5G18A

Direct observation of active-site protonation states in a class a beta lactamase with a monobactam substrate
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
261
structure length
261
Chain Sequence
NSVQQQLEALEKSSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTAPTLNTAIPGDPRDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQPEQKAENRNDILAAAAKIVTHGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE CTX-M-97
publication title Active-Site Protonation States in an Acyl-Enzyme Intermediate of a Class A beta-Lactamase with a Monobactam Substrate.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 88
structure length 261
sequence length 261
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2016-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5g18A00
1FR1A 1PIOA 2XF3A 5HX9A 3W4PA 1L0EA 3M6BA 2ZMAA 1N9BA 2H5SA 1W7FA 2ZM8A 4N92A 4R23A 4X55A 3BRMA 3HUMA 1NY0A 1EI5A 1XPBA 1JTGA 1E3UD 2FFFB 3TG9A 5A90A 4PM5A 2WGVA 2R9XA 2XD5A 4EBPA 3ZCZA 4KQRA 4JXSA 3LO7A 5FQQA 4E6XA 3C4OA 5FSRA 3MBZA 3SS3A 2XQZA 1KDSA 1ESUA 1S0WA 1GCEA 1BTLA 2WZXA 4OONA 4MBKA 3BM6A 1IELA 5I94A 4LV2A 4GB7A 3RXWA 2V2FF 1NZUA 3ITAA 5EVIB 2PBYA 4IBXA 2Y2LA 1K38A 3MZEA 4GKUA 3E2LA 4OQHA 5EOEA 1YQSA 5HAPA 4KZBA 4ZDXA 1GA9A 2ZC7A 4YFMA 2ZQ9A 3NI9A 5KSCA 2J9OA 3O3VA 1ES5A 4GD6A 3HUOA 4EQIA 4A5RA 2P74A 3G31A 3LEZA 5CEBA 2BLSA 3DWZA 3O88A 4Q8IA 1KGFA 3ZNTA 3M2JA 3BFGA 2OLUA 1XX2A 1BLPA 1L2SA 2ZQ7A 3G32A 1MWTA 2HDRA 3TOIA 4DE1A 2EFUA 1DJCA 3BFDA 5FQMA 5EVID 1K56D 3LCEA 3LY4A 2EFXA 5EVIA 3IWIA 5CTMA 4DF6A 3V5MA 3IXHA 2WAEA 2JCHA 2XGNA 5EVIC 1XGIA 3IQAA 3VOYA 1G6AA 4OOYA 2HDQA 1U60A 2HP6A 4N1XA 1BLCA 5FAOA 4KG2A 5FA7A 5M19A 3FYZA 3NDGA 4EBLA 3PBOA 1G68A 1ZG6A 1K54A 3I7JA 2EX6A 5KZHA 2J9PA 3LY3A 4LCLA 4CPKA 1I2WA 1N4OA 4DE2A 1K6RA 3RJUA 2PU2A 1PYYA 3M6HA 4OQ0A 2XR0A 4OPYA 5A93A 5CHMA 2E8IA 5GL9A 1FCNA 1FSWA 3W4OA 4FH2A 3A3JA 1BUEA 4ZBEA 5CGWA 4OH0A 4P6BA 1YLJA 1ES2A 3HUNA 3AGFA 4KG5A 1LHYA 3HLDA 1NRFA 4R3JA 4HBTA 4X6TA 2Y2IA 4GZBA 1BSGA 3M2KA 2WYXA 3G34A 4N9KA 5EECA 3HBRA 1HVBA 2XFSA 5L2FA 2JBFA 1E25A 4PM8A 4FCFA 3OZHA 3A3IA 3GTCA 4FSFA 2P9VB 3IHAA 4K0WA 5FQ9A 3FKVA 2IWBA 5EVLA 3NIAA 1TVFA 3AGEA 4KZ8A 2EXBA 4RVAA 2ZQ8A 4X53A 5AQ7A 4QB8A 4JLFA 4QHCA 1YLPA 3GVBA 1BLHA 2Q9NA 2Y59A 3G35A 1I5QA 1PI4A 1S6RA 4LV0A 3W4QA 4C3QA 4JXVA 1NZOA 3FV7A 1TDLA 2RL3A 5CXWA 3TSGA 1ERMA 3OCNA 4KZ7A 4IVKA 4WELA 1GA0A 1YMXA 3B3XA 4MBFA 5F1GA 4QD4A 2QPNA 3V39A 4RYEA 1CK3A 5EE8A 3WRTA 3ZFZA 1EWZA 4PM6A 4B4ZA 3IH9A 1BLSA 1NJ4A 4MNRA 3PBQA 1K6SA 5FDHA 1SDNA 4XXRA 5GHXA 3WS0A 2R9WA 2XH9A 3NCKA 1TEMA 3A3EA 5HL1A 3HVFA 1JWZA 4PM7A 1RGYA 5DF9A 1KVMA 2DCFA 3Q7VB 1KGEA 2I72A 5F83A 3D4FA 3MZFA 1E3UA 4R3BA 4JBFA 1FQGA 5HARA 1EROA 1L0GA 3VP3A 3N8RA 1RGZA 2OLVA 5EPHA 5JYOA 1O07A 2Y91A 4RX2A 3UE3A 3DW0A 1OMEA 3BEBA 5FATA 1PZPA 1XA7A 4OKPA 3VFFA 4L0LA 3HLGA 5CHUA 4WEKA 4E3KA 4X69A 5FI6A 3PBSA 2XLNA 3BLMA 1NXYA 2EXAA 1K25A 2X71A 3BYDA 1XA1A 3C7VA 3FKWA 3G2ZA 5JYPA 3VOZA 1SKFA 1H8YA 1PWGA 3V3RA 3S4XA 1NYMA 1TDGA 3GR2A 1Q2PA 3VSLA 4C75A 2Y2GA 3ZG7B 3CJMA 1KE3A 1KE4A 3BECA 2WUQA 4F94A 2C6WB 1CI9A 1IYSA 2IWCA 3BFCA 3ZVWA 4OOMA 2ZC5B 3SH9A 3ZG0A 3EQVA 3Q7VA 1C3BA 5F82A 4EUZA 1LL5A 2G2WA 3NC8A 4N1HA 4ZJ2A 1ONHA 4C6YA 4ZTKA 5EOOA 4OP8A 2Y2MA 1CEFA 4Y0UA 3G2YA 4GNUA 5G18A 3VP4A 1JWPA 4K91A 4U0XA 4RX3A 5GLCA 4GOGA 4DE0A 1DY6A 1IKGA 1O7EA 3PBTA 2J7VA 1ES4A 1H8ZA 1K56A 3SH8A 3UE1A 2Z2MB 2Y4AA 3EQUA 3MKFA 2Y2KA 4OLDA 4BENA 3WS2A 5BOHA 1W5DA 2V1ZA 2Y2HA 3AGDA 4JF5A 2X01A 5M1AA 5KMWA 4LV1A 1XP4A 5HW3A 4BD1A 1FCOA 4S2PA 1JWVA 3OPPA 3WS4A 2OSUA 4KZ6A 2XD1A 3VFHA 4BL3A 3MZDA 1QMFA 4R4SA 5DTKA 5HAIA 2V20A 2ZLYA 2Y2PA 1K4FA 3UO9A 3C7UA 1L0DA 2XFTA 4DDYA 4LV3A 4P0MA 4WMCD 3UDXA 1MBLA 1VQQA 1BT5A 5DTSA 3HLFA 5E2GA 2ZC3B 3RXXA 4ZAMA 4P87A 1MPLA 1MWSA 4BJPA 3ZDJA 3VSKA 4S2OA 4UA7A 3O87A 4ZJ3A 4DDSA 3N8SA 1YLWA 3P09A 2GDNA 5FAQA 4U0TA 2Y2JA 5TGFA 3A3DA 2HDSA 3ISGA 3UPPA 1LL9A 5AQAA 1MY8A 1MWRA 4HBUA 4PM9A 1IKIA 1Z6FA 3ZGAB 3MKEA 2QMIA 4UHUA 4WBGA 5AQ9A 4BD0A 3GV9A 1W8QA 3Q82A 5TFQA 5CECA 5CGXA 2A3UA 5FQIA 4BL2A 2WKEA 5HAQA 3C5AA 1GHIA 4EWFA 3MXRA 4BQMA 3A3FA 4JXGA 3ZG8B 1CEGA 3OCLA 3MXSA 1YM1A 2WGWB 4E3JA 3UN7A 1SDEA 4OPQA 3ZG9B 3V3SA 3JYIA 4BLMA 3ITBA 1HZOA 4RA7A 4M3KA 1ONGA 1GHMA 2Y2NA 3QHYA 4LCMA 2OV5A 2CC1A 1HTZA 3PBNA 5EUAA 4QY6A 4KQOA 4MEZA 2ZC4B 4NETA 4R1GA 3MFDA 3PAEA 4KG6A 5F1FA 2ZQCA 2QZ6A 3VP2A 1MWUA 1KGGA 3Q7ZA 4GDNA 4MLLA 1BULA 5TR7A 1PW1A 2WK0A 5FI7A 3VP1A 5CEDA 5GLDA 3GMWA 1NYYA 1RCJA 1YLTA 2ZJ9A 2DRWA 3N4IA 1LI9A 1WE4A 1PW8A 2P9VA 1XKZA 1ALQA 4OOLA 1L0FA 1SHVA 4S2NC 2VGJA 4R4RA 4WM9A 2WGWA 4DE3A 2HPBA 4FH4A 4KENB 5E2EA 4JKTA 5DVAA 1QMEA 1H5XA 4K0XA 3Q81A 5CRFA 3SOIA 2H10A 4O7DA 2BG1A 1DJAA 4P85A 1J9MA 4OLGA 3W8KA 3ZVTA 4EV4A 1DJBA 3OC2A 3BFFA 4QJGA 4S2MA 1PZOA 1CI8A 1ESIA 1K4EA 2VGKA 3PTEA 2WAFA 2Z2LB 1MXOA 2ZC6B 1IYQA 4S2KA 2HP5A 4DXCA 4E3IA 5FQJA 3HL9A 5M18A 3OPHA 1M6KA 3UPNA 3VMAA 1SCWA 5HFOA 1ZKJA 3HLBA 2Y2OA 3SS4A 2RCXA 3O86A 3HREA 5GLBA 4KQQA 2EX9A 1XXMA 5A92A 2J8YA 4X68A 1PI5A 5CGSA 3BFEA 3G30A 2JC7A 1JVJA 4CJNA 2B5RA 3PBRA 4IEDA 1K57A 3NBLA 1FSYA 3HLWA 3Q07A 3S22A 1FCMA 4XUZA 2ZM0A 4XUXA 1K57C 2JE5A 1ZC2A 4B88A 4DRTA 2ZQAA 4JF4A 4E6WA 4PMAA 5AQBA 4WZ4A 1YT4A 4E3NA 3CMZA 3IF5A 5IHVA 1KE0A 3QNBA 4LENA 5E2FA 1KVLA 4N9LA 2G2UA 1WYBA 1YLYA 4KZAA 4E3LA 2ZD8A 1WYCA 5DF8A 4UA6A 1W8YA 2EX2A 3VP0A 5FAPA 4DKIA 3CZDA 4U3TA 3UNWA 3ZHHA 1GHPA 4Y0TA 3PAGA 4OQIA 3WRZA 3WS5A 1KDWA 4OPZA 3G4PA 4EBNA 1YMSA 1MKIA 3UDIA 3UDFA 1PWCA 3OPLA 3GQZA 2WKHA 4JXWA 4KZ5A 4YINA 2WZZA 3FWLA 1E4DA 4H8RA 4WMCA 4S2IA 5E2HA 2Y2QA 4E3MA 1JTDA 4Y0OA 4KZ4A 5GHYA 2EX8A 3BLSA 1LLBA 2XDMA 4KZ9A 3SS5A 3FZCA 4E3OA 2H0YA 1Q2QA 4OP5A 1AXBA 1Y54A 4B4XA 2ZQDA 3IF6B 3WWXA 4GD8A 3HLCA 1K55A 4HEFA 1FR6A 3NDEA 4GN2A 4ZJ1A 1K54C 1IYOA 5DTTA 1I2SA 3IH8A 3C4PA 4MBHA 2WGIA 4R0QA 3UY6A 1K55C 4D2OA 5FASA 2X02A 2WADA 2XEPA 1ZG4A 4DXBA 4GDBA 4S2LA 2HDUA 4UAAA 5J8XA 4KZ3A 4WEJA 1LI0A 4Y7PA 3UPOA 3IT9A 3N6IA 4HESA 3IXBA 4QY5A 1FOFA 3V50A 4JPMA 3N7WA 5FI2A 4FD8A 1PWDA 1IYPA 1M40A 4OPRA 4X56A 5D3OA 5DF7A 1XGJA 4OQGA 5CTNA 4NK3A 3IXGA 4WYYA 4WZ5A 3S1YA 1RP5A 3DWKA 3IF6A 3IHBA 3HLEA 5GLAA 5GHZA 2Q9MA 3DTMA 3ZG5A 2A49A 1BZAA 2ZM2A 5KSHA 5CHJA 4WZ5C 3CG5A 4OVDA 2Y55A 3IF6C 3SH7A 3WS1A 2XK1A 1ERQA 2H0TA 3IWQA 3IWOA 5U47A 4PPRA 2UWXA 4JF6A 4IVIA 5E43A 1YLZA 2IWDA 3GRJA 4S2NA 1VM1A 5CERA 3OPRA 3P98A 1ES3A 5A91A 1HD8A 4QU3A 1W79A 5FQKA 2DNSA 3QNCA 3ZNYA 4UA9A 3UE0A 2C5WB 2WKIA 3E2KA 3GSGA 4IBRA 4Z9QA 3NY4A 3N8LA 3Q1FA 4ID4A 2PU4A 1IEMA 2FFYA 2HP9A 4S2JA 3IXDA
chains in the Genus database with same CATH superfamily
1FR1A 2JKTM 3D72A 1L0EA 3CHWP 5HDDA 2ZMAA 3S7QA 4X55A 3HUMA 5J3WA 2FFFB 5A90A 4P6ZS 5FQQA 4BBUA 5FDSA 2WZXA 1GCEA 3ULFA 4LV2A 3RXWA 2V2FF 4P6ZM 4YWZA 3T1XA 4OQHA 4HI4A 2QKPA 5HAPA 2ZQ9A 4X1LA 4LPZA 4B93A 2P74A 3QP6A 2HDRA 3TOIA 2K31A 5G4ZA 3KSGA 1K56D 4H6JB 3LCEA 4DF6A 3V5MA 1J3WA 5EVIC 3VOYA 1VETA 2HDQA 1U60A 1BLCA 3PYPA 3FYZA 4KQDA 3I7JA 2EX6A 4O0PA 4CPKA 4MMNA 5HSQA 1OJGA 4LFUA 4ARZA 1AWIA 2XR0A 4OPYA 5CHMA 2E8IA 1FCNA 3A3JA 1BUEA 4HY8A 1PFLA 1NRFA 3G6OA 1HVBA 5K5BA 4PM8A 4FCFA 3A3IA 4FSFA 4HNBA 5DFXA 1FIKA 3NIAA 4KZ8A 5DKLA 3S7PA 4RVAA 2ZQ8A 4Y15A 4EERA 5CEDA 3W4QA 1PI4A 4F3LB 2ZL1A 4C3QA 4NXFA 3TSGA 4IVKA 1GA0A 4MBFA 5HDCA 5HPFA 4RYEA 5EE8A 1T19A 3IH9A 1NJ4A 3MJQA 4XXRA 2XH9A 3B47A 1TEMA 3A3EA 5HL1A 4ME4A 1NLZA 1KGEA 2I72A 1G5UA 4G3KA 1YSPA 3VP3A 1FQGA 2HJ9C 1EROA 2PT7A 2OLVA 1O07A 4RX2A 1T1AA 4L0LA 2L4RA 4WEKA 2VA0A 3FKWA 1H8MA 3VOZA 3VSLA 3V67A 4F94A 2C6WB 3Q7VA 2M7VA 2VGLS 2KOIA 1OPXA 2O9BA 3VP4A 5G18A 1DY6A 1O7EA 2VGLM 4GCZA 2O9AA 1H8ZA 1K56A 2Y4AA 2Y2KA 3T12B 3PXPA 1G28A 3WS2A 4QPRA 4JF5A 2X01A 1FCOA 3OBFA 4KZ6A 2XD1A 1QMFA 4R4SA 2JKFA 4DDYA 1YAXA 2XFTA 2HZ5A 2WKPA 1BT5A 4G3WA 4ZAMA 4BJPA 3ZDJA 3EGXC 3T50A 3A3DA 2HDSA 1LL9A 1MWRA 4PM9A 3MKEA 2QMIA 2P08A 2W1RA 4WBGA 1S1ZA 5F6AA 4EWFA 3BJNA 3A3FA 2ZOIA 4JXGA 1YM1A 4GS9A 3IX3A 5L10A 3FG8A 2G7UA 2A2LA 3D9YA 4M3KA 3IS2A 2OV5A 2CC1A 1HTZA 3JVUA 5EUAA 2ZC4B 1KGGA 1S4RA 1BULA 5L09A 5TR7A 1PW1A 2WK0A 5FI7A 3VP1A 1YLTA 4FUWA 4S2NC 4R4RA 4HJ6A 4FH4A 4NXEA 1H5XA 4K0XA 3Q81A 3R7WA 2JKRI 3A0SA 1PZOA 1ESIA 3U2AA 2Q0OA 3OPHA 3E4QA 4L9EA 1N9OA 1WA9A 5A92A 3BWLA 2E8JA 5L8MA 1T18A 3B42A 2B5RA 3NBLA 5FL3A 4R38A 4XUZA 1ZHHB 1K57C 2JE5A 4CLCB 4B88A 4DRTA 4E6WA 4I5SA 1YT4A 4E3NA 3JVVA 3F1PA 4LENA 4N9LA 2G2UA 1WYCA 4HH2A 1W8YA 3MR0A 4DKIA 3CZDA 2WKQA 3ZHHA 3PAGA 3WS5A 3G4PA 4EBNA 3LIDA 1CF0A 3OPLA 4CLCD 4YINA 1E4DA 5E2HA 5TJJA 3LIEA 5GHYA 2EX8A 4AFIA 1LLBA 3HJKA 1AXBA 3SZTA 1OTAA 4Y5FA 4GN2A 3F1NB 1STZA 3IH8A 4R0QA 3UY6A 1K55C 4HJ3A 2WADA 2W3GA 5EVEA 3C38A 4DXBA 1P9WA 4UAAA 4PKYA 3LR5A 4HESA 5FI2A 4FD8A 4NXGA 4X56A 5EM0A 1XGJA 3RFBA 3DWKA 3HLEA 1GSVA 2A49A 5KSHA 4WZ5C 3BY8A 1ERQA 1N9LA 1YLZA 1VB6A 4QU3A 3EOIA 3VV4A 2C5WB 4Y3IA 2LB9A 1SKOB 4ID4A 1IEMA 2V8CA 2OAQ1 3LYXA 3UPOA 4LRZE 1Y4OA 3W4PA 3M6BA 1N9BA 1W7FA 4N92A 1EI5A 1E3UD 3TG9A 2WGVA 2XD5A 4GJ4A 4KQRA 2XQZA 1ESUA 4OONA 1BTLA 3T1RA 4MBKA 5I94A 1IELA 4GB7A 2HGVA 4IBXA 4GKUA 2H28A 4GHIB 5EOEA 1D1JA 4KZBA 1GA9A 1VETB 2ZC7A 2JKGA 3LEZA 2BLSA 3DWZA 3O88A 3ZNTA 2R78A 2OLUA 4ARZB 1L2SA 2ZQ7A 2XROA 2GNXA 1DJCA 3LIAA 3LY4A 4I38A 2XGNA 4HP4A 4CLCA 3B33A 1G6AA 4OOYA 2HP6A 4KG2A 5M19A 1G68A 1K54A 3MQ0A 1XFQA 5KZHA 3LY3A 1N4OA 4LLOB 3RJUA 2PU2A 4DJ3A 4HIAA 4I39A 2OWJA 2ZL1B 1FSWA 3W4OA 5CGWA 3HUNA 1LHYA 2Y2IA 3EGDC 1OT9A 4MN6A 4PHTA 2JBFA 3GTCA 2P9VB 3IHAA 2D01A 2KX6A 3F1NA 5FQ9A 5EVLA 2EXBA 5AQ7A 1D06A 4QHCA 1BLHA 2Q9NA 2Y59A 1S6RA 1NZOA 3FV7A 1TDLA 5CXWA 3V39A 4EESA 3ZFZA 5L07A 3WRTA 4B4ZA 1BLSA 5J4EA 3KSIA 1K6SA 2EWWA 1SDNA 5HD5A 2R9WA 4IJGA 3HVFA 1JWZA 4PM7A 1RGYA 1KVMA 3Q7VB 3IBJA 5DJUA 2W1TB 3D4FA 1XJ3A 2QJ5A 1E3UA 1S66L 4JBFA 4R3BA 4JGOA 5HARA 3N8RA 3UE3A 1P0ZA 3BEBA 4OKPA 3HLGA 1SKOA 4BD0A 2Z6DA 1K25A 2B95A 5JYPA 1H8YA 3KYQA 3V3RA 3H9WA 1Q2PA 4JGRA 4C75A 2Y2GA 3QP1A 3ZG7B 1KE3A 1KE4A 3BFCA 3ZG0A 2JKRM 2GZAA 3NOTC 1C3BA 5F82A 4EUZA 3NC8A 4ZJ2A 4OP8A 3IX8A 2Y2MA 4MDZA 1JWPA 4U0XA 5GLCA 4GOGA 2UV0E 1F98A 4DE0A 2J7VA 3NECA 5HZHA 2Z2MB 1P9RA 3OOVA 2ACGA 4GHIA 4Q0HA 1TD5A 3SW1A 2V1BA 5M1AA 4WL9A 2M7UA 5KMWA 2P04A 4Q0IA 1LT0A 1Y28A 3WS4A 2V20A 3NHQA 1K4FA 3C7UA 4Y13A 4HP9A 1VQQA 5DTSA 5E2GA 4GS9B 2ZC3B 3RXXA 5LBRA 4S2OA 4DDSA 4ZJ3A 3VOLA 3IS2B 3N8SA 3OLOA 3ISGA 2V0UA 1MY8A 4HBUA 1IKIA 3C8CA 5HPIA 4UHUA 3CWFA 2JHEA 1W8QA 5TFQA 5CECA 5DKKA 2A3UA 4BL2A 2WKEA 3ZG8B 3A0RA 4E3JA 1S67L 3ZG9B 3V3SA 1HZOA 1F2KA 4RA7A 1ONGA 2PBDP 3R7WB 2GX5A 3C2WA 4QY6A 4KQOA 3R4KA 2ZQCA 3VP2A 1MWUA 3Q7ZA 1LSVA 4JGPA 2JN7A 5GLDA 1NYYA 2DRWA 1LI9A 1XKZA 2HJEA 2P9VA 3GECA 1ALQA 4OOLA 5AVEA 2VGJA 1GSWA 2PD7A 3MF0A 2WGWA 4KENB 4JKTA 5CRFA 4O7DA 2W27A 4P85A 3W8KA 4OLGA 4EV4A 3TE8A 3OC2A 1LSXA 4QJGA 4QWOA 2VGKA 2WAFA 2ZC6B 4FTXA 2HP5A 5M18A 3F1PB 3UPNA 5F68A 5HD3A 2Y2OA 3LR0A 2K2NA 4WLAA 4EEUA 3P01A 2W1TA 1PI5A 4M4XA 4CJNA 3PBRA 4G3VA 1FSYA 2Y8HA 3CUEC 3KYZA 5AQBA 1UGUA 4WZ4A 3LI8A 3IF5A 3UE6A 2L1MA 3UB9A 1KE0A 1WYBA 5HWVA 4KZAA 4E3LA 1W63Q 2ZD8A 3VP0A 2EX2A 3QP8A 4OPZA 3UDFA 2OOLA 2WKHA 4JXWA 4H8RA 3FWLA 4S2IA 4Y0OA 4KZ4A 2XDMA 4CLCC 3SS5A 4E3OA 3FZCA 3T4LA 2ZQDA 3HLCA 1TS8A 3NDEA 1K54C 2I9VA 1IYOA 5FASA 3C4PA 2WGIA 2XEPA 1ZG4A 5AJGA 4GDBA 4ESPA 4S2LA 3RTYA 4KZ3A 4WEJA 3MMHA 3N6IA 4QY5A 1FOFA 4JPMA 2INWA 1PWDA 5CTNA 1TS6A 4NK3A 3IXGA 2HV1A 3IF6A 2FZ0A 3IHBA 3NULA 5GLAA 2ZM2A 3CI6A 3D3OA 2H0TA 2XK1A 3IWQA 3IWOA 3CAXA 4PPRA 5E43A 1FILA 3OPRA 2DNSA 3ZNYA 4UA9A 3UE0A 4WN5A 2VEAA 2WKIA 3E2KA 3GSGA 3NY4A 3U4LP 3PBOA 5FAPA 4S2JA 2O9CA 2H5SA 2ZM8A 4YNRA 3BRMA 1NY0A 1XPBA 3LIBA 4O01A 2R9XA 5IT5A 4JXSA 2O99A 3LO7A 1KDSA 2VKSA 3BQAA 4O8GA 4IHQA 2PBYA 3MZEA 1K38A 4ZDXA 4YFMA 3LGOA 5KSCA 2J9OA 3O3VA 3HUOA 4EQIA 3RH8B 3G31A 1KGFA 4HOIA 1G6OA 1XX2A 3GDIA 1MWTA 2J80A 3BFDA 5FQMA 3H7WA 1K0KA 2EFXA 5EVIA 5CTMA 4ETZA 4Q0JA 2EA9A 4MN5A 1XGIA 3IQAA 4N1XA 5FA7A 3L7HA 3NDGA 2PR6A 4EBLA 1S4SA 3LICA 2J9PA 4LCLA 1CQAA 1K6RA 1UWPX 1PYYA 3UMEA 4ETXA 5A93A 5GL9A 2L0WA 4HH3A 1S1YA 3K2NA 4P6BA 2FH5A 3AGFA 4KG5A 3HLDA 3A0VA 4R3JA 4HBTA 4GZBA 1BSGA 3M2KA 3BQ8A 3G34A 4N9KA 3T1QB 1V9ZA 3HBRA 3T4TA 2XFSA 2ZMFA 1E25A 3FKVA 5MC7A 1TVFA 3QP5A 3KSFA 4EEPA 4JLFA 1YLPA 4I3AA 4LV0A 1DP6A 4JXVA 4BWIA 2J3TD 1ERMA 1MC0A 1IOUA 3OCNA 4WELA 5F1GA 1YMXA 3B3XA 2QPNA 1EWZA 2QJ7A 4MNRA 5FDHA 2A24B 4I3JA 2DCFA 1TS7A 1TS0A 5F83A 1L0GA 1F9IA 2PRFA 5EPHA 4D60A 5IU1A 1YKDA 1PZPA 5FI6A 3PBSA 3BLMA 4Y17A 3C7VA 1XA1A 3G2ZA 1SKFA 1PWGA 4LRYC 3GR2A 2BASA 3CJMA 2WUQA 1IYSA 3ZVWA 4OOMA 2ZC5B 2ZOHA 5CX7A 4BBVA 3UMDA 3T4KA 4N1HA 1ONHA 4C6YA 4ZTKA 2VV6A 1CEFA 4Y0UA 3G2YA 2VV7A 4GNUA 3P7NA 2B02A 4K91A 1YSQA 4KUOA 1ES4A 4GLQA 3SH8A 3UE1A 5G4YA 3MKFA 3EQUA 4OLDA 4BENA 5BOHA 1W5DA 3AGDA 3DAVA 4HQAA 5DJTA 1XP4A 3E4PA 4DN0A 5HW3A 3MS6A 3VFHA 3MZDA 4R6LA 3E4OA 3UO9A 1L0DA 4KUKA 4LV3A 3UDXA 2CMNA 3EEHA 3HLFA 4P87A 1MWSA 3VSKA 3O87A 3NOPC 4I3IA 3P09A 2GDNA 4U0TA 2Y2JA 5AQAA 2ZMVA 4EQ1A 2PHYA 1Z6FA 3ZGAB 2Y79A 5AQ9A 3GV9A 3Q82A 5EFWA 1GHIA 2GJ3A 4BQMA 2K7SA 3MXSA 3O5YA 2WGWB 1SDEA 2W3DA 1IFQA 3JYIA 4BLMA 3ITBA 2KLIA 1W63M 2VLGA 1GHMA 2Y2NA 5HL6A 3PBNA 4NETA 4R1GA 3MFDA 2BTFP 4GDNA 2VJWA 1OT6A 3T4QA 2ZJ9A 1WE4A 1PW8A 3TJZC 4WM9A 3H82A 1EW0A 5DVAA 1QMEA 2H10A 1DJAA 1J9MA 3ZVTA 2QYBA 3BFFA 1K4EA 3PTEA 1MXOA 1IYQA 4E3IA 1ZTUA 2A24A 1SCWA 3HLBA 2RCXA 3HREA 4KQQA 1TF1A 2XA7S 1OTDA 2J8YA 3G30A 1JVJA 1K57A 1VEUA 5C5KA 4DJ2A 3HLWA 2B18A 2ZM0A 4XUXA 2XA7M 1ZC2A 4JF4A 1F5MA 2O0YA 4PMAA 3CMZA 2V0WA 3QNBA 5F69A 1NRJA 1KVLA 2V9AA 1YLYA 1JNUA 3DBAA 5I5LA 1GHPA 1ACFA 4Y0TA 3S7NA 4OQIA 1YMSA 5KIZA 2WZZA 4GW9A 2Y2QA 4MCWA 4E3MA 1T1CA 4B4XA 3IF6B 3VE4A 1K55A 4HEFA 2EWVA 5DTTA 1I2SA 1PRQA 4D2OA 3KSHA 2P7JA 1CJFA 5J8XA 1V9YA 3CPTA 1OTBA 4II7A 3IXBA 3V50A 3N7WA 3PHYA 1UWNX 1M40A 5DF7A 5D3OA 4WYYA 4WZ5A 3S1YA 3T1SA 1RP5A 4WUJA 1HLUP 4E04A 2Q9MA 3DTMA 3ZG5A 3NJAA 1BZAA 4YOFA 4OVDA 3SH7A 3WS1A 4DMZA 1OTIA 5AVFA 4XT2A 5EM1A 2D02A 1VM1A 3P98A 1ES3A 5FQKA 4PKYG 5IS1A 4IBRA 4L9FA 3N8LA 2PU4A 2FFYA 1PIOA 2XF3A 5HX9A 3UB7A 4R23A 3W2ZA 1JTGA 1P97A 4PM5A 4EBPA 3ZCZA 2MJ6A 4E6XA 3CITA 3C4OA 5FSRA 3MBZA 3SS3A 1S0WA 3BM6A 2W0NA 5A8BA 2AVXA 3H7WB 1NZUA 3ITAA 5EVIB 2Y2LA 3E2LA 1YQSA 1DP8A 1D7EA 3NI9A 2W3HA 1ES5A 2YKHA 1N9NA 4GD6A 4A5RA 1ODVA 5CEBA 4Q8IA 3LUQA 3M2JA 3BFGA 1SZVA 3K3CA 1BLPA 3G32A 4DE1A 2EFUA 5F5YA 5EVID 3LEQA 3IWIA 3IXHA 2JCHA 2WAEA 1PNEA 1MZUA 5FAOA 3K3DA 3IX4A 5HWTA 5TBMB 1ZG6A 2YKFA 1I2WA 2LB5A 1BYWA 3IBRA 3LFVA 4NKPA 4DE2A 4UEYA 3M6HA 4OQ0A 4ZRRA 4H6JA 4FH2A 4ZBEA 1OJ5A 3ZYTA 2PAVP 4R3AA 4OH0A 1YLJA 1GSXA 1ES2A 3EWKA 4X6TA 5EECA 2WYXA 3F1OB 5L2FA 2V8FA 3OZHA 4K0WA 3E98A 2IWBA 3AGEA 4X53A 4QB8A 4CLCE 3GVBA 2JKTI 3G35A 1I5QA 4EETB 2RL3A 4KZ7A 2OAP1 3PR6A 1DRMA 4QD4A 1CK3A 2J3TC 4PM6A 3PBQA 3WS0A 5GHXA 2VK3A 1DP9A 3NCKA 3MQQA 5DF9A 2J3WA 3KYEA 2QHKA 4NG2A 3MZFA 2PR5A 1RGZA 2PDRA 5JYOA 2Y91A 4F3LA 3DW0A 4LRXC 1OMEA 5FATA 1XA7A 3VFFA 5CHUA 4E3KA 4IUHA 1Z09A 4X69A 3UB8A 2XLNA 4LGWA 1NXYA 2EXAA 2X71A 3BYDA 3S4XA 1NYMA 1TDGA 1VHMA 3BECA 1CI9A 2IWCA 3SH9A 3EQVA 2V1AA 3LIFA 1LL5A 2G2WA 1OTEA 5EOOA 1X0OA 4RQ9A 3TRCA 4RX3A 4BMWA 4BBTA 1IKGA 3PBTA 3NOUC 2QWSA 3ICYA 1H3QA 2M1CA 4MN7A 3DTIA 3DTKA 2V1ZA 2Y2HA 3VE3A 4LV1A 4BD1A 3FPWA 1JWVA 4S2PA 3OPPA 2OSUA 4L9GA 1A0KA 4BL3A 2ZBBA 3BW6A 5DTKA 5HAIA 2ZLYA 2Y2PA 2PD8A 4WMCD 4P0MA 1MBLA 4JGQA 3DTEA 1MPLA 4UA7A 5FEGA 4HJ4A 1YLWA 5HWWA 5FAQA 1NLYA 5TGFA 2DMWA 1LSWA 3UPPA 3E0YA 2PYPA 2VX8A 5TBMA 1KOUA 1MKMA 4NXBA 5CGXA 5FQIA 5HAQA 3C5AA 4X25A 3MXRA 1CEGA 2HF6A 3OCLA 3H82B 3UN7A 4OPQA 4LCMA 3QHYA 4R70A 4MEZA 1H0MA 2IA2A 3PAEA 4KG6A 5F1FA 2QZ6A 3FC7A 4HHDA 4MLLA 1XJ6A 4EU0A 5EV0A 3F1OA 3GMWA 1RCJA 3N4IA 1L0FA 1SHVA 2NUPC 1XJ4A 3KO6A 3QP2A 4DE3A 2HPBA 5E2EA 1VEUB 3SOIA 2BG1A 3LI9A 1DJBA 4S2MA 4EXOA 1CI8A 1L3LA 2Z2LB 3HJIA 4S2KA 4Y2FA 4DXCA 5FQJA 3HL9A 1M6KA 3VMAA 5HFOA 1ZKJA 3SS4A 3O86A 5GLBA 2EX9A 1XXMA 2XSSA 4FOFA 4X68A 5CGSA 2XRNA 3BFEA 2JC7A 3FPVA 2Z6CA 3CUEA 4IEDA 4WF0A 3Q07A 1NWZA 3S22A 1FCMA 1XJ2A 3MSHA 2W3FA 2ZQAA 3C30A 5IHVA 5E2FA 4EW7A 3LR4A 4EUVA 1XFNA 3L9KA 4PAUA 5DF8A 4UA6A 4U3TA 3UNWA 5FEFA 3WRZA 4NEED 1KDWA 2OWHA 1MKIA 3TW8A 3UDIA 2WKRA 1PWCA 3GQZA 3CPTB 4KZ5A 4WMCA 1JTDA 3CLOA 4K08A 3BLSA 3EEAA 4KZ9A 2H0YA 1Q2QA 4OP5A 4IUKA 3T4OA 1Y54A 2NUTC 5J7EA 3T4SA 3WWXA 4GD8A 3UB5P 1FR6A 2PYRA 4ZJ1A 3MFXA 4MBHA 1LL8A 3QP4A 4XT2B 2X02A 3LR3A 5DFYA 4CQHA 3KX0X 4UQIS 3S7OA 1YPRA 2HDUA 4Y7PA 1LI0A 3IT9A 3JPUA 2VV8A 1IYPA 4UQIM 4B9OA 4OPRA 4OQGA 5HDSA 3MXQA 5GHZA 5CHJA 3CG5A 2VZWA 2Y55A 3IF6C 3T4JA 5U47A 2UWXA 4JF6A 4IVIA 4Z1WA 2IWDA 3GRJA 4S2NA 5CERA 3UB6A 5A91A 1HD8A 1W79A 3QNCA 3MQOA 2KDKA 4X1MA 3ZQ5A 1T1BA 2W3EA 4Z9QA 3Q1FA 3BY9A 2HP9A 3HCYA 3IXDA
chains in the Genus database with same CATH topology
1FR1A 1PIOA 2XF3A 5HX9A 3W4PA 1L0EA 3M6BA 2ZMAA 1N9BA 2H5SA 1W7FA 2ZM8A 4N92A 4R23A 4X55A 3BRMA 3HUMA 1NY0A 1EI5A 1XPBA 1JTGA 1E3UD 2FFFB 3TG9A 5A90A 4PM5A 2WGVA 2R9XA 2XD5A 4EBPA 3ZCZA 4KQRA 4JXSA 3LO7A 5FQQA 4E6XA 3C4OA 5FSRA 3MBZA 3SS3A 2XQZA 1KDSA 1ESUA 1S0WA 1GCEA 1BTLA 2WZXA 4OONA 4MBKA 3BM6A 1IELA 5I94A 4LV2A 4GB7A 3RXWA 2V2FF 1NZUA 3ITAA 5EVIB 2PBYA 4IBXA 2Y2LA 1K38A 3MZEA 4GKUA 3E2LA 4OQHA 5EOEA 1YQSA 5HAPA 4KZBA 4ZDXA 1GA9A 2ZC7A 4YFMA 2ZQ9A 3NI9A 5KSCA 2J9OA 3O3VA 1ES5A 4GD6A 3HUOA 4EQIA 4A5RA 2P74A 3G31A 3LEZA 5CEBA 2BLSA 3DWZA 3O88A 4Q8IA 1KGFA 3ZNTA 3M2JA 3BFGA 2OLUA 1XX2A 1BLPA 1L2SA 2ZQ7A 3G32A 1MWTA 2HDRA 3TOIA 4DE1A 2EFUA 1DJCA 3BFDA 5FQMA 5EVID 1K56D 3LCEA 3LY4A 2EFXA 5EVIA 3IWIA 5CTMA 4DF6A 3V5MA 3IXHA 2WAEA 2JCHA 2XGNA 5EVIC 1XGIA 3IQAA 3VOYA 1G6AA 4OOYA 2HDQA 1U60A 2HP6A 4N1XA 1BLCA 5FAOA 4KG2A 5FA7A 5M19A 3FYZA 3NDGA 4EBLA 3PBOA 1G68A 1ZG6A 1K54A 3I7JA 2EX6A 5KZHA 2J9PA 3LY3A 4LCLA 4CPKA 1I2WA 1N4OA 4DE2A 1K6RA 3RJUA 2PU2A 1PYYA 3M6HA 4OQ0A 2XR0A 4OPYA 5A93A 5CHMA 2E8IA 5GL9A 1FCNA 1FSWA 3W4OA 4FH2A 3A3JA 1BUEA 4ZBEA 5CGWA 4OH0A 4P6BA 1YLJA 1ES2A 3HUNA 3AGFA 4KG5A 1LHYA 3HLDA 1NRFA 4R3JA 4HBTA 4X6TA 2Y2IA 4GZBA 1BSGA 3M2KA 2WYXA 3G34A 4N9KA 5EECA 3HBRA 1HVBA 2XFSA 5L2FA 2JBFA 1E25A 4PM8A 4FCFA 3OZHA 3A3IA 3GTCA 4FSFA 2P9VB 3IHAA 4K0WA 5FQ9A 3FKVA 2IWBA 5EVLA 3NIAA 1TVFA 3AGEA 4KZ8A 2EXBA 4RVAA 2ZQ8A 4X53A 5AQ7A 4QB8A 4JLFA 4QHCA 1YLPA 3GVBA 1BLHA 2Q9NA 2Y59A 3G35A 1I5QA 1PI4A 1S6RA 4LV0A 3W4QA 4C3QA 4JXVA 1NZOA 3FV7A 1TDLA 2RL3A 5CXWA 3TSGA 1ERMA 3OCNA 4KZ7A 4IVKA 4WELA 1GA0A 1YMXA 3B3XA 4MBFA 5F1GA 4QD4A 2QPNA 3V39A 4RYEA 1CK3A 5EE8A 3WRTA 3ZFZA 1EWZA 4PM6A 4B4ZA 3IH9A 1BLSA 1NJ4A 4MNRA 3PBQA 1K6SA 5FDHA 1SDNA 4XXRA 5GHXA 3WS0A 2R9WA 2XH9A 3NCKA 1TEMA 3A3EA 5HL1A 3HVFA 1JWZA 4PM7A 1RGYA 5DF9A 1KVMA 2DCFA 3Q7VB 1KGEA 2I72A 5F83A 3D4FA 3MZFA 1E3UA 4R3BA 4JBFA 1FQGA 5HARA 1EROA 1L0GA 3VP3A 3N8RA 1RGZA 2OLVA 5EPHA 5JYOA 1O07A 2Y91A 4RX2A 3UE3A 3DW0A 1OMEA 3BEBA 5FATA 1PZPA 1XA7A 4OKPA 3VFFA 4L0LA 3HLGA 5CHUA 4WEKA 4E3KA 4X69A 5FI6A 3PBSA 2XLNA 3BLMA 1NXYA 2EXAA 1K25A 2X71A 3BYDA 1XA1A 3C7VA 3FKWA 3G2ZA 5JYPA 3VOZA 1SKFA 1H8YA 1PWGA 3V3RA 3S4XA 1NYMA 1TDGA 3GR2A 1Q2PA 3VSLA 4C75A 2Y2GA 3ZG7B 3CJMA 1KE3A 1KE4A 3BECA 2WUQA 4F94A 2C6WB 1CI9A 1IYSA 2IWCA 3BFCA 3ZVWA 4OOMA 2ZC5B 3SH9A 3ZG0A 3EQVA 3Q7VA 1C3BA 5F82A 4EUZA 1LL5A 2G2WA 3NC8A 4N1HA 4ZJ2A 1ONHA 4C6YA 4ZTKA 5EOOA 4OP8A 2Y2MA 1CEFA 4Y0UA 3G2YA 4GNUA 5G18A 3VP4A 1JWPA 4K91A 4U0XA 4RX3A 5GLCA 4GOGA 4DE0A 1DY6A 1IKGA 1O7EA 3PBTA 2J7VA 1ES4A 1H8ZA 1K56A 3SH8A 3UE1A 2Z2MB 2Y4AA 3EQUA 3MKFA 2Y2KA 4OLDA 4BENA 3WS2A 5BOHA 1W5DA 2V1ZA 2Y2HA 3AGDA 4JF5A 2X01A 5M1AA 5KMWA 4LV1A 1XP4A 5HW3A 4BD1A 1FCOA 4S2PA 1JWVA 3OPPA 3WS4A 2OSUA 4KZ6A 2XD1A 3VFHA 4BL3A 3MZDA 1QMFA 4R4SA 5DTKA 5HAIA 2V20A 2ZLYA 2Y2PA 1K4FA 3UO9A 3C7UA 1L0DA 2XFTA 4DDYA 4LV3A 4P0MA 4WMCD 3UDXA 1MBLA 1VQQA 1BT5A 5DTSA 3HLFA 5E2GA 2ZC3B 3RXXA 4ZAMA 4P87A 1MPLA 1MWSA 4BJPA 3ZDJA 3VSKA 4S2OA 4UA7A 3O87A 4ZJ3A 4DDSA 3N8SA 1YLWA 3P09A 2GDNA 5FAQA 4U0TA 2Y2JA 5TGFA 3A3DA 2HDSA 3ISGA 3UPPA 1LL9A 5AQAA 1MY8A 1MWRA 4HBUA 4PM9A 1IKIA 1Z6FA 3ZGAB 3MKEA 2QMIA 4UHUA 4WBGA 5AQ9A 4BD0A 3GV9A 1W8QA 3Q82A 5TFQA 5CECA 5CGXA 2A3UA 5FQIA 4BL2A 2WKEA 5HAQA 3C5AA 1GHIA 4EWFA 3MXRA 4BQMA 3A3FA 4JXGA 3ZG8B 1CEGA 3OCLA 3MXSA 1YM1A 2WGWB 4E3JA 3UN7A 1SDEA 4OPQA 3ZG9B 3V3SA 3JYIA 4BLMA 3ITBA 1HZOA 4RA7A 4M3KA 1ONGA 1GHMA 2Y2NA 3QHYA 4LCMA 2OV5A 2CC1A 1HTZA 3PBNA 5EUAA 4QY6A 4KQOA 4MEZA 2ZC4B 4NETA 4R1GA 3MFDA 3PAEA 4KG6A 5F1FA 2ZQCA 2QZ6A 3VP2A 1MWUA 1KGGA 3Q7ZA 4GDNA 4MLLA 1BULA 5TR7A 1PW1A 2WK0A 5FI7A 3VP1A 5CEDA 5GLDA 3GMWA 1NYYA 1RCJA 1YLTA 2ZJ9A 2DRWA 3N4IA 1LI9A 1WE4A 1PW8A 2P9VA 1XKZA 1ALQA 4OOLA 1L0FA 1SHVA 4S2NC 2VGJA 4R4RA 4WM9A 2WGWA 4DE3A 2HPBA 4FH4A 4KENB 5E2EA 4JKTA 5DVAA 1QMEA 1H5XA 4K0XA 3Q81A 5CRFA 3SOIA 2H10A 4O7DA 2BG1A 1DJAA 4P85A 1J9MA 4OLGA 3W8KA 3ZVTA 4EV4A 1DJBA 3OC2A 3BFFA 4QJGA 4S2MA 1PZOA 1CI8A 1ESIA 1K4EA 2VGKA 3PTEA 2WAFA 2Z2LB 1MXOA 2ZC6B 1IYQA 4S2KA 2HP5A 4DXCA 4E3IA 5FQJA 3HL9A 5M18A 3OPHA 1M6KA 3UPNA 3VMAA 1SCWA 5HFOA 1ZKJA 3HLBA 2Y2OA 3SS4A 2RCXA 3O86A 3HREA 5GLBA 4KQQA 2EX9A 1XXMA 5A92A 2J8YA 4X68A 1PI5A 5CGSA 3BFEA 3G30A 2JC7A 1JVJA 4CJNA 2B5RA 3PBRA 4IEDA 1K57A 3NBLA 1FSYA 3HLWA 3Q07A 3S22A 1FCMA 4XUZA 2ZM0A 4XUXA 1K57C 2JE5A 1ZC2A 4B88A 4DRTA 2ZQAA 4JF4A 4E6WA 4PMAA 5AQBA 4WZ4A 1YT4A 4E3NA 3CMZA 3IF5A 5IHVA 1KE0A 3QNBA 4LENA 5E2FA 1KVLA 4N9LA 2G2UA 1WYBA 1YLYA 4KZAA 4E3LA 2ZD8A 1WYCA 5DF8A 4UA6A 1W8YA 2EX2A 3VP0A 5FAPA 4DKIA 3CZDA 4U3TA 3UNWA 3ZHHA 1GHPA 4Y0TA 3PAGA 4OQIA 3WRZA 3WS5A 1KDWA 4OPZA 3G4PA 4EBNA 1YMSA 1MKIA 3UDIA 3UDFA 1PWCA 3OPLA 3GQZA 2WKHA 4JXWA 4KZ5A 4YINA 2WZZA 3FWLA 1E4DA 4H8RA 4WMCA 4S2IA 5E2HA 2Y2QA 4E3MA 1JTDA 4Y0OA 4KZ4A 5GHYA 2EX8A 3BLSA 1LLBA 2XDMA 4KZ9A 3SS5A 3FZCA 4E3OA 2H0YA 1Q2QA 4OP5A 1AXBA 1Y54A 4B4XA 2ZQDA 3IF6B 3WWXA 4GD8A 3HLCA 1K55A 4HEFA 1FR6A 3NDEA 4GN2A 4ZJ1A 1K54C 1IYOA 5DTTA 1I2SA 3IH8A 3C4PA 4MBHA 2WGIA 4R0QA 3UY6A 1K55C 4D2OA 5FASA 2X02A 2WADA 2XEPA 1ZG4A 4DXBA 4GDBA 4S2LA 2HDUA 4UAAA 5J8XA 4KZ3A 4WEJA 1LI0A 4Y7PA 3UPOA 3IT9A 3N6IA 4HESA 3IXBA 4QY5A 1FOFA 3V50A 4JPMA 3N7WA 5FI2A 4FD8A 1PWDA 1IYPA 1M40A 4OPRA 4X56A 5D3OA 5DF7A 1XGJA 4OQGA 5CTNA 4NK3A 3IXGA 4WYYA 4WZ5A 3S1YA 1RP5A 3DWKA 3IF6A 3IHBA 3HLEA 5GLAA 5GHZA 2Q9MA 3DTMA 3ZG5A 2A49A 1BZAA 2ZM2A 5KSHA 5CHJA 4WZ5C 3CG5A 4OVDA 2Y55A 3IF6C 3SH7A 3WS1A 2XK1A 1ERQA 2H0TA 3IWQA 3IWOA 5U47A 4PPRA 2UWXA 4JF6A 4IVIA 5E43A 1YLZA 2IWDA 3GRJA 4S2NA 1VM1A 5CERA 3OPRA 3P98A 1ES3A 5A91A 1HD8A 4QU3A 1W79A 5FQKA 2DNSA 3QNCA 3ZNYA 4UA9A 3UE0A 2C5WB 2WKIA 3E2KA 3GSGA 4IBRA 4Z9QA 3NY4A 3N8LA 3Q1FA 4ID4A 2PU4A 1IEMA 2FFYA 2HP9A 4S2JA 3IXDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FR1 A;  1PIO A;  2XF3 A;  5HX9 A;  3W4P A;  1L0E A;  3M6B A;  2ZMA A;  1N9B A;  2H5S A;  1W7F A;  2ZM8 A;  4N92 A;  4R23 A;  4X55 A;  3BRM A;  3HUM A;  1NY0 A;  1EI5 A;  1XPB A;  1JTG A;  1E3U D;  2FFF B;  3TG9 A;  5A90 A;  4PM5 A;  2WGV A;  2R9X A;  2XD5 A;  4EBP A;  3ZCZ A;  4KQR A;  4JXS A;  3LO7 A;  5FQQ A;  4E6X A;  3C4O A;  5FSR A;  3MBZ A;  3SS3 A;  2XQZ A;  1KDS A;  1ESU A;  1S0W A;  1GCE A;  1BTL A;  2WZX A;  4OON A;  4MBK A;  3BM6 A;  1IEL A;  5I94 A;  4LV2 A;  4GB7 A;  3RXW A;  2V2F F;  1NZU A;  3ITA A;  5EVI B;  2PBY A;  4IBX A;  2Y2L A;  1K38 A;  3MZE A;  4GKU A;  3E2L A;  4OQH A;  5EOE A;  1YQS A;  5HAP A;  4KZB A;  4ZDX A;  1GA9 A;  2ZC7 A;  4YFM A;  2ZQ9 A;  3NI9 A;  5KSC A;  2J9O A;  3O3V A;  1ES5 A;  4GD6 A;  3HUO A;  4EQI A;  4A5R A;  2P74 A;  3G31 A;  3LEZ A;  5CEB A;  2BLS A;  3DWZ A;  3O88 A;  4Q8I A;  1KGF A;  3ZNT A;  3M2J A;  3BFG A;  2OLU A;  1XX2 A;  1BLP A;  1L2S A;  2ZQ7 A;  3G32 A;  1MWT A;  2HDR A;  3TOI A;  4DE1 A;  2EFU A;  1DJC A;  3BFD A;  5FQM A;  5EVI D;  1K56 D;  3LCE A;  3LY4 A;  2EFX A;  5EVI A;  3IWI A;  5CTM A;  4DF6 A;  3V5M A;  3IXH A;  2WAE A;  2JCH A;  2XGN A;  5EVI C;  1XGI A;  3IQA A;  3VOY A;  1G6A A;  4OOY A;  2HDQ A;  1U60 A;  2HP6 A;  4N1X A;  1BLC A;  5FAO A;  4KG2 A;  5FA7 A;  5M19 A;  3FYZ A;  3NDG A;  4EBL A;  3PBO A;  1G68 A;  1ZG6 A;  1K54 A;  3I7J A;  2EX6 A;  5KZH A;  2J9P A;  3LY3 A;  4LCL A;  4CPK A;  1I2W A;  1N4O A;  4DE2 A;  1K6R A;  3RJU A;  2PU2 A;  1PYY A;  3M6H A;  4OQ0 A;  2XR0 A;  4OPY A;  5A93 A;  5CHM A;  2E8I A;  5GL9 A;  1FCN A;  1FSW A;  3W4O A;  4FH2 A;  3A3J A;  1BUE A;  4ZBE A;  5CGW A;  4OH0 A;  4P6B A;  1YLJ A;  1ES2 A;  3HUN A;  3AGF A;  4KG5 A;  1LHY A;  3HLD A;  1NRF A;  4R3J A;  4HBT A;  4X6T A;  2Y2I A;  4GZB A;  1BSG A;  3M2K A;  2WYX A;  3G34 A;  4N9K A;  5EEC A;  3HBR A;  1HVB A;  2XFS A;  5L2F A;  2JBF A;  1E25 A;  4PM8 A;  4FCF A;  3OZH A;  3A3I A;  3GTC A;  4FSF A;  2P9V B;  3IHA A;  4K0W A;  5FQ9 A;  3FKV A;  2IWB A;  5EVL A;  3NIA A;  1TVF A;  3AGE A;  4KZ8 A;  2EXB A;  4RVA A;  2ZQ8 A;  4X53 A;  5AQ7 A;  4QB8 A;  4JLF A;  4QHC A;  1YLP A;  3GVB A;  1BLH A;  2Q9N A;  2Y59 A;  3G35 A;  1I5Q A;  1PI4 A;  1S6R A;  4LV0 A;  3W4Q A;  4C3Q A;  4JXV A;  1NZO A;  3FV7 A;  1TDL A;  2RL3 A;  5CXW A;  3TSG A;  1ERM A;  3OCN A;  4KZ7 A;  4IVK A;  4WEL A;  1GA0 A;  1YMX A;  3B3X A;  4MBF A;  5F1G A;  4QD4 A;  2QPN A;  3V39 A;  4RYE A;  1CK3 A;  5EE8 A;  3WRT A;  3ZFZ A;  1EWZ A;  4PM6 A;  4B4Z A;  3IH9 A;  1BLS A;  1NJ4 A;  4MNR A;  3PBQ A;  1K6S A;  5FDH A;  1SDN A;  4XXR A;  5GHX A;  3WS0 A;  2R9W A;  2XH9 A;  3NCK A;  1TEM A;  3A3E A;  5HL1 A;  3HVF A;  1JWZ A;  4PM7 A;  1RGY A;  5DF9 A;  1KVM A;  2DCF A;  3Q7V B;  1KGE A;  2I72 A;  5F83 A;  3D4F A;  3MZF A;  1E3U A;  4R3B A;  4JBF A;  1FQG A;  5HAR A;  1ERO A;  1L0G A;  3VP3 A;  3N8R A;  1RGZ A;  2OLV A;  5EPH A;  5JYO A;  1O07 A;  2Y91 A;  4RX2 A;  3UE3 A;  3DW0 A;  1OME A;  3BEB A;  5FAT A;  1PZP A;  1XA7 A;  4OKP A;  3VFF A;  4L0L A;  3HLG A;  5CHU A;  4WEK A;  4E3K A;  4X69 A;  5FI6 A;  3PBS A;  2XLN A;  3BLM A;  1NXY A;  2EXA A;  1K25 A;  2X71 A;  3BYD A;  1XA1 A;  3C7V A;  3FKW A;  3G2Z A;  5JYP A;  3VOZ A;  1SKF A;  1H8Y A;  1PWG A;  3V3R A;  3S4X A;  1NYM A;  1TDG A;  3GR2 A;  1Q2P A;  3VSL A;  4C75 A;  2Y2G A;  3ZG7 B;  3CJM A;  1KE3 A;  1KE4 A;  3BEC A;  2WUQ A;  4F94 A;  2C6W B;  1CI9 A;  1IYS A;  2IWC A;  3BFC A;  3ZVW A;  4OOM A;  2ZC5 B;  3SH9 A;  3ZG0 A;  3EQV A;  3Q7V A;  1C3B A;  5F82 A;  4EUZ A;  1LL5 A;  2G2W A;  3NC8 A;  4N1H A;  4ZJ2 A;  1ONH A;  4C6Y A;  4ZTK A;  5EOO A;  4OP8 A;  2Y2M A;  1CEF A;  4Y0U A;  3G2Y A;  4GNU A;  5G18 A;  3VP4 A;  1JWP A;  4K91 A;  4U0X A;  4RX3 A;  5GLC A;  4GOG A;  4DE0 A;  1DY6 A;  1IKG A;  1O7E A;  3PBT A;  2J7V A;  1ES4 A;  1H8Z A;  1K56 A;  3SH8 A;  3UE1 A;  2Z2M B;  2Y4A A;  3EQU A;  3MKF A;  2Y2K A;  4OLD A;  4BEN A;  3WS2 A;  5BOH A;  1W5D A;  2V1Z A;  2Y2H A;  3AGD A;  4JF5 A;  2X01 A;  5M1A A;  5KMW A;  4LV1 A;  1XP4 A;  5HW3 A;  4BD1 A;  1FCO A;  4S2P A;  1JWV A;  3OPP A;  3WS4 A;  2OSU A;  4KZ6 A;  2XD1 A;  3VFH A;  4BL3 A;  3MZD A;  1QMF A;  4R4S A;  5DTK A;  5HAI A;  2V20 A;  2ZLY A;  2Y2P A;  1K4F A;  3UO9 A;  3C7U A;  1L0D A;  2XFT A;  4DDY A;  4LV3 A;  4P0M A;  4WMC D;  3UDX A;  1MBL A;  1VQQ A;  1BT5 A;  5DTS A;  3HLF A;  5E2G A;  2ZC3 B;  3RXX A;  4ZAM A;  4P87 A;  1MPL A;  1MWS A;  4BJP A;  3ZDJ A;  3VSK A;  4S2O A;  4UA7 A;  3O87 A;  4ZJ3 A;  4DDS A;  3N8S A;  1YLW A;  3P09 A;  2GDN A;  5FAQ A;  4U0T A;  2Y2J A;  5TGF A;  3A3D A;  2HDS A;  3ISG A;  3UPP A;  1LL9 A;  5AQA A;  1MY8 A;  1MWR A;  4HBU A;  4PM9 A;  1IKI A;  1Z6F A;  3ZGA B;  3MKE A;  2QMI A;  4UHU A;  4WBG A;  5AQ9 A;  4BD0 A;  3GV9 A;  1W8Q A;  3Q82 A;  5TFQ A;  5CEC A;  5CGX A;  2A3U A;  5FQI A;  4BL2 A;  2WKE A;  5HAQ A;  3C5A A;  1GHI A;  4EWF A;  3MXR A;  4BQM A;  3A3F A;  4JXG A;  3ZG8 B;  1CEG A;  3OCL A;  3MXS A;  1YM1 A;  2WGW B;  4E3J A;  3UN7 A;  1SDE A;  4OPQ A;  3ZG9 B;  3V3S A;  3JYI A;  4BLM A;  3ITB A;  1HZO A;  4RA7 A;  4M3K A;  1ONG A;  1GHM A;  2Y2N A;  3QHY A;  4LCM A;  2OV5 A;  2CC1 A;  1HTZ A;  3PBN A;  5EUA A;  4QY6 A;  4KQO A;  4MEZ A;  2ZC4 B;  4NET A;  4R1G A;  3MFD A;  3PAE A;  4KG6 A;  5F1F A;  2ZQC A;  2QZ6 A;  3VP2 A;  1MWU A;  1KGG A;  3Q7Z A;  4GDN A;  4MLL A;  1BUL A;  5TR7 A;  1PW1 A;  2WK0 A;  5FI7 A;  3VP1 A;  5CED A;  5GLD A;  3GMW A;  1NYY A;  1RCJ A;  1YLT A;  2ZJ9 A;  2DRW A;  3N4I A;  1LI9 A;  1WE4 A;  1PW8 A;  2P9V A;  1XKZ A;  1ALQ A;  4OOL A;  1L0F A;  1SHV A;  4S2N C;  2VGJ A;  4R4R A;  4WM9 A;  2WGW A;  4DE3 A;  2HPB A;  4FH4 A;  4KEN B;  5E2E A;  4JKT A;  5DVA A;  1QME A;  1H5X A;  4K0X A;  3Q81 A;  5CRF A;  3SOI A;  2H10 A;  4O7D A;  2BG1 A;  1DJA A;  4P85 A;  1J9M A;  4OLG A;  3W8K A;  3ZVT A;  4EV4 A;  1DJB A;  3OC2 A;  3BFF A;  4QJG A;  4S2M A;  1PZO A;  1CI8 A;  1ESI A;  1K4E A;  2VGK A;  3PTE A;  2WAF A;  2Z2L B;  1MXO A;  2ZC6 B;  1IYQ A;  4S2K A;  2HP5 A;  4DXC A;  4E3I A;  5FQJ A;  3HL9 A;  5M18 A;  3OPH A;  1M6K A;  3UPN A;  3VMA A;  1SCW A;  5HFO A;  1ZKJ A;  3HLB A;  2Y2O A;  3SS4 A;  2RCX A;  3O86 A;  3HRE A;  5GLB A;  4KQQ A;  2EX9 A;  1XXM A;  5A92 A;  2J8Y A;  4X68 A;  1PI5 A;  5CGS A;  3BFE A;  3G30 A;  2JC7 A;  1JVJ A;  4CJN A;  2B5R A;  3PBR A;  4IED A;  1K57 A;  3NBL A;  1FSY A;  3HLW A;  3Q07 A;  3S22 A;  1FCM A;  4XUZ A;  2ZM0 A;  4XUX A;  1K57 C;  2JE5 A;  1ZC2 A;  4B88 A;  4DRT A;  2ZQA A;  4JF4 A;  4E6W A;  4PMA A;  5AQB A;  4WZ4 A;  1YT4 A;  4E3N A;  3CMZ A;  3IF5 A;  5IHV A;  1KE0 A;  3QNB A;  4LEN A;  5E2F A;  1KVL A;  4N9L A;  2G2U A;  1WYB A;  1YLY A;  4KZA A;  4E3L A;  2ZD8 A;  1WYC A;  5DF8 A;  4UA6 A;  1W8Y A;  2EX2 A;  3VP0 A;  5FAP A;  4DKI A;  3CZD A;  4U3T A;  3UNW A;  3ZHH A;  1GHP A;  4Y0T A;  3PAG A;  4OQI A;  3WRZ A;  3WS5 A;  1KDW A;  4OPZ A;  3G4P A;  4EBN A;  1YMS A;  1MKI A;  3UDI A;  3UDF A;  1PWC A;  3OPL A;  3GQZ A;  2WKH A;  4JXW A;  4KZ5 A;  4YIN A;  2WZZ A;  3FWL A;  1E4D A;  4H8R A;  4WMC A;  4S2I A;  5E2H A;  2Y2Q A;  4E3M A;  1JTD A;  4Y0O A;  4KZ4 A;  5GHY A;  2EX8 A;  3BLS A;  1LLB A;  2XDM A;  4KZ9 A;  3SS5 A;  3FZC A;  4E3O A;  2H0Y A;  1Q2Q A;  4OP5 A;  1AXB A;  1Y54 A;  4B4X A;  2ZQD A;  3IF6 B;  3WWX A;  4GD8 A;  3HLC A;  1K55 A;  4HEF A;  1FR6 A;  3NDE A;  4GN2 A;  4ZJ1 A;  1K54 C;  1IYO A;  5DTT A;  1I2S A;  3IH8 A;  3C4P A;  4MBH A;  2WGI A;  4R0Q A;  3UY6 A;  1K55 C;  4D2O A;  5FAS A;  2X02 A;  2WAD A;  2XEP A;  1ZG4 A;  4DXB A;  4GDB A;  4S2L A;  2HDU A;  4UAA A;  5J8X A;  4KZ3 A;  4WEJ A;  1LI0 A;  4Y7P A;  3UPO A;  3IT9 A;  3N6I A;  4HES A;  3IXB A;  4QY5 A;  1FOF A;  3V50 A;  4JPM A;  3N7W A;  5FI2 A;  4FD8 A;  1PWD A;  1IYP A;  1M40 A;  4OPR A;  4X56 A;  5D3O A;  5DF7 A;  1XGJ A;  4OQG A;  5CTN A;  4NK3 A;  3IXG A;  4WYY A;  4WZ5 A;  3S1Y A;  1RP5 A;  3DWK A;  3IF6 A;  3IHB A;  3HLE A;  5GLA A;  5GHZ A;  2Q9M A;  3DTM A;  3ZG5 A;  2A49 A;  1BZA A;  2ZM2 A;  5KSH A;  5CHJ A;  4WZ5 C;  3CG5 A;  4OVD A;  2Y55 A;  3IF6 C;  3SH7 A;  3WS1 A;  2XK1 A;  1ERQ A;  2H0T A;  3IWQ A;  3IWO A;  5U47 A;  4PPR A;  2UWX A;  4JF6 A;  4IVI A;  5E43 A;  1YLZ A;  2IWD A;  3GRJ A;  4S2N A;  1VM1 A;  5CER A;  3OPR A;  3P98 A;  1ES3 A;  5A91 A;  1HD8 A;  4QU3 A;  1W79 A;  5FQK A;  2DNS A;  3QNC A;  3ZNY A;  4UA9 A;  3UE0 A;  2C5W B;  2WKI A;  3E2K A;  3GSG A;  4IBR A;  4Z9Q A;  3NY4 A;  3N8L A;  3Q1F A;  4ID4 A;  2PU4 A;  1IEM A;  2FFY A;  2HP9 A;  4S2J A;  3IXD A; 
#chains in the Genus database with same CATH topology
 1FR1 A;  2JKT M;  3D72 A;  1L0E A;  3CHW P;  5HDD A;  2ZMA A;  3S7Q A;  4X55 A;  3HUM A;  5J3W A;  2FFF B;  5A90 A;  4P6Z S;  5FQQ A;  4BBU A;  5FDS A;  2WZX A;  1GCE A;  3ULF A;  4LV2 A;  3RXW A;  2V2F F;  4P6Z M;  4YWZ A;  3T1X A;  4OQH A;  4HI4 A;  2QKP A;  5HAP A;  2ZQ9 A;  4X1L A;  4LPZ A;  4B93 A;  2P74 A;  3QP6 A;  2HDR A;  3TOI A;  2K31 A;  5G4Z A;  3KSG A;  1K56 D;  4H6J B;  3LCE A;  4DF6 A;  3V5M A;  1J3W A;  5EVI C;  3VOY A;  1VET A;  2HDQ A;  1U60 A;  1BLC A;  3PYP A;  3FYZ A;  4KQD A;  3I7J A;  2EX6 A;  4O0P A;  4CPK A;  4MMN A;  5HSQ A;  1OJG A;  4LFU A;  4ARZ A;  1AWI A;  2XR0 A;  4OPY A;  5CHM A;  2E8I A;  1FCN A;  3A3J A;  1BUE A;  4HY8 A;  1PFL A;  1NRF A;  3G6O A;  1HVB A;  5K5B A;  4PM8 A;  4FCF A;  3A3I A;  4FSF A;  4HNB A;  5DFX A;  1FIK A;  3NIA A;  4KZ8 A;  5DKL A;  3S7P A;  4RVA A;  2ZQ8 A;  4Y15 A;  4EER A;  5CED A;  3W4Q A;  1PI4 A;  4F3L B;  2ZL1 A;  4C3Q A;  4NXF A;  3TSG A;  4IVK A;  1GA0 A;  4MBF A;  5HDC A;  5HPF A;  4RYE A;  5EE8 A;  1T19 A;  3IH9 A;  1NJ4 A;  3MJQ A;  4XXR A;  2XH9 A;  3B47 A;  1TEM A;  3A3E A;  5HL1 A;  4ME4 A;  1NLZ A;  1KGE A;  2I72 A;  1G5U A;  4G3K A;  1YSP A;  3VP3 A;  1FQG A;  2HJ9 C;  1ERO A;  2PT7 A;  2OLV A;  1O07 A;  4RX2 A;  1T1A A;  4L0L A;  2L4R A;  4WEK A;  2VA0 A;  3FKW A;  1H8M A;  3VOZ A;  3VSL A;  3V67 A;  4F94 A;  2C6W B;  3Q7V A;  2M7V A;  2VGL S;  2KOI A;  1OPX A;  2O9B A;  3VP4 A;  5G18 A;  1DY6 A;  1O7E A;  2VGL M;  4GCZ A;  2O9A A;  1H8Z A;  1K56 A;  2Y4A A;  2Y2K A;  3T12 B;  3PXP A;  1G28 A;  3WS2 A;  4QPR A;  4JF5 A;  2X01 A;  1FCO A;  3OBF A;  4KZ6 A;  2XD1 A;  1QMF A;  4R4S A;  2JKF A;  4DDY A;  1YAX A;  2XFT A;  2HZ5 A;  2WKP A;  1BT5 A;  4G3W A;  4ZAM A;  4BJP A;  3ZDJ A;  3EGX C;  3T50 A;  3A3D A;  2HDS A;  1LL9 A;  1MWR A;  4PM9 A;  3MKE A;  2QMI A;  2P08 A;  2W1R A;  4WBG A;  1S1Z A;  5F6A A;  4EWF A;  3BJN A;  3A3F A;  2ZOI A;  4JXG A;  1YM1 A;  4GS9 A;  3IX3 A;  5L10 A;  3FG8 A;  2G7U A;  2A2L A;  3D9Y A;  4M3K A;  3IS2 A;  2OV5 A;  2CC1 A;  1HTZ A;  3JVU A;  5EUA A;  2ZC4 B;  1KGG A;  1S4R A;  1BUL A;  5L09 A;  5TR7 A;  1PW1 A;  2WK0 A;  5FI7 A;  3VP1 A;  1YLT A;  4FUW A;  4S2N C;  4R4R A;  4HJ6 A;  4FH4 A;  4NXE A;  1H5X A;  4K0X A;  3Q81 A;  3R7W A;  2JKR I;  3A0S A;  1PZO A;  1ESI A;  3U2A A;  2Q0O A;  3OPH A;  3E4Q A;  4L9E A;  1N9O A;  1WA9 A;  5A92 A;  3BWL A;  2E8J A;  5L8M A;  1T18 A;  3B42 A;  2B5R A;  3NBL A;  5FL3 A;  4R38 A;  4XUZ A;  1ZHH B;  1K57 C;  2JE5 A;  4CLC B;  4B88 A;  4DRT A;  4E6W A;  4I5S A;  1YT4 A;  4E3N A;  3JVV A;  3F1P A;  4LEN A;  4N9L A;  2G2U A;  1WYC A;  4HH2 A;  1W8Y A;  3MR0 A;  4DKI A;  3CZD A;  2WKQ A;  3ZHH A;  3PAG A;  3WS5 A;  3G4P A;  4EBN A;  3LID A;  1CF0 A;  3OPL A;  4CLC D;  4YIN A;  1E4D A;  5E2H A;  5TJJ A;  3LIE A;  5GHY A;  2EX8 A;  4AFI A;  1LLB A;  3HJK A;  1AXB A;  3SZT A;  1OTA A;  4Y5F A;  4GN2 A;  3F1N B;  1STZ A;  3IH8 A;  4R0Q A;  3UY6 A;  1K55 C;  4HJ3 A;  2WAD A;  2W3G A;  5EVE A;  3C38 A;  4DXB A;  1P9W A;  4UAA A;  4PKY A;  3LR5 A;  4HES A;  5FI2 A;  4FD8 A;  4NXG A;  4X56 A;  5EM0 A;  1XGJ A;  3RFB A;  3DWK A;  3HLE A;  1GSV A;  2A49 A;  5KSH A;  4WZ5 C;  3BY8 A;  1ERQ A;  1N9L A;  1YLZ A;  1VB6 A;  4QU3 A;  3EOI A;  3VV4 A;  2C5W B;  4Y3I A;  2LB9 A;  1SKO B;  4ID4 A;  1IEM A;  2V8C A;  2OAQ 1;  3LYX A;  3UPO A;  4LRZ E;  1Y4O A;  3W4P A;  3M6B A;  1N9B A;  1W7F A;  4N92 A;  1EI5 A;  1E3U D;  3TG9 A;  2WGV A;  2XD5 A;  4GJ4 A;  4KQR A;  2XQZ A;  1ESU A;  4OON A;  1BTL A;  3T1R A;  4MBK A;  5I94 A;  1IEL A;  4GB7 A;  2HGV A;  4IBX A;  4GKU A;  2H28 A;  4GHI B;  5EOE A;  1D1J A;  4KZB A;  1GA9 A;  1VET B;  2ZC7 A;  2JKG A;  3LEZ A;  2BLS A;  3DWZ A;  3O88 A;  3ZNT A;  2R78 A;  2OLU A;  4ARZ B;  1L2S A;  2ZQ7 A;  2XRO A;  2GNX A;  1DJC A;  3LIA A;  3LY4 A;  4I38 A;  2XGN A;  4HP4 A;  4CLC A;  3B33 A;  1G6A A;  4OOY A;  2HP6 A;  4KG2 A;  5M19 A;  1G68 A;  1K54 A;  3MQ0 A;  1XFQ A;  5KZH A;  3LY3 A;  1N4O A;  4LLO B;  3RJU A;  2PU2 A;  4DJ3 A;  4HIA A;  4I39 A;  2OWJ A;  2ZL1 B;  1FSW A;  3W4O A;  5CGW A;  3HUN A;  1LHY A;  2Y2I A;  3EGD C;  1OT9 A;  4MN6 A;  4PHT A;  2JBF A;  3GTC A;  2P9V B;  3IHA A;  2D01 A;  2KX6 A;  3F1N A;  5FQ9 A;  5EVL A;  2EXB A;  5AQ7 A;  1D06 A;  4QHC A;  1BLH A;  2Q9N A;  2Y59 A;  1S6R A;  1NZO A;  3FV7 A;  1TDL A;  5CXW A;  3V39 A;  4EES A;  3ZFZ A;  5L07 A;  3WRT A;  4B4Z A;  1BLS A;  5J4E A;  3KSI A;  1K6S A;  2EWW A;  1SDN A;  5HD5 A;  2R9W A;  4IJG A;  3HVF A;  1JWZ A;  4PM7 A;  1RGY A;  1KVM A;  3Q7V B;  3IBJ A;  5DJU A;  2W1T B;  3D4F A;  1XJ3 A;  2QJ5 A;  1E3U A;  1S66 L;  4JBF A;  4R3B A;  4JGO A;  5HAR A;  3N8R A;  3UE3 A;  1P0Z A;  3BEB A;  4OKP A;  3HLG A;  1SKO A;  4BD0 A;  2Z6D A;  1K25 A;  2B95 A;  5JYP A;  1H8Y A;  3KYQ A;  3V3R A;  3H9W A;  1Q2P A;  4JGR A;  4C75 A;  2Y2G A;  3QP1 A;  3ZG7 B;  1KE3 A;  1KE4 A;  3BFC A;  3ZG0 A;  2JKR M;  2GZA A;  3NOT C;  1C3B A;  5F82 A;  4EUZ A;  3NC8 A;  4ZJ2 A;  4OP8 A;  3IX8 A;  2Y2M A;  4MDZ A;  1JWP A;  4U0X A;  5GLC A;  4GOG A;  2UV0 E;  1F98 A;  4DE0 A;  2J7V A;  3NEC A;  5HZH A;  2Z2M B;  1P9R A;  3OOV A;  2ACG A;  4GHI A;  4Q0H A;  1TD5 A;  3SW1 A;  2V1B A;  5M1A A;  4WL9 A;  2M7U A;  5KMW A;  2P04 A;  4Q0I A;  1LT0 A;  1Y28 A;  3WS4 A;  2V20 A;  3NHQ A;  1K4F A;  3C7U A;  4Y13 A;  4HP9 A;  1VQQ A;  5DTS A;  5E2G A;  4GS9 B;  2ZC3 B;  3RXX A;  5LBR A;  4S2O A;  4DDS A;  4ZJ3 A;  3VOL A;  3IS2 B;  3N8S A;  3OLO A;  3ISG A;  2V0U A;  1MY8 A;  4HBU A;  1IKI A;  3C8C A;  5HPI A;  4UHU A;  3CWF A;  2JHE A;  1W8Q A;  5TFQ A;  5CEC A;  5DKK A;  2A3U A;  4BL2 A;  2WKE A;  3ZG8 B;  3A0R A;  4E3J A;  1S67 L;  3ZG9 B;  3V3S A;  1HZO A;  1F2K A;  4RA7 A;  1ONG A;  2PBD P;  3R7W B;  2GX5 A;  3C2W A;  4QY6 A;  4KQO A;  3R4K A;  2ZQC A;  3VP2 A;  1MWU A;  3Q7Z A;  1LSV A;  4JGP A;  2JN7 A;  5GLD A;  1NYY A;  2DRW A;  1LI9 A;  1XKZ A;  2HJE A;  2P9V A;  3GEC A;  1ALQ A;  4OOL A;  5AVE A;  2VGJ A;  1GSW A;  2PD7 A;  3MF0 A;  2WGW A;  4KEN B;  4JKT A;  5CRF A;  4O7D A;  2W27 A;  4P85 A;  3W8K A;  4OLG A;  4EV4 A;  3TE8 A;  3OC2 A;  1LSX A;  4QJG A;  4QWO A;  2VGK A;  2WAF A;  2ZC6 B;  4FTX A;  2HP5 A;  5M18 A;  3F1P B;  3UPN A;  5F68 A;  5HD3 A;  2Y2O A;  3LR0 A;  2K2N A;  4WLA A;  4EEU A;  3P01 A;  2W1T A;  1PI5 A;  4M4X A;  4CJN A;  3PBR A;  4G3V A;  1FSY A;  2Y8H A;  3CUE C;  3KYZ A;  5AQB A;  1UGU A;  4WZ4 A;  3LI8 A;  3IF5 A;  3UE6 A;  2L1M A;  3UB9 A;  1KE0 A;  1WYB A;  5HWV A;  4KZA A;  4E3L A;  1W63 Q;  2ZD8 A;  3VP0 A;  2EX2 A;  3QP8 A;  4OPZ A;  3UDF A;  2OOL A;  2WKH A;  4JXW A;  4H8R A;  3FWL A;  4S2I A;  4Y0O A;  4KZ4 A;  2XDM A;  4CLC C;  3SS5 A;  4E3O A;  3FZC A;  3T4L A;  2ZQD A;  3HLC A;  1TS8 A;  3NDE A;  1K54 C;  2I9V A;  1IYO A;  5FAS A;  3C4P A;  2WGI A;  2XEP A;  1ZG4 A;  5AJG A;  4GDB A;  4ESP A;  4S2L A;  3RTY A;  4KZ3 A;  4WEJ A;  3MMH A;  3N6I A;  4QY5 A;  1FOF A;  4JPM A;  2INW A;  1PWD A;  5CTN A;  1TS6 A;  4NK3 A;  3IXG A;  2HV1 A;  3IF6 A;  2FZ0 A;  3IHB A;  3NUL A;  5GLA A;  2ZM2 A;  3CI6 A;  3D3O A;  2H0T A;  2XK1 A;  3IWQ A;  3IWO A;  3CAX A;  4PPR A;  5E43 A;  1FIL A;  3OPR A;  2DNS A;  3ZNY A;  4UA9 A;  3UE0 A;  4WN5 A;  2VEA A;  2WKI A;  3E2K A;  3GSG A;  3NY4 A;  3U4L P;  3PBO A;  5FAP A;  4S2J A;  2O9C A;  2H5S A;  2ZM8 A;  4YNR A;  3BRM A;  1NY0 A;  1XPB A;  3LIB A;  4O01 A;  2R9X A;  5IT5 A;  4JXS A;  2O99 A;  3LO7 A;  1KDS A;  2VKS A;  3BQA A;  4O8G A;  4IHQ A;  2PBY A;  3MZE A;  1K38 A;  4ZDX A;  4YFM A;  3LGO A;  5KSC A;  2J9O A;  3O3V A;  3HUO A;  4EQI A;  3RH8 B;  3G31 A;  1KGF A;  4HOI A;  1G6O A;  1XX2 A;  3GDI A;  1MWT A;  2J80 A;  3BFD A;  5FQM A;  3H7W A;  1K0K A;  2EFX A;  5EVI A;  5CTM A;  4ETZ A;  4Q0J A;  2EA9 A;  4MN5 A;  1XGI A;  3IQA A;  4N1X A;  5FA7 A;  3L7H A;  3NDG A;  2PR6 A;  4EBL A;  1S4S A;  3LIC A;  2J9P A;  4LCL A;  1CQA A;  1K6R A;  1UWP X;  1PYY A;  3UME A;  4ETX A;  5A93 A;  5GL9 A;  2L0W A;  4HH3 A;  1S1Y A;  3K2N A;  4P6B A;  2FH5 A;  3AGF A;  4KG5 A;  3HLD A;  3A0V A;  4R3J A;  4HBT A;  4GZB A;  1BSG A;  3M2K A;  3BQ8 A;  3G34 A;  4N9K A;  3T1Q B;  1V9Z A;  3HBR A;  3T4T A;  2XFS A;  2ZMF A;  1E25 A;  3FKV A;  5MC7 A;  1TVF A;  3QP5 A;  3KSF A;  4EEP A;  4JLF A;  1YLP A;  4I3A A;  4LV0 A;  1DP6 A;  4JXV A;  4BWI A;  2J3T D;  1ERM A;  1MC0 A;  1IOU A;  3OCN A;  4WEL A;  5F1G A;  1YMX A;  3B3X A;  2QPN A;  1EWZ A;  2QJ7 A;  4MNR A;  5FDH A;  2A24 B;  4I3J A;  2DCF A;  1TS7 A;  1TS0 A;  5F83 A;  1L0G A;  1F9I A;  2PRF A;  5EPH A;  4D60 A;  5IU1 A;  1YKD A;  1PZP A;  5FI6 A;  3PBS A;  3BLM A;  4Y17 A;  3C7V A;  1XA1 A;  3G2Z A;  1SKF A;  1PWG A;  4LRY C;  3GR2 A;  2BAS A;  3CJM A;  2WUQ A;  1IYS A;  3ZVW A;  4OOM A;  2ZC5 B;  2ZOH A;  5CX7 A;  4BBV A;  3UMD A;  3T4K A;  4N1H A;  1ONH A;  4C6Y A;  4ZTK A;  2VV6 A;  1CEF A;  4Y0U A;  3G2Y A;  2VV7 A;  4GNU A;  3P7N A;  2B02 A;  4K91 A;  1YSQ A;  4KUO A;  1ES4 A;  4GLQ A;  3SH8 A;  3UE1 A;  5G4Y A;  3MKF A;  3EQU A;  4OLD A;  4BEN A;  5BOH A;  1W5D A;  3AGD A;  3DAV A;  4HQA A;  5DJT A;  1XP4 A;  3E4P A;  4DN0 A;  5HW3 A;  3MS6 A;  3VFH A;  3MZD A;  4R6L A;  3E4O A;  3UO9 A;  1L0D A;  4KUK A;  4LV3 A;  3UDX A;  2CMN A;  3EEH A;  3HLF A;  4P87 A;  1MWS A;  3VSK A;  3O87 A;  3NOP C;  4I3I A;  3P09 A;  2GDN A;  4U0T A;  2Y2J A;  5AQA A;  2ZMV A;  4EQ1 A;  2PHY A;  1Z6F A;  3ZGA B;  2Y79 A;  5AQ9 A;  3GV9 A;  3Q82 A;  5EFW A;  1GHI A;  2GJ3 A;  4BQM A;  2K7S A;  3MXS A;  3O5Y A;  2WGW B;  1SDE A;  2W3D A;  1IFQ A;  3JYI A;  4BLM A;  3ITB A;  2KLI A;  1W63 M;  2VLG A;  1GHM A;  2Y2N A;  5HL6 A;  3PBN A;  4NET A;  4R1G A;  3MFD A;  2BTF P;  4GDN A;  2VJW A;  1OT6 A;  3T4Q A;  2ZJ9 A;  1WE4 A;  1PW8 A;  3TJZ C;  4WM9 A;  3H82 A;  1EW0 A;  5DVA A;  1QME A;  2H10 A;  1DJA A;  1J9M A;  3ZVT A;  2QYB A;  3BFF A;  1K4E A;  3PTE A;  1MXO A;  1IYQ A;  4E3I A;  1ZTU A;  2A24 A;  1SCW A;  3HLB A;  2RCX A;  3HRE A;  4KQQ A;  1TF1 A;  2XA7 S;  1OTD A;  2J8Y A;  3G30 A;  1JVJ A;  1K57 A;  1VEU A;  5C5K A;  4DJ2 A;  3HLW A;  2B18 A;  2ZM0 A;  4XUX A;  2XA7 M;  1ZC2 A;  4JF4 A;  1F5M A;  2O0Y A;  4PMA A;  3CMZ A;  2V0W A;  3QNB A;  5F69 A;  1NRJ A;  1KVL A;  2V9A A;  1YLY A;  1JNU A;  3DBA A;  5I5L A;  1GHP A;  1ACF A;  4Y0T A;  3S7N A;  4OQI A;  1YMS A;  5KIZ A;  2WZZ A;  4GW9 A;  2Y2Q A;  4MCW A;  4E3M A;  1T1C A;  4B4X A;  3IF6 B;  3VE4 A;  1K55 A;  4HEF A;  2EWV A;  5DTT A;  1I2S A;  1PRQ A;  4D2O A;  3KSH A;  2P7J A;  1CJF A;  5J8X A;  1V9Y A;  3CPT A;  1OTB A;  4II7 A;  3IXB A;  3V50 A;  3N7W A;  3PHY A;  1UWN X;  1M40 A;  5DF7 A;  5D3O A;  4WYY A;  4WZ5 A;  3S1Y A;  3T1S A;  1RP5 A;  4WUJ A;  1HLU P;  4E04 A;  2Q9M A;  3DTM A;  3ZG5 A;  3NJA A;  1BZA A;  4YOF A;  4OVD A;  3SH7 A;  3WS1 A;  4DMZ A;  1OTI A;  5AVF A;  4XT2 A;  5EM1 A;  2D02 A;  1VM1 A;  3P98 A;  1ES3 A;  5FQK A;  4PKY G;  5IS1 A;  4IBR A;  4L9F A;  3N8L A;  2PU4 A;  2FFY A;  1PIO A;  2XF3 A;  5HX9 A;  3UB7 A;  4R23 A;  3W2Z A;  1JTG A;  1P97 A;  4PM5 A;  4EBP A;  3ZCZ A;  2MJ6 A;  4E6X A;  3CIT A;  3C4O A;  5FSR A;  3MBZ A;  3SS3 A;  1S0W A;  3BM6 A;  2W0N A;  5A8B A;  2AVX A;  3H7W B;  1NZU A;  3ITA A;  5EVI B;  2Y2L A;  3E2L A;  1YQS A;  1DP8 A;  1D7E A;  3NI9 A;  2W3H A;  1ES5 A;  2YKH A;  1N9N A;  4GD6 A;  4A5R A;  1ODV A;  5CEB A;  4Q8I A;  3LUQ A;  3M2J A;  3BFG A;  1SZV A;  3K3C A;  1BLP A;  3G32 A;  4DE1 A;  2EFU A;  5F5Y A;  5EVI D;  3LEQ A;  3IWI A;  3IXH A;  2JCH A;  2WAE A;  1PNE A;  1MZU A;  5FAO A;  3K3D A;  3IX4 A;  5HWT A;  5TBM B;  1ZG6 A;  2YKF A;  1I2W A;  2LB5 A;  1BYW A;  3IBR A;  3LFV A;  4NKP A;  4DE2 A;  4UEY A;  3M6H A;  4OQ0 A;  4ZRR A;  4H6J A;  4FH2 A;  4ZBE A;  1OJ5 A;  3ZYT A;  2PAV P;  4R3A A;  4OH0 A;  1YLJ A;  1GSX A;  1ES2 A;  3EWK A;  4X6T A;  5EEC A;  2WYX A;  3F1O B;  5L2F A;  2V8F A;  3OZH A;  4K0W A;  3E98 A;  2IWB A;  3AGE A;  4X53 A;  4QB8 A;  4CLC E;  3GVB A;  2JKT I;  3G35 A;  1I5Q A;  4EET B;  2RL3 A;  4KZ7 A;  2OAP 1;  3PR6 A;  1DRM A;  4QD4 A;  1CK3 A;  2J3T C;  4PM6 A;  3PBQ A;  3WS0 A;  5GHX A;  2VK3 A;  1DP9 A;  3NCK A;  3MQQ A;  5DF9 A;  2J3W A;  3KYE A;  2QHK A;  4NG2 A;  3MZF A;  2PR5 A;  1RGZ A;  2PDR A;  5JYO A;  2Y91 A;  4F3L A;  3DW0 A;  4LRX C;  1OME A;  5FAT A;  1XA7 A;  3VFF A;  5CHU A;  4E3K A;  4IUH A;  1Z09 A;  4X69 A;  3UB8 A;  2XLN A;  4LGW A;  1NXY A;  2EXA A;  2X71 A;  3BYD A;  3S4X A;  1NYM A;  1TDG A;  1VHM A;  3BEC A;  1CI9 A;  2IWC A;  3SH9 A;  3EQV A;  2V1A A;  3LIF A;  1LL5 A;  2G2W A;  1OTE A;  5EOO A;  1X0O A;  4RQ9 A;  3TRC A;  4RX3 A;  4BMW A;  4BBT A;  1IKG A;  3PBT A;  3NOU C;  2QWS A;  3ICY A;  1H3Q A;  2M1C A;  4MN7 A;  3DTI A;  3DTK A;  2V1Z A;  2Y2H A;  3VE3 A;  4LV1 A;  4BD1 A;  3FPW A;  1JWV A;  4S2P A;  3OPP A;  2OSU A;  4L9G A;  1A0K A;  4BL3 A;  2ZBB A;  3BW6 A;  5DTK A;  5HAI A;  2ZLY A;  2Y2P A;  2PD8 A;  4WMC D;  4P0M A;  1MBL A;  4JGQ A;  3DTE A;  1MPL A;  4UA7 A;  5FEG A;  4HJ4 A;  1YLW A;  5HWW A;  5FAQ A;  1NLY A;  5TGF A;  2DMW A;  1LSW A;  3UPP A;  3E0Y A;  2PYP A;  2VX8 A;  5TBM A;  1KOU A;  1MKM A;  4NXB A;  5CGX A;  5FQI A;  5HAQ A;  3C5A A;  4X25 A;  3MXR A;  1CEG A;  2HF6 A;  3OCL A;  3H82 B;  3UN7 A;  4OPQ A;  4LCM A;  3QHY A;  4R70 A;  4MEZ A;  1H0M A;  2IA2 A;  3PAE A;  4KG6 A;  5F1F A;  2QZ6 A;  3FC7 A;  4HHD A;  4MLL A;  1XJ6 A;  4EU0 A;  5EV0 A;  3F1O A;  3GMW A;  1RCJ A;  3N4I A;  1L0F A;  1SHV A;  2NUP C;  1XJ4 A;  3KO6 A;  3QP2 A;  4DE3 A;  2HPB A;  5E2E A;  1VEU B;  3SOI A;  2BG1 A;  3LI9 A;  1DJB A;  4S2M A;  4EXO A;  1CI8 A;  1L3L A;  2Z2L B;  3HJI A;  4S2K A;  4Y2F A;  4DXC A;  5FQJ A;  3HL9 A;  1M6K A;  3VMA A;  5HFO A;  1ZKJ A;  3SS4 A;  3O86 A;  5GLB A;  2EX9 A;  1XXM A;  2XSS A;  4FOF A;  4X68 A;  5CGS A;  2XRN A;  3BFE A;  2JC7 A;  3FPV A;  2Z6C A;  3CUE A;  4IED A;  4WF0 A;  3Q07 A;  1NWZ A;  3S22 A;  1FCM A;  1XJ2 A;  3MSH A;  2W3F A;  2ZQA A;  3C30 A;  5IHV A;  5E2F A;  4EW7 A;  3LR4 A;  4EUV A;  1XFN A;  3L9K A;  4PAU A;  5DF8 A;  4UA6 A;  4U3T A;  3UNW A;  5FEF A;  3WRZ A;  4NEE D;  1KDW A;  2OWH A;  1MKI A;  3TW8 A;  3UDI A;  2WKR A;  1PWC A;  3GQZ A;  3CPT B;  4KZ5 A;  4WMC A;  1JTD A;  3CLO A;  4K08 A;  3BLS A;  3EEA A;  4KZ9 A;  2H0Y A;  1Q2Q A;  4OP5 A;  4IUK A;  3T4O A;  1Y54 A;  2NUT C;  5J7E A;  3T4S A;  3WWX A;  4GD8 A;  3UB5 P;  1FR6 A;  2PYR A;  4ZJ1 A;  3MFX A;  4MBH A;  1LL8 A;  3QP4 A;  4XT2 B;  2X02 A;  3LR3 A;  5DFY A;  4CQH A;  3KX0 X;  4UQI S;  3S7O A;  1YPR A;  2HDU A;  4Y7P A;  1LI0 A;  3IT9 A;  3JPU A;  2VV8 A;  1IYP A;  4UQI M;  4B9O A;  4OPR A;  4OQG A;  5HDS A;  3MXQ A;  5GHZ A;  5CHJ A;  3CG5 A;  2VZW A;  2Y55 A;  3IF6 C;  3T4J A;  5U47 A;  2UWX A;  4JF6 A;  4IVI A;  4Z1W A;  2IWD A;  3GRJ A;  4S2N A;  5CER A;  3UB6 A;  5A91 A;  1HD8 A;  1W79 A;  3QNC A;  3MQO A;  2KDK A;  4X1M A;  3ZQ5 A;  1T1B A;  2W3E A;  4Z9Q A;  3Q1F A;  3BY9 A;  2HP9 A;  3HCY A;  3IXD A; 
#chains in the Genus database with same CATH homology
 1FR1 A;  1PIO A;  2XF3 A;  5HX9 A;  3W4P A;  1L0E A;  3M6B A;  2ZMA A;  1N9B A;  2H5S A;  1W7F A;  2ZM8 A;  4N92 A;  4R23 A;  4X55 A;  3BRM A;  3HUM A;  1NY0 A;  1EI5 A;  1XPB A;  1JTG A;  1E3U D;  2FFF B;  3TG9 A;  5A90 A;  4PM5 A;  2WGV A;  2R9X A;  2XD5 A;  4EBP A;  3ZCZ A;  4KQR A;  4JXS A;  3LO7 A;  5FQQ A;  4E6X A;  3C4O A;  5FSR A;  3MBZ A;  3SS3 A;  2XQZ A;  1KDS A;  1ESU A;  1S0W A;  1GCE A;  1BTL A;  2WZX A;  4OON A;  4MBK A;  3BM6 A;  1IEL A;  5I94 A;  4LV2 A;  4GB7 A;  3RXW A;  2V2F F;  1NZU A;  3ITA A;  5EVI B;  2PBY A;  4IBX A;  2Y2L A;  1K38 A;  3MZE A;  4GKU A;  3E2L A;  4OQH A;  5EOE A;  1YQS A;  5HAP A;  4KZB A;  4ZDX A;  1GA9 A;  2ZC7 A;  4YFM A;  2ZQ9 A;  3NI9 A;  5KSC A;  2J9O A;  3O3V A;  1ES5 A;  4GD6 A;  3HUO A;  4EQI A;  4A5R A;  2P74 A;  3G31 A;  3LEZ A;  5CEB A;  2BLS A;  3DWZ A;  3O88 A;  4Q8I A;  1KGF A;  3ZNT A;  3M2J A;  3BFG A;  2OLU A;  1XX2 A;  1BLP A;  1L2S A;  2ZQ7 A;  3G32 A;  1MWT A;  2HDR A;  3TOI A;  4DE1 A;  2EFU A;  1DJC A;  3BFD A;  5FQM A;  5EVI D;  1K56 D;  3LCE A;  3LY4 A;  2EFX A;  5EVI A;  3IWI A;  5CTM A;  4DF6 A;  3V5M A;  3IXH A;  2WAE A;  2JCH A;  2XGN A;  5EVI C;  1XGI A;  3IQA A;  3VOY A;  1G6A A;  4OOY A;  2HDQ A;  1U60 A;  2HP6 A;  4N1X A;  1BLC A;  5FAO A;  4KG2 A;  5FA7 A;  5M19 A;  3FYZ A;  3NDG A;  4EBL A;  3PBO A;  1G68 A;  1ZG6 A;  1K54 A;  3I7J A;  2EX6 A;  5KZH A;  2J9P A;  3LY3 A;  4LCL A;  4CPK A;  1I2W A;  1N4O A;  4DE2 A;  1K6R A;  3RJU A;  2PU2 A;  1PYY A;  3M6H A;  4OQ0 A;  2XR0 A;  4OPY A;  5A93 A;  5CHM A;  2E8I A;  5GL9 A;  1FCN A;  1FSW A;  3W4O A;  4FH2 A;  3A3J A;  1BUE A;  4ZBE A;  5CGW A;  4OH0 A;  4P6B A;  1YLJ A;  1ES2 A;  3HUN A;  3AGF A;  4KG5 A;  1LHY A;  3HLD A;  1NRF A;  4R3J A;  4HBT A;  4X6T A;  2Y2I A;  4GZB A;  1BSG A;  3M2K A;  2WYX A;  3G34 A;  4N9K A;  5EEC A;  3HBR A;  1HVB A;  2XFS A;  5L2F A;  2JBF A;  1E25 A;  4PM8 A;  4FCF A;  3OZH A;  3A3I A;  3GTC A;  4FSF A;  2P9V B;  3IHA A;  4K0W A;  5FQ9 A;  3FKV A;  2IWB A;  5EVL A;  3NIA A;  1TVF A;  3AGE A;  4KZ8 A;  2EXB A;  4RVA A;  2ZQ8 A;  4X53 A;  5AQ7 A;  4QB8 A;  4JLF A;  4QHC A;  1YLP A;  3GVB A;  1BLH A;  2Q9N A;  2Y59 A;  3G35 A;  1I5Q A;  1PI4 A;  1S6R A;  4LV0 A;  3W4Q A;  4C3Q A;  4JXV A;  1NZO A;  3FV7 A;  1TDL A;  2RL3 A;  5CXW A;  3TSG A;  1ERM A;  3OCN A;  4KZ7 A;  4IVK A;  4WEL A;  1GA0 A;  1YMX A;  3B3X A;  4MBF A;  5F1G A;  4QD4 A;  2QPN A;  3V39 A;  4RYE A;  1CK3 A;  5EE8 A;  3WRT A;  3ZFZ A;  1EWZ A;  4PM6 A;  4B4Z A;  3IH9 A;  1BLS A;  1NJ4 A;  4MNR A;  3PBQ A;  1K6S A;  5FDH A;  1SDN A;  4XXR A;  5GHX A;  3WS0 A;  2R9W A;  2XH9 A;  3NCK A;  1TEM A;  3A3E A;  5HL1 A;  3HVF A;  1JWZ A;  4PM7 A;  1RGY A;  5DF9 A;  1KVM A;  2DCF A;  3Q7V B;  1KGE A;  2I72 A;  5F83 A;  3D4F A;  3MZF A;  1E3U A;  4R3B A;  4JBF A;  1FQG A;  5HAR A;  1ERO A;  1L0G A;  3VP3 A;  3N8R A;  1RGZ A;  2OLV A;  5EPH A;  5JYO A;  1O07 A;  2Y91 A;  4RX2 A;  3UE3 A;  3DW0 A;  1OME A;  3BEB A;  5FAT A;  1PZP A;  1XA7 A;  4OKP A;  3VFF A;  4L0L A;  3HLG A;  5CHU A;  4WEK A;  4E3K A;  4X69 A;  5FI6 A;  3PBS A;  2XLN A;  3BLM A;  1NXY A;  2EXA A;  1K25 A;  2X71 A;  3BYD A;  1XA1 A;  3C7V A;  3FKW A;  3G2Z A;  5JYP A;  3VOZ A;  1SKF A;  1H8Y A;  1PWG A;  3V3R A;  3S4X A;  1NYM A;  1TDG A;  3GR2 A;  1Q2P A;  3VSL A;  4C75 A;  2Y2G A;  3ZG7 B;  3CJM A;  1KE3 A;  1KE4 A;  3BEC A;  2WUQ A;  4F94 A;  2C6W B;  1CI9 A;  1IYS A;  2IWC A;  3BFC A;  3ZVW A;  4OOM A;  2ZC5 B;  3SH9 A;  3ZG0 A;  3EQV A;  3Q7V A;  1C3B A;  5F82 A;  4EUZ A;  1LL5 A;  2G2W A;  3NC8 A;  4N1H A;  4ZJ2 A;  1ONH A;  4C6Y A;  4ZTK A;  5EOO A;  4OP8 A;  2Y2M A;  1CEF A;  4Y0U A;  3G2Y A;  4GNU A;  5G18 A;  3VP4 A;  1JWP A;  4K91 A;  4U0X A;  4RX3 A;  5GLC A;  4GOG A;  4DE0 A;  1DY6 A;  1IKG A;  1O7E A;  3PBT A;  2J7V A;  1ES4 A;  1H8Z A;  1K56 A;  3SH8 A;  3UE1 A;  2Z2M B;  2Y4A A;  3EQU A;  3MKF A;  2Y2K A;  4OLD A;  4BEN A;  3WS2 A;  5BOH A;  1W5D A;  2V1Z A;  2Y2H A;  3AGD A;  4JF5 A;  2X01 A;  5M1A A;  5KMW A;  4LV1 A;  1XP4 A;  5HW3 A;  4BD1 A;  1FCO A;  4S2P A;  1JWV A;  3OPP A;  3WS4 A;  2OSU A;  4KZ6 A;  2XD1 A;  3VFH A;  4BL3 A;  3MZD A;  1QMF A;  4R4S A;  5DTK A;  5HAI A;  2V20 A;  2ZLY A;  2Y2P A;  1K4F A;  3UO9 A;  3C7U A;  1L0D A;  2XFT A;  4DDY A;  4LV3 A;  4P0M A;  4WMC D;  3UDX A;  1MBL A;  1VQQ A;  1BT5 A;  5DTS A;  3HLF A;  5E2G A;  2ZC3 B;  3RXX A;  4ZAM A;  4P87 A;  1MPL A;  1MWS A;  4BJP A;  3ZDJ A;  3VSK A;  4S2O A;  4UA7 A;  3O87 A;  4ZJ3 A;  4DDS A;  3N8S A;  1YLW A;  3P09 A;  2GDN A;  5FAQ A;  4U0T A;  2Y2J A;  5TGF A;  3A3D A;  2HDS A;  3ISG A;  3UPP A;  1LL9 A;  5AQA A;  1MY8 A;  1MWR A;  4HBU A;  4PM9 A;  1IKI A;  1Z6F A;  3ZGA B;  3MKE A;  2QMI A;  4UHU A;  4WBG A;  5AQ9 A;  4BD0 A;  3GV9 A;  1W8Q A;  3Q82 A;  5TFQ A;  5CEC A;  5CGX A;  2A3U A;  5FQI A;  4BL2 A;  2WKE A;  5HAQ A;  3C5A A;  1GHI A;  4EWF A;  3MXR A;  4BQM A;  3A3F A;  4JXG A;  3ZG8 B;  1CEG A;  3OCL A;  3MXS A;  1YM1 A;  2WGW B;  4E3J A;  3UN7 A;  1SDE A;  4OPQ A;  3ZG9 B;  3V3S A;  3JYI A;  4BLM A;  3ITB A;  1HZO A;  4RA7 A;  4M3K A;  1ONG A;  1GHM A;  2Y2N A;  3QHY A;  4LCM A;  2OV5 A;  2CC1 A;  1HTZ A;  3PBN A;  5EUA A;  4QY6 A;  4KQO A;  4MEZ A;  2ZC4 B;  4NET A;  4R1G A;  3MFD A;  3PAE A;  4KG6 A;  5F1F A;  2ZQC A;  2QZ6 A;  3VP2 A;  1MWU A;  1KGG A;  3Q7Z A;  4GDN A;  4MLL A;  1BUL A;  5TR7 A;  1PW1 A;  2WK0 A;  5FI7 A;  3VP1 A;  5CED A;  5GLD A;  3GMW A;  1NYY A;  1RCJ A;  1YLT A;  2ZJ9 A;  2DRW A;  3N4I A;  1LI9 A;  1WE4 A;  1PW8 A;  2P9V A;  1XKZ A;  1ALQ A;  4OOL A;  1L0F A;  1SHV A;  4S2N C;  2VGJ A;  4R4R A;  4WM9 A;  2WGW A;  4DE3 A;  2HPB A;  4FH4 A;  4KEN B;  5E2E A;  4JKT A;  5DVA A;  1QME A;  1H5X A;  4K0X A;  3Q81 A;  5CRF A;  3SOI A;  2H10 A;  4O7D A;  2BG1 A;  1DJA A;  4P85 A;  1J9M A;  4OLG A;  3W8K A;  3ZVT A;  4EV4 A;  1DJB A;  3OC2 A;  3BFF A;  4QJG A;  4S2M A;  1PZO A;  1CI8 A;  1ESI A;  1K4E A;  2VGK A;  3PTE A;  2WAF A;  2Z2L B;  1MXO A;  2ZC6 B;  1IYQ A;  4S2K A;  2HP5 A;  4DXC A;  4E3I A;  5FQJ A;  3HL9 A;  5M18 A;  3OPH A;  1M6K A;  3UPN A;  3VMA A;  1SCW A;  5HFO A;  1ZKJ A;  3HLB A;  2Y2O A;  3SS4 A;  2RCX A;  3O86 A;  3HRE A;  5GLB A;  4KQQ A;  2EX9 A;  1XXM A;  5A92 A;  2J8Y A;  4X68 A;  1PI5 A;  5CGS A;  3BFE A;  3G30 A;  2JC7 A;  1JVJ A;  4CJN A;  2B5R A;  3PBR A;  4IED A;  1K57 A;  3NBL A;  1FSY A;  3HLW A;  3Q07 A;  3S22 A;  1FCM A;  4XUZ A;  2ZM0 A;  4XUX A;  1K57 C;  2JE5 A;  1ZC2 A;  4B88 A;  4DRT A;  2ZQA A;  4JF4 A;  4E6W A;  4PMA A;  5AQB A;  4WZ4 A;  1YT4 A;  4E3N A;  3CMZ A;  3IF5 A;  5IHV A;  1KE0 A;  3QNB A;  4LEN A;  5E2F A;  1KVL A;  4N9L A;  2G2U A;  1WYB A;  1YLY A;  4KZA A;  4E3L A;  2ZD8 A;  1WYC A;  5DF8 A;  4UA6 A;  1W8Y A;  2EX2 A;  3VP0 A;  5FAP A;  4DKI A;  3CZD A;  4U3T A;  3UNW A;  3ZHH A;  1GHP A;  4Y0T A;  3PAG A;  4OQI A;  3WRZ A;  3WS5 A;  1KDW A;  4OPZ A;  3G4P A;  4EBN A;  1YMS A;  1MKI A;  3UDI A;  3UDF A;  1PWC A;  3OPL A;  3GQZ A;  2WKH A;  4JXW A;  4KZ5 A;  4YIN A;  2WZZ A;  3FWL A;  1E4D A;  4H8R A;  4WMC A;  4S2I A;  5E2H A;  2Y2Q A;  4E3M A;  1JTD A;  4Y0O A;  4KZ4 A;  5GHY A;  2EX8 A;  3BLS A;  1LLB A;  2XDM A;  4KZ9 A;  3SS5 A;  3FZC A;  4E3O A;  2H0Y A;  1Q2Q A;  4OP5 A;  1AXB A;  1Y54 A;  4B4X A;  2ZQD A;  3IF6 B;  3WWX A;  4GD8 A;  3HLC A;  1K55 A;  4HEF A;  1FR6 A;  3NDE A;  4GN2 A;  4ZJ1 A;  1K54 C;  1IYO A;  5DTT A;  1I2S A;  3IH8 A;  3C4P A;  4MBH A;  2WGI A;  4R0Q A;  3UY6 A;  1K55 C;  4D2O A;  5FAS A;  2X02 A;  2WAD A;  2XEP A;  1ZG4 A;  4DXB A;  4GDB A;  4S2L A;  2HDU A;  4UAA A;  5J8X A;  4KZ3 A;  4WEJ A;  1LI0 A;  4Y7P A;  3UPO A;  3IT9 A;  3N6I A;  4HES A;  3IXB A;  4QY5 A;  1FOF A;  3V50 A;  4JPM A;  3N7W A;  5FI2 A;  4FD8 A;  1PWD A;  1IYP A;  1M40 A;  4OPR A;  4X56 A;  5D3O A;  5DF7 A;  1XGJ A;  4OQG A;  5CTN A;  4NK3 A;  3IXG A;  4WYY A;  4WZ5 A;  3S1Y A;  1RP5 A;  3DWK A;  3IF6 A;  3IHB A;  3HLE A;  5GLA A;  5GHZ A;  2Q9M A;  3DTM A;  3ZG5 A;  2A49 A;  1BZA A;  2ZM2 A;  5KSH A;  5CHJ A;  4WZ5 C;  3CG5 A;  4OVD A;  2Y55 A;  3IF6 C;  3SH7 A;  3WS1 A;  2XK1 A;  1ERQ A;  2H0T A;  3IWQ A;  3IWO A;  5U47 A;  4PPR A;  2UWX A;  4JF6 A;  4IVI A;  5E43 A;  1YLZ A;  2IWD A;  3GRJ A;  4S2N A;  1VM1 A;  5CER A;  3OPR A;  3P98 A;  1ES3 A;  5A91 A;  1HD8 A;  4QU3 A;  1W79 A;  5FQK A;  2DNS A;  3QNC A;  3ZNY A;  4UA9 A;  3UE0 A;  2C5W B;  2WKI A;  3E2K A;  3GSG A;  4IBR A;  4Z9Q A;  3NY4 A;  3N8L A;  3Q1F A;  4ID4 A;  2PU4 A;  1IEM A;  2FFY A;  2HP9 A;  4S2J A;  3IXD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...