01 A;  3SS3 A;  1OPX A;  3PBR A;  4GDB A;  3MKF A;  1MBL A;  1LSV A;  1W79 A;  2I72 A;  4IBR A;  3KSF A;  3H7W A;  3V50 A;  1MXO A;  2WKR A;  4X69 A;  4WUJ A;  5E2E A;  3S7O A;  1RP5 A;  4OPY A;  3G2Z A;  3CAX A;  3CLO A;  3MQQ A;  2J9O A;  3HUM A;  2IWB A;  4P6Z M;  1ERQ A;  1KDS A;  4KZ8 A;  5DTT A;  3HUO A;  4XUZ A;  3ZVT A;  4C3Q A;  5G4Z A;  2AVX A;  3G6O A;  3Q82 A;  1WE4 A;  2VLG A;  3ICY A;  1XPB A;  2JKR I;  1D7E A;  3LIC A;  4QWO A;  3E2K A;  5L2F A;  3N8S A;  3IHA A;  4BWI A;  5HWW A;  3MXS A;  4KQD A;  5F1F A;  3NDG A;  3IWO A;  2BTF P;  2Z6D A;  3IH9 A;  3P98 A;  2A3U A;  3CUE A;  2MJ6 A;  1LHY A;  4Y0U A;  1VQQ A;  2Z2L B;  2UWX A;  1AXB A;  1D06 A;  1SDN A;  1MWS A;  4UA9 A;  1EW0 A;  1HLU P;  5DFY A;  5AQ7 A;  5HL6 A;  4D60 A;  2WKQ A;  2PAV P;  5EVE A;  3DAV A;  4OQG A;  3OCN A;  1HD8 A;  4PKY A;  3LEQ A;  4JGP A;  2E8I A;  4GZB A;  5GLA A;  1G68 A;  2X01 A;  2ZQ7 A;  3RXX A;  5E2F A;  2I9V A;  5KSH A;  1OTD A;  2RCX A;  2VX8 A;  3QNC A;  2E8J A;  1LLB A;  2Y4A A;  3DW0 A;  1YLT A;  1SDE A;  3R4K A;  1YMX A;  4E04 A;  3N8L A;  3NUL A;  3MXR A;  5FSR A;  2YKH A;  1PIO A;  2B18 A;  4KQO A;  3SOI A;  1LSW A;  1W63 Q;  1QMF A;  3SZT A;  4Y17 A;  2W1T B;  4LFU A;  2VJW A;  3TE8 A;  4BMW A;  2PR5 A;  2Y2K A;  3LEZ A;  3MBZ A;  3EEA A;  4EU0 A;  1XGJ A;  3ZG8 B;  4MBK A;  5GHX A;  3WS4 A;  1BLS A;  2JKF A;  3T4O A;  1IOU A;  2PBD P;  4OPZ A;  3E4O A;  2EXB A;  1N9O A;  4NKP A;  3PXP A;  4RX3 A;  5CGW A;  3AGE A;  3F1O B;  5F1G A;  2WUQ A;  3CG5 A;  3VP1 A;  1E3U A;  4B88 A;  3JVV A;  4KZ4 A;  4R70 A;  5HFO A;  4PM8 A;  5FQ9 A;  3BLS A;  4EER A;  1O07 A;  1CEG A;  1LL9 A;  2V1B A;  5TFQ A;  3SH9 A;  5HX9 A;  4QPR A;  2HDU A;  3LR3 A;  1E3U D;  1K6R A;  1P0Z A;  3BFG A;  1S67 L;  2W3E A;  4AFI A;  5HW3 A;  3KSG A;  2EA9 A;  2ZQ8 A;  4GS9 B;  2XFT A;  2VZW A;  3GDI A;  2FFY A;  4GJ4 A;  5TJJ A;  5EEC A;  4WM9 A;  2XQZ A;  3QP1 A;  2W3H A;  1L0E A;  3C4P A;  2VEA A;  1YLZ A;  5GHY A;  1IFQ A;  3NEC A;  3UE1 A;  5JYP A;  1LSX A;  1E25 A;  3WRT A;  2ZC5 B;  3LFV A;  2K7S A;  4GD6 A;  3FPV A;  3LI9 A;  4Q8I A;  2PR6 A;  4EEP A;  3VP2 A;  2KLI A;  3KYE A;  4GHI B;  3E4P A;  4IUK A;  1PRQ A;  2EWW A;  5HWV A;  2HF6 A;  3IF5 A;  1JWV A;  2PD8 A;  2WGV A;  4NET A;  1I5Q A;  5J3W A;  2Q9N A;  4MLL A;  1O7E A;  4EUZ A;  1FR6 A;  1TDG A;  3E0Y A;  3IBJ A;  5FAS A;  1XFQ A;  5DKK A;  3F1O A;  1PWG A;  2H0Y A;  1VHM A;  5DJU A;  1Z09 A;  3IQA A;  3QP2 A;  4E3M A;  3H9W A;  3S7N A;  4QB8 A;  3BRM A;  2ZJ9 A;  5FI2 A;  5GLC A;  4PM5 A;  5J8X A;  4R6L A;  1VEU B;  2ACG A;  1S4S A;  2BLS A;  3FKV A;  4HJ4 A;  3FYZ A;  5U47 A;  2OSU A;  4RA7 A;  1OTE A;  3RXW A;  3G30 A;  5FEF A;  3KSH A;  2VGJ A;  1GHM A;  3FKW A;  1JWZ A;  4DE2 A;  1TS6 A;  2OV5 A;  4GS9 A;  3G4P A;  4L9E A;  2G7U A;  4LPZ A;  4CLC C;  3DWZ A;  2JC7 A;  2ZLY A;  3IS2 B;  2CC1 A;  5EFW A;  3B33 A;  4E3L A;  2WKI A;  1UGU A;  2A24 A;  2JN7 A;  3TW8 A;  3HLD A;  3H82 A;  4ESP A;  3LR4 A;  4GLQ A;  1VET B;  2Y2P A;  3HLW A;  1Z6F A;  4GOG A;  3NDE A;  5FQQ A;  3FG8 A;  5CRF A;  5A8B A;  4EXO A;  3IHB A;  2XH9 A;  4HBU A;  3IX3 A;  4BL3 A;  3B3X A;  3LIB A;  4JF5 A;  2WGW B;  1H5X A;  4S2P A;  1K38 A;  4GHI A;  1N9L A;  2ZC6 B;  4N1H A;  1XJ2 A;  1CF0 A;  3DBA A;  4MMN A;  3VSL A;  1ES2 A;  4DN0 A;  3FZC A;  2PD7 A;  4DE3 A;  4EW7 A;  2B5R A;  1CQA A;  3HLF A;  1XP4 A;  1OTI A;  3A0V A;  4C6Y A;  3NIA A;  4X55 A;  3PBQ A;  3FC7 A;  4PAU A;  4IED A;  2GJ3 A;  4CPK A;  5MC7 A;  3BY9 A;  3B47 A;  1YLY A;  5CTM A;  1IEL A;  1I2S A;  5G18 A;  1S4R A;  4NXG A;  1VEU A;  3HJI A;  1K25 A;  4O0P A;  4DJ3 A;  1A0K A;  2D02 A;  2XFS A;  1KDW A;  1D1J A;  3GQZ A;  5D3O A;  4GD8 A;  1YSP A;  2W3G A;  1S66 L;  4HP4 A;  2PHY A;  4PMA A;  1L3L A;  4S2N A;  2Y2O A;  2J3T D;  3IS2 A;  3VOZ A;  3IXH A;  4WEK A;  3WS5 A;  3C7V A;  4IJG A;  5JYO A;  1ALQ A;  1W63 M;  2GNX A;  1NY0 A;  3UO9 A;  2XA7 M;  4GN2 A;  4E3N A;  3MQO A;  4S2K A;  3ZHH A;  4II7 A;  1IYP A;  1VET A;  1ONG A;  4FUW A;  1MC0 A;  3AGD A;  3H7W B;  1T19 A;  1OME A;  5F82 A;  4QHC A;  4E3J A;  1XA1 A;  2BG1 A;  3A3D A;  3M6H A;  2WGW A;  1W7F A;  1XXM A;  1SZV A;  4UEY A;  1MWT A;  4BL2 A;  3MS6 A;  3U2A A;  3GVB A;  3ZG5 A;  2JKT I;  3BWL A;  1XX2 A;  4PM6 A;  4KEN B;  4GCZ A;  1TS0 A;  3OC2 A;  3VE4 A;  4BEN A;  4BBT A;  4S2I A;  1FCM A;  3OPR A;  3UDI A;  1CK3 A;  1FCO A;  3S4X A;  2GX5 A;  1S1Y A;  3IT9 A;  5FQK A;  1EI5 A;  2FH5 A;  3UNW A;  1T18 A;  2HPB A;  1H3Q A;  3WS2 A;  4Q0J A;  4LRX C;  4DDY A;  2OWH A;  2WZZ A;  5EM0 A;  5IHV A;  4DRT A;  5LBR A;  2P74 A;  5TR7 A;  4ARZ B;  1SHV A;  2JBF A;  4IVK A;  1YLP A;  4WZ5 C;  5GHZ A;  3IWI A;  3NBL A;  3G35 A;  4WN5 A;  3BW6 A;  1PWD A;  2M7V A;  1L2S A;  3S7Q A;  4S2M A;  1KVL A;  1XA7 A;  1FIK A;  3A0S A;  4N9L A;  2DRW A;  1TEM A;  3HJK A;  4L9F A;  2ZM0 A;  4R1G A;  3UB8 A;  5FDH A;  4NG2 A;  1S6R A;  3T50 A;  3UB6 A;  5EOE A;  5M18 A;  4RX2 A;  2P7J A;  3CZD A;  4WLA A;  3S1Y A;  4IVI A;  5K5B A;  3ISG A;  2HDQ A;  1K57 C;  4E3K A;  4E6W A;  4I5S A;  4E6X A;  1YAX A;  2DCF A;  2JKR M;  3RJU A;  1FSY A;  5E43 A;  3HBR A;  4HOI A;  3T1S A;  2EWV A;  3UE0 A;  5EE8 A;  1NZU A;  4I3J A;  4MN6 A;  4MBH A;  3HVF A;  5F69 A;  4YFM A;  4UQI S;  3W4Q A;  4MNR A;  1YM1 A;  2XRN A;  3NC8 A;  4RVA A;  3PYP A;  1NXY A;  3A3E A;  2VGL M;  1YMS A;  1K55 A;  2QPN A;  4BLM A;  4E3O A;  4ZJ1 A;  2IWC A;  4Y0T A;  4XUX A;  4WMC A;  5CHM A;  2JE5 A;  4U3T A;  1BUE A;  5GLB A;  3GMW A;  1GSW A;  5KIZ A;  4U0X A;  4UA6 A;  1N9B A;  4EQ1 A;  2Z2M B;  1XJ4 A;  4UA7 A;  3BFE A;  4ARZ A;  3O86 A;  2PYP A;  2ZQ9 A;  4NXE A;  2P08 A;  3W8K A;  1MZU A;  3DWK A;  3IXD A;  2ZMV A;  5DF7 A;  4QY5 A;  1PFL A;  5CEB A;  1PZO A;  2V9A A;  1PW1 A;  1UWN X;  3RH8 B;  2VA0 A;  2V8F A;  2WKE A;  4ZBE A;  4FOF A;  3G31 A;  2WZX A;  3GEC A;  4PHT A;  3MR0 A;  3IF6 C;  4P6Z S;  1DJA A;  4S2O A;  4R23 A;  3VP4 A;  2J3W A;  2Y2G A;  3D3O A;  3SW1 A;  4KG5 A;  1BSG A;  5EM1 A;  5F83 A;  3TJZ C;  3LIE A;  1NLZ A;  3RTY A;  2EX9 A;  3MQ0 A;  4JF6 A;  5EOO A;  1K54 A;  4R4S A;  3ULF A;  3WS0 A;  1BT5 A;  3CUE C;  3ZDJ A;  4OPR A;  4CLC B;  2WYX A;  1JNU A;  2HDR A;  2J9P A;  1E4D A;  5FQM A;  5L8M A;  4LCM A;  4BD1 A;  2W3F A;  2Z6C A;  2HGV A;  1L0G A;  4P85 A;  3LR5 A;  2B02 A;  5CHU A;  5GLD A;  4HP9 A;  2PU2 A;  4OPQ A;  4WF0 A;  3G2Y A;  3K2N A;  5IT5 A;  5TGF A;  3N8R A;  3VSK A;  3VFF A;  2V0W A;  3IX8 A;  2ZMA A;  2Q9M A;  1MPL A;  1ZG4 A;  3UDF A;  5J4E A;  3MXQ A;  3U4L P;  4OOM A;  4HBT A;  1ESU A;  3PBN A;  3W2Z A;  3DTI A;  1IKG A;  3BQA A;  1BYW A;  1ZTU A;  1MKI A;  2WAF A;  4EBL A;  2VGK A;  4BBV A;  1H8Y A;  5HAR A;  3OZH A;  3A3J A;  4WZ4 A;  4Z9Q A;  4GB7 A;  5L10 A;  2IA2 A;  4X68 A;  4EES A;  4HNB A;  1SKF A;  3NI9 A;  1M6K A;  1CEF A;  1LI0 A;  2A24 B;  4KG2 A;  5FQJ A;  3T4L A;  3HL9 A;  3H82 B;  2W27 A;  1C3B A;  3IX4 A;  5DKL A;  4R3J A;  3LY3 A;  5A93 A;  1IYO A;  5IU1 A;  4A5R A;  4D2O A;  5J7E A;  4WEL A;  4HH3 A;  3A3I A;  4WL9 A;  5DJT A;  4JXS A;  3T12 B;  3KO6 A;  4HY8 A;  3VP3 A;  1QME A;  3GSG A;  4F3L B;  3T1X A;  4CLC A;  3HLB A;  3IH8 A;  1GSV A;  2R9X A;  2EX2 A;  2Y2J A;  3PAE A;  4H8R A;  5HD5 A;  4DF6 A;  2XGN A;  3UY6 A;  2EX8 A;  1W8Y A;  3A0R A;  2XD1 A;  3UMD A;  4DXB A;  2LB9 A;  4CLC D;  1P97 A;  2L0W A;  2OLU A;  4YWZ A;  5DTS A;  3A3F A;  2GDN A;  3K3D A;  3ZCZ A;  2INW A;  5KSC A;  1ACF A;  1K6S A;  3CI6 A;  2V0U A;  3TG9 A;  1MWU A;  4UHU A;  3VOL A;  1F9I A;  3PBT A;  3SH7 A;  2XLN A;  3IXG A;  4YOF A;  5EUA A;  3L7H A;  4I3A A;  3ZQ5 A;  1L0F A;  2BAS A;  1FR1 A;  3E2L A;  1HVB A;  3Q07 A;  1W5D A;  3C5A A;  1V9Z A;  3EWK A;  3QP8 A;  1PZP A;  1F5M A;  1IKI A;  1RGZ A;  1UWP X;  4ZDX A;  4MEZ A;  4EUV A;  4BBU A;  2H5S A;  3EQU A;  1ONH A;  2XRO A;  1Q2P A;  5FQI A;  5A90 A;  1K56 A;  4Y0O A;  3IXB A;  4HJ3 A;  4PM9 A;  1VM1 A;  4KZ3 A;  4NXF A;  4RQ9 A;  4KZ5 A;  4Q0I A;  5HAP A;  2JHE A;  5DTK A;  1DP8 A;  1K0K A;  4DMZ A;  1FIL A;  2RL3 A;  5F5Y A;  4LRZ E;  1F98 A;  4EBP A;  1DJB A;  2KX6 A;  4F3L A;  1SKO B;  1GA0 A;  3UPO A;  2WAD A;  3BEC A;  1XKZ A;  4MN7 A;  3QP4 A;  2K2N A;  2O9A A;  3NOT C;  3OOV A;  3EGD C;  1OTA A;  3ZYT A;  4KZ9 A;  5M1A A;  4OOY A;  3LY4 A;  3VE3 A;  2X02 A;  1CJF A;  1JVJ A;  2ZQC A;  2ZC3 B;  3HCY A;  2ZOI A;  2ZMF A;  2JKG A;  4O8G A;  3BFC A;  3ZG0 A;  2L1M A;  5CTN A;  4Z1W A;  4I39 A;  3PHY A;  5FL3 A;  3BLM A;  1T1B A;  2Y2L A;  4HEF A;  4YIN A;  3OPP A;  5CER A;  5KZH A;  5EVI C;  2C5W B;  2EXA A;  5DFX A;  1GA9 A;  1YT4 A;  4QD4 A;  5HDS A;  5I5L A;  2DNS A;  4EET B;  1RGY A;  2A49 A;  2B95 A;  3T4S A;  3UE6 A;  4XT2 A;  2JKT M;  1DP9 A;  4HJ6 A;  5HPF A;  2V1A A;  1Y28 A;  5AQB A;  3UN7 A;  2OAP 1;  4ZRR A;  2XSS A;  1YLJ A;  4ME4 A;  1PW8 A;  1YLW A;  5AJG A;  5BOH A;  1X0O A;  4G3K A;  1ODV A;  4FH2 A;  5G4Y A;  5EV0 A;  4HES A;  2QMI A;  1SKO A;  2V2F F;  1XGI A;  3MF0 A;  4JGO A;  4JXW A;  3V39 A;  2J3T C;  1MKM A;  2P9V B;  3N6I A;  5CED A;  2ZBB A;  3UPN A;  2EFU A;  2XEP A;  4JGQ A;  2VV6 A;  4X53 A;  2KDK A;  3IF6 B;  3ZG7 B;  4X6T A;  5AQ9 A;  4KQQ A;  3ZG9 B;  2V20 A; 
#chains in the Genus database with same CATH homology
 2ZQ9 A;  4JXV A;  2FFY A;  5EVI A;  1KGE A;  2WKH A;  5EEC A;  3M6B A;  3DTM A;  3PBS A;  4WM9 A;  3P09 A;  3W8K A;  2XQZ A;  4R4R A;  3DWK A;  1K56 D;  3IXD A;  5EVL A;  3ITB A;  2ZQD A;  1L0E A;  3BFD A;  3C7U A;  3C4P A;  4QY5 A;  5DF7 A;  1YLZ A;  5GHY A;  3V5M A;  4LV0 A;  4OOL A;  2IWD A;  5DF8 A;  5CEB A;  1HZO A;  3UE1 A;  5JYP A;  3VFH A;  1PZO A;  4R3B A;  3S22 A;  3N7W A;  1E25 A;  3WRT A;  1ERM A;  1L0D A;  1PW1 A;  2ZC5 B;  1U60 A;  2ZD8 A;  4FCF A;  5FI6 A;  1GCE A;  2WKE A;  4ZBE A;  1BLC A;  4GD6 A;  2QZ6 A;  4U0T A;  3G31 A;  2WZX A;  1CI9 A;  4OLG A;  5CGS A;  5EVI D;  3IF6 C;  3O88 A;  4Q8I A;  1PI5 A;  2Y91 A;  1DJA A;  4S2O A;  4EV4 A;  3VP2 A;  3M2J A;  2EX6 A;  4DDS A;  4R23 A;  3VP4 A;  3WRZ A;  3LO7 A;  3VMA A;  1ES3 A;  2R9W A;  3HRE A;  3IF5 A;  3C4O A;  1ES4 A;  2Y2G A;  1JWV A;  2V1Z A;  2WGV A;  3SS5 A;  4EBN A;  5E2H A;  4NET A;  4KG5 A;  3Q1F A;  1I5Q A;  4E3I A;  1BSG A;  3V3R A;  2Q9N A;  3MKE A;  4MLL A;  1O7E A;  5F83 A;  4EUZ A;  1FR6 A;  1FSW A;  1TDG A;  5CEC A;  5FAS A;  4JLF A;  4JXG A;  1WYC A;  2EX9 A;  1LL5 A;  1PWG A;  4JF6 A;  3ZFZ A;  2H0Y A;  1G6A A;  4EQI A;  1DY6 A;  1ES5 A;  3IQA A;  5EOO A;  1K54 A;  3PBO A;  5AQA A;  4E3M A;  4R4S A;  4N9K A;  3V3S A;  3WS0 A;  2HP9 A;  5CGX A;  3CJM A;  1BT5 A;  1DJC A;  3ZDJ A;  4B4Z A;  3HLG A;  4GKU A;  4OPR A;  5A92 A;  4QB8 A;  2WYX A;  3HUN A;  2J7V A;  2HDR A;  3BRM A;  2J9P A;  1E4D A;  5GL9 A;  1M40 A;  3OPL A;  2ZJ9 A;  3OPH A;  1YQS A;  5FI2 A;  5FQM A;  1FQG A;  3GR2 A;  5GLC A;  4PM5 A;  3SH8 A;  5J8X A;  4KZB A;  4LCM A;  4KG6 A;  4BD1 A;  1L0G A;  4P85 A;  2BLS A;  1MY8 A;  4JF4 A;  3GV9 A;  4P6B A;  3FKV A;  5CHU A;  3FYZ A;  5U47 A;  4KQR A;  4OH0 A;  4LV2 A;  5GLD A;  2OSU A;  2PU2 A;  1ESI A;  4FD8 A;  4OPQ A;  4RA7 A;  1TVF A;  5CHJ A;  3ZNY A;  3RXW A;  3UDX A;  3G2Y A;  3G30 A;  2P9V A;  4GNU A;  5TGF A;  2VGJ A;  1GHM A;  3FKW A;  3N8R A;  4PPR A;  3VFF A;  3VSK A;  4DKI A;  1JWZ A;  4WZ5 A;  4DE2 A;  3IWQ A;  3IF6 A;  2OV5 A;  2HP6 A;  5DF9 A;  5A91 A;  5TR7 A;  3G4P A;  4ZAM A;  4IBX A;  5FAP A;  2PBY A;  2ZMA A;  4QJG A;  5FAQ A;  2Q9M A;  1MPL A;  4FH4 A;  3O3V A;  1BLH A;  4F94 A;  3DWZ A;  2JC7 A;  1ZG4 A;  2ZLY A;  4P87 A;  3UDF A;  2WGI A;  2CC1 A;  4OP5 A;  3GRJ A;  4OOM A;  4HBT A;  3FWL A;  1ESU A;  3PBN A;  3BFF A;  4E3L A;  2WKI A;  3W4P A;  3ZNT A;  4OON A;  1IKG A;  4XXR A;  5KMW A;  2X71 A;  3BM6 A;  3HLD A;  1KE4 A;  1MKI A;  2WAF A;  4EBL A;  4BD0 A;  4JBF A;  2Y2P A;  2FFF B;  3HLW A;  1LI9 A;  1K4F A;  1Q2Q A;  1Z6F A;  1KE3 A;  2VGK A;  4S2J A;  1K57 A;  2ZC7 A;  4GOG A;  1H8Y A;  3NDE A;  3UE3 A;  5HAR A;  5FQQ A;  3OZH A;  3BEB A;  5CRF A;  1H8Z A;  3A3J A;  4WZ4 A;  4Z9Q A;  4GB7 A;  2OLV A;  3IHB A;  2XH9 A;  4HBU A;  4X68 A;  4EWF A;  3GTC A;  4UAA A;  4OQH A;  3HLC A;  2Y2M A;  4K91 A;  3M2K A;  1SKF A;  3B3X A;  1M6K A;  1CEF A;  1LI0 A;  3NI9 A;  4N92 A;  4WMC D;  5DVA A;  4JF5 A;  2WGW B;  4KG2 A;  2H0T A;  1H5X A;  4S2P A;  5FQJ A;  1NRF A;  4OLD A;  4S2N C;  2Y2I A;  3HL9 A;  1K38 A;  3MFD A;  2ZC6 B;  1W8Q A;  1PI4 A;  1C3B A;  4N1H A;  1MWR A;  2XDM A;  1JWP A;  4Y7P A;  1EWZ A;  1J9M A;  3N4I A;  4DXC A;  2XF3 A;  4KZ6 A;  3VSL A;  4R3J A;  3LY3 A;  5A93 A;  1IYO A;  1ES2 A;  4A5R A;  5CXW A;  3FZC A;  4D2O A;  3NCK A;  4LEN A;  4DE3 A;  2B5R A;  3HLF A;  1XP4 A;  4C6Y A;  3W4O A;  2H10 A;  4CJN A;  4DE1 A;  4WEL A;  3NIA A;  3Q7V B;  2EFX A;  2HP5 A;  3A3I A;  2XK1 A;  4ID4 A;  4KZA A;  4ZTK A;  4X55 A;  4DE0 A;  3VOY A;  3PBQ A;  4JXS A;  1FCN A;  3CMZ A;  4ZJ2 A;  4IED A;  1IYS A;  1QME A;  4OKP A;  3GSG A;  3VP3 A;  3Q81 A;  4CPK A;  1ERO A;  1JTD A;  1K4E A;  3MZE A;  3TSG A;  1YLY A;  1SCW A;  1KGG A;  1K55 C;  5FA7 A;  4M3K A;  4BJP A;  3HLB A;  3IH8 A;  4O7D A;  4R0Q A;  5CTM A;  4QY6 A;  1ZC2 A;  2R9X A;  1IEL A;  2EX2 A;  5HL1 A;  1IYQ A;  2Y2J A;  3EQV A;  4S2L A;  1I2S A;  5G18 A;  1CI8 A;  3PAE A;  1S0W A;  3WWX A;  1NJ4 A;  5E2G A;  4H8R A;  3QNB A;  4GDN A;  2C6W B;  1K25 A;  3G32 A;  1ZG6 A;  3VP0 A;  4DF6 A;  2XGN A;  2XFS A;  3UY6 A;  1KDW A;  2EX8 A;  1W8Y A;  3LCE A;  4K0X A;  5I94 A;  3GQZ A;  5EPH A;  2XD1 A;  3SS3 A;  5D3O A;  4WBG A;  4GD8 A;  4DXB A;  3PBR A;  4GDB A;  3MKF A;  1MBL A;  1W79 A;  2OLU A;  4PMA A;  2I72 A;  5DTS A;  4S2N A;  2Y2O A;  4IBR A;  3V50 A;  1MXO A;  4OQ0 A;  3A3F A;  2GDN A;  4X69 A;  3VOZ A;  3IXH A;  5E2E A;  4WEK A;  3ZCZ A;  1RP5 A;  3WS5 A;  5KSC A;  1K6S A;  4OPY A;  3G2Z A;  3C7V A;  5JYO A;  1ALQ A;  2J9O A;  2Y55 A;  1NY0 A;  3TG9 A;  3HUM A;  4KZ7 A;  1MWU A;  3UO9 A;  4UHU A;  4GN2 A;  4E3N A;  3PBT A;  4S2K A;  3SH7 A;  2XLN A;  3IXG A;  2IWB A;  3PAG A;  3ZHH A;  1ERQ A;  5EUA A;  1KDS A;  4X56 A;  4KZ8 A;  5DTT A;  1IYP A;  2HDS A;  1ONG A;  3HUO A;  1BUL A;  3AGD A;  4PM7 A;  4XUZ A;  3ZVT A;  4C3Q A;  3G34 A;  1L0F A;  1OME A;  5F82 A;  4QHC A;  1FR1 A;  3E2L A;  1HVB A;  3Q07 A;  1W5D A;  1WE4 A;  3C5A A;  3Q82 A;  4E3J A;  1XA1 A;  2XR0 A;  4L0L A;  1PZP A;  2BG1 A;  1XPB A;  3A3D A;  1IKI A;  1RGZ A;  3M6H A;  4JKT A;  4ZDX A;  2WGW A;  4N1X A;  1W7F A;  1GHI A;  3E2K A;  3MZF A;  4MEZ A;  5L2F A;  1XXM A;  2H5S A;  5FI7 A;  3EQU A;  3N8S A;  2Y2H A;  3IHA A;  1ONH A;  1MWT A;  2G2U A;  4BL2 A;  3NY4 A;  1Q2P A;  4QU3 A;  5FQI A;  3MXS A;  1NYY A;  4FSF A;  1GHP A;  1K56 A;  5A90 A;  2PU4 A;  5F1F A;  3NDG A;  3IWO A;  3GVB A;  3JYI A;  3ZG5 A;  4C75 A;  4Y0O A;  3IXB A;  4LCL A;  3IH9 A;  3P98 A;  4PM9 A;  1XX2 A;  1VM1 A;  4KZ3 A;  2A3U A;  4PM6 A;  4KZ5 A;  4KEN B;  5HAP A;  3OC2 A;  1LHY A;  4Y0U A;  1VQQ A;  3Q7V A;  4BEN A;  1K54 C;  2Z2L B;  5DTK A;  3AGF A;  4S2I A;  1FCM A;  2UWX A;  1AXB A;  3OPR A;  2RL3 A;  1SDN A;  3UDI A;  1MWS A;  4UA9 A;  3ITA A;  1CK3 A;  4EBP A;  1DJB A;  4B4X A;  1FCO A;  1N4O A;  5AQ7 A;  3ZVW A;  3S4X A;  1GA0 A;  3IT9 A;  5FQK A;  3BYD A;  4BQM A;  1EI5 A;  3UPO A;  2WAD A;  3UNW A;  2HPB A;  4OQG A;  3OCN A;  3WS2 A;  3BEC A;  1HD8 A;  1XKZ A;  4LV3 A;  4WEJ A;  4DDY A;  2WZZ A;  5HAI A;  1BLP A;  3SS4 A;  5HAQ A;  2E8I A;  5IHV A;  4DRT A;  2P74 A;  3UPP A;  1ZKJ A;  4GZB A;  1G68 A;  1WYB A;  1Y54 A;  3HLE A;  1SHV A;  4LV1 A;  5GLA A;  2ZQ7 A;  2X01 A;  5M19 A;  5EVI B;  3RXX A;  4KZ9 A;  5E2F A;  2JBF A;  5M1A A;  5KSH A;  2RCX A;  3QNC A;  4IVK A;  4OOY A;  1YLP A;  3D4F A;  3LY4 A;  4WZ5 C;  4ZJ3 A;  1FOF A;  2X02 A;  1LLB A;  2Y4A A;  3DW0 A;  5GHZ A;  2ZM2 A;  1YLT A;  5FAO A;  1SDE A;  3IWI A;  3ZGA B;  1JVJ A;  1YMX A;  2ZQC A;  3NBL A;  3N8L A;  3G35 A;  4BL3 A;  3MXR A;  2ZC3 B;  5FSR A;  1PIO A;  1PWD A;  1PYY A;  1L2S A;  4JPM A;  4S2M A;  3SOI A;  4KQO A;  1KVL A;  1XA7 A;  3BFC A;  4NK3 A;  3ZG0 A;  4N9L A;  1QMF A;  1BZA A;  1NYM A;  2DRW A;  1HTZ A;  1TEM A;  2ZC4 B;  5CTN A;  2ZM0 A;  4R1G A;  3QHY A;  3BLM A;  5FDH A;  2Y2L A;  4OQI A;  2Y2Q A;  1S6R A;  2ZQA A;  2Y2K A;  4HEF A;  4WYY A;  3Q7Z A;  4RX2 A;  3LEZ A;  4YIN A;  3MBZ A;  5EOE A;  5M18 A;  3CZD A;  1XGJ A;  3S1Y A;  4IVI A;  3OPP A;  3WS1 A;  3ISG A;  5CER A;  4MBK A;  3ZG8 B;  2HDQ A;  2JCH A;  1K57 C;  5EVI C;  5KZH A;  4E3K A;  4E6W A;  5GHX A;  3WS4 A;  4E6X A;  2C5W B;  2EXA A;  2DCF A;  1BLS A;  4P0M A;  1GA9 A;  3RJU A;  1KVM A;  3PTE A;  1FSY A;  5E43 A;  3HBR A;  1YT4 A;  4QD4 A;  4OPZ A;  2EXB A;  2DNS A;  2J8Y A;  3MZD A;  1RGY A;  2A49 A;  1KE0 A;  4OVD A;  4RX3 A;  5CGW A;  3AGE A;  1RCJ A;  3UE0 A;  5EE8 A;  1NZU A;  4MBH A;  1NZO A;  1BTL A;  3HVF A;  3OCL A;  5F1G A;  2WUQ A;  3CG5 A;  3VP1 A;  1E3U A;  4B88 A;  2Y59 A;  4YFM A;  4KZ4 A;  3W4Q A;  2Y2N A;  3I7J A;  4MNR A;  4PM8 A;  5AQB A;  5HFO A;  5FQ9 A;  3BLS A;  3UN7 A;  1YM1 A;  1JTG A;  3NC8 A;  1O07 A;  4RVA A;  2XD5 A;  1NXY A;  1CEG A;  1LL9 A;  3A3E A;  4RYE A;  2WAE A;  1YLJ A;  5TFQ A;  3SH9 A;  1YMS A;  1K55 A;  1PW8 A;  1YLW A;  5HX9 A;  2QPN A;  2G2W A;  4BLM A;  4E3O A;  5BOH A;  4ZJ1 A;  2IWC A;  4Y0T A;  2ZM8 A;  4FH2 A;  4XUX A;  3TOI A;  5FAT A;  1I2W A;  2HDU A;  2WK0 A;  4HES A;  2QMI A;  2V2F F;  1E3U D;  1K6R A;  4WMC A;  1XGI A;  5CHM A;  2JE5 A;  4U3T A;  3BFG A;  4JXW A;  1BUE A;  3V39 A;  2P9V B;  4K0W A;  3N6I A;  5GLB A;  3GMW A;  5CED A;  3UPN A;  5HW3 A;  2EFU A;  2XEP A;  4U0X A;  4UA6 A;  1IEM A;  4X53 A;  1N9B A;  1PWC A;  3O87 A;  2Z2M B;  3IF6 B;  3FV7 A;  2ZQ8 A;  3ZG7 B;  4X6T A;  4UA7 A;  4OP8 A;  5AQ9 A;  4KQQ A;  1TDL A;  3BFE A;  4MBF A;  3ZG9 B;  2V20 A;  2XFT A;  3O86 A;  1KGF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...