4X53A

Structure of the class d beta-lactamase oxa-160 v130d in acyl-enzyme complex with aztreonam
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
245
structure length
243
Chain Sequence
MHISSQQHEKAIKSYFDEAQTQGVIIIKEGKNLSTYGNALARANKEYVPASTFKMLNALIGLENHKATTNEIFKWDGKKRTYPMWEKDMTLGEAMALSADPVYQELARRTGLELMQKEVKRVNFGNTNIGTQVDNFWGPLKITPVQEVNFADDLAHNRLPFKLETQEEVKKMLLIKEVNGSKIYAKSGWGMGVTSQVGWLTGWVEQANGKKIPFSLNLEMKEGMSGSIRNEITYKSLENLGII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Activity against Aztreonam and Extended Spectrum Cephalosporins for Two Carbapenem-Hydrolyzing Class D beta-Lactamases from Acinetobacter baumannii.
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Hydrolase
molecule keywords Class D beta-lactamase OXA-160
total genus 80
structure length 243
sequence length 245
ec nomenclature
pdb deposition date 2014-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4x53A00
1BLPA 2FFFB 2P9VB 3S22A 2DRWA 4B88A 5CEDA 3MZDA 2HP5A 1L2SA 1S0WA 4QY6A 3ZVWA 3W4OA 4PPRA 3IH9A 1K54C 1SCWA 1MWTA 4YFMA 3DWZA 1ERMA 1FR6A 5HX9A 1IYPA 3JYIA 2G2WA 3G34A 4E6WA 3M2KA 3ZG5A 4WEKA 4Y0TA 1MWRA 4A5RA 3SS4A 1EROA 3ZDJA 3O87A 3UPOA 3V3SA 1LLBA 3FYZA 3IHAA 2XFTA 3PBRA 1SDEA 5FQQA 1IEMA 5CGSA 2X01A 3UDXA 3BFFA 4X56A 1JWPA 4X55A 3FKVA 5JYOA 1ES2A 4WZ5C 1U60A 1EWZA 3HVFA 3PBQA 5I94A 5E2EA 5KSCA 4K91A 2XLNA 3VP1A 4S2JA 2OLVA 4N1XA 4R3JA 2IWDA 3GMWA 3UE0A 4ZAMA 3W4PA 1K56A 4KZ9A 5EVIB 2ZQ8A 4OP5A 4IBRA 4E3OA 2CC1A 1JWVA 3OCLA 5AQBA 4JF4A 4OPQA 2JE5A 3SH7A 2ZM0A 1FOFA 1K25A 1NXYA 1YMSA 5EVIA 4GN2A 3VP2A 2PU2A 1BLHA 3PBNA 3GVBA 4BL2A 3OPRA 1K54A 3G31A 2E8IA 3LCEA 4NETA 2XD5A 4OPZA 4S2OA 3D4FA 4WELA 1TDLA 4JBFA 4KZ7A 1KE4A 4QJGA 1Q2PA 5FI7A 1VM1A 3UN7A 2IWCA 3WRTA 1GHMA 1VQQA 1GCEA 4IVKA 4LCLA 1JTGA 4KZBA 4YINA 1MY8A 1YT4A 4B4ZA 1K57C 3HLEA 2ZQ7A 1YLTA 1L0DA 3ZNYA 2XGNA 1KGGA 1PIOA 1ES5A 3S4XA 2ZLYA 5M1AA 4BJPA 1E3UD 2JCHA 1YLPA 5EOEA 4MBFA 2WADA 3PBOA 1BLCA 2WYXA 3BFEA 3BYDA 2B5RA 3FKWA 1IELA 3BECA 2WGWA 3HLWA 4DKIA 3LY3A 3UDFA 1Y54A 5F83A 2JC7A 2EX8A 3MZEA 4ZTKA 3I7JA 3IT9A 5GLBA 5DTSA 4WYYA 3NY4A 5GHZA 3V39A 5M19A 1GHPA 4KG5A 4X69A 4E3IA 1WYCA 1NYMA 3E2KA 3N4IA 4HEFA 3MFDA 4GDNA 3GR2A 4GZBA 5GL9A 5CTNA 3RJUA 3WS4A 2PBYA 3IXGA 3CZDA 3IF5A 4NK3A 1WE4A 1ERQA 3HLCA 5EVIC 3ZNTA 3VSKA 5JYPA 2Y2HA 2XF3A 4OOMA 4U3TA 3WRZA 1LI9A 1XGIA 2ZD8A 1QMFA 5TGFA 1NY0A 1FCNA 3BFDA 1IYQA 2WGIA 5EE8A 4WEJA 5TR7A 3CJMA 4E6XA 3CMZA 3EQVA 1H8YA 2OV5A 4LV2A 1DJAA 3IF6C 1E4DA 2IWBA 5GLDA 1IKGA 1ZC2A 3A3JA 3PAEA 2Y2LA 4E3JA 4OONA 1O7EA 2EXBA 2Q9NA 2WAFA 1RGYA 4IBXA 2Y2PA 4OP8A 3VOZA 3O86A 3UDIA 3WS0A 5FQ9A 4JXWA 4N9LA 4QD4A 3VP3A 4JKTA 4IVIA 4Y0UA 4N1HA 4WZ4A 1XPBA 4LV3A 4PM8A 2ZC6B 5E2FA 1S6RA 5A90A 5DF7A 4JLFA 4EV4A 1YQSA 3A3DA 1SKFA 3C7UA 4EBLA 5F1GA 4KQQA 4X6TA 5AQ7A 5J8XA 1J9MA 4DXBA 2HDUA 5HAQA 1XX2A 1DJCA 1RCJA 5HAIA 3V50A 3W4QA 4JF6A 2Y2GA 5AQ9A 3W8KA 2Y2JA 3IHBA 3OC2A 2EX9A 4DE1A 4ZJ1A 5CERA 3UO9A 1YM1A 1FQGA 2ZC5B 1KGEA 3AGFA 4GD8A 3TG9A 3E2LA 1CI9A 3VP4A 1FCMA 1MWUA 4EBPA 1LL9A 4OOLA 1CEGA 3DWKA 3NDGA 3EQUA 4FH4A 4GB7A 4L0LA 2J8YA 3ISGA 2ZQDA 4KZ8A 4FSFA 1ONGA 4EWFA 1K4FA 2DNSA 1C3BA 1MBLA 4K0XA 2XQZA 3NBLA 4KZ4A 2BLSA 3Q7ZA 3PAGA 1Z6FA 1PWDA 3QNCA 3Q7VB 5GHXA 5FQIA 4DDYA 4KZ3A 1HD8A 1W79A 1E25A 2J7VA 4UA7A 1ES4A 5GHYA 4Y0OA 5IHVA 4BENA 2P74A 3M6BA 3C4PA 2Y2IA 1W5DA 2WZXA 3IF6B 4QHCA 5CGXA 4EQIA 1K56D 3PBTA 4LV1A 3NIAA 1LI0A 3A3EA 3GRJA 3MKFA 5FSRA 3HL9A 5TFQA 2EXAA 3LEZA 4KZ6A 2C5WB 2V2FF 4OLGA 4DDSA 1NZUA 1BLSA 3M2JA 1N9BA 4OOYA 3BLSA 1XA7A 3FV7A 4GD6A 3ZG7B 5CEBA 1MKIA 3NI9A 5KSHA 3P09A 1WYBA 2EX6A 1CEFA 3NDEA 2BG1A 4MNRA 1KDWA 4FD8A 4MLLA 5EPHA 2WK0A 1KVMA 2WZZA 2WKIA 4OQGA 4S2LA 1GA0A 4BD1A 1K57A 1E3UA 5FASA 2EFXA 1KGFA 3N8SA 3VFHA 4PM9A 4BL3A 2UWXA 4GDBA 4RA7A 1PWGA 4S2NC 4Z9QA 2WGWB 2Y2NA 3OPLA 4OKPA 3HUMA 1BZAA 1YLZA 3G2ZA 4JXGA 2X71A 3ZHHA 5F1FA 1ESIA 1KDSA 4RVAA 4LV0A 1K38A 2HDRA 2HDSA 4HBTA 5FI2A 3GQZA 1IYOA 1KE3A 3G32A 5DVAA 5HARA 4RX2A 4R4RA 1HZOA 1KVLA 2DCFA 4C3QA 2V20A 5AQAA 3UPPA 3GV9A 1L0FA 4UHUA 5FAPA 3P98A 4FCFA 2RCXA 5CRFA 1FSYA 4P87A 1PW8A 3CG5A 2ZQAA 4WBGA 2HDQA 4XUZA 3SOIA 1EI5A 3BLMA 1M6KA 4HESA 4KQOA 1CK3A 2VGJA 3G35A 4CJNA 5HW3A 1IYSA 4BQMA 2WGVA 4O7DA 5FAQA 1PYYA 3BM6A 1I2WA 3MXRA 3HLFA 3BEBA 4KENB 2R9XA 3C4OA 4MEZA 4QU3A 4N9KA 4BLMA 4C6YA 4DE0A 1MWSA 1HTZA 5HAPA 1G6AA 5KMWA 2WAEA 3ZG0A 3B3XA 4OVDA 4F94A 1SHVA 2Y55A 5E43A 1ZKJA 1PW1A 5FA7A 2ZMAA 5EVID 2Z2LB 2ZM8A 2Q9MA 1GA9A 3ITBA 4KQRA 4M3KA 4JXSA 4E3KA 3ZG9B 1YLYA 5G18A 4ZBEA 3MZFA 5CECA 1YLJA 1O07A 1QMEA 3G4PA 5U47A 2A3UA 3HLBA 3N7WA 4D2OA 1XA1A 4LCMA 1RP5A 4P6BA 3TOIA 3UE3A 4DF6A 5FQMA 4Q8IA 1PZOA 3MBZA 5F82A 3V3RA 3GSGA 5GLCA 3ZCZA 2QPNA 3VSLA 4U0TA 3IWIA 5BOHA 2Y59A 4X68A 4U0XA 3SH8A 1W8QA 5GLAA 4ZJ2A 1G68A 3OPHA 1NYYA 3IF6A 2ZQCA 5EVLA 4OH0A 3VFFA 1PWCA 1RGZA 1OMEA 3Q1FA 1HVBA 4R3BA 2ZC3B 3HLGA 4ID4A 1PZPA 3Q81A 4WM9A 1K55A 3RXXA 4XXRA 1K6SA 3DTMA 3PTEA 4UAAA 4RX3A 2R9WA 1NRFA 3IQAA 3WS2A 2Y2MA 1H5XA 2V1ZA 3IWOA 4WMCD 2ZM2A 1I5QA 2X02A 4UA9A 1PI4A 4DXCA 4PMAA 3RXWA 4KG2A 1Q2QA 2P9VA 4N92A 4P0MA 4S2IA 1BULA 2VGKA 3SH9A 2XFSA 4R4SA 4DRTA 4GKUA 3WS5A 1JVJA 5E2HA 1IKIA 1H8ZA 4EBNA 5CXWA 2XDMA 3WWXA 4MBKA 5DF9A 4BD0A 5DTTA 2ZC7A 3N6IA 1N4OA 2XEPA 4S2NA 2HPBA 1W8YA 5FQKA 3IWQA 3FZCA 5A91A 1W7FA 4Y7PA 5CGWA 2Y2QA 5FDHA 3AGEA 1ALQA 2Y2KA 1GHIA 4JF5A 4DE2A 1DY6A 2GDNA 3UPNA 2H0TA 2H10A 4OQHA 1FR1A 3BFGA 5M18A 3G2YA 2ZQ9A 4RYEA 1BT5A 3ITAA 1MXOA 5CHMA 4HBUA 4IEDA 3ZFZA 2I72A 4FH2A 3HREA 4PM5A 2XD1A 1MPLA 1K6RA 3G30A 4H8RA 4R1GA 2Z2MB 3M6HA 4DE3A 1NJ4A 4C75A 5E2GA 4QY5A 1ONHA 3WS1A 5EECA 1ZG6A 3BRMA 2XR0A 2H5SA 4R23A 2QMIA 2QZ6A 4P85A 5L2FA 4JPMA 1K4EA 5EUAA 4B4XA 1YLWA 4QB8A 2RL3A 1LHYA 2Y91A 1ESUA 3HLDA 4K0WA 2JBFA 2XK1A 3OCNA 3N8RA 1BSGA 5HFOA 4KZAA 5EOOA 2WUQA 3UNWA 3C7VA 4KG6A 4UA6A 3NC8A 1LL5A 3A3IA 5CHJA 3DW0A 1TDGA 2A49A 3HUOA 4E3MA 3BFCA 3HBRA 1XP4A 1FSWA 4JXVA 4XUXA 2G2UA 4OQIA 3SS5A 2FFYA 2ZJ9A 3TSGA 1TEMA 2C6WB 3Q82A 3UE1A 5HL1A 5FQJA 4GNUA 1TVFA 3AGDA 3ZG8B 3UY6A 5DF8A 1YMXA 3Q07A 5FAOA 2J9PA 2H0YA 1L0GA 1I2SA 3LO7A 5D3OA 4OLDA 4KZ5A 3LY4A 5CTMA 4E3NA 3QHYA 1CI8A 1XXMA 3QNBA 1NZOA 4X53A 3V5MA 3IH8A 4S2PA 4OPYA 4EUZA 1M40A 4R0QA 4S2KA 1ES3A 1L0EA 3Q7VA 1XKZA 3VOYA 4LENA 4CPKA 3ZVTA 4OPRA 3VP0A 4S2MA 3N8LA 3VMAA 4GOGA 3NCKA 3GTCA 5FI6A 4PM6A 5A92A 1DJBA 3IXBA 1JWZA 1ZG4A 5DTKA 3ZGAB 2WKHA 3HUNA 4ZDXA 2WKEA 1FCOA 1PI5A 1SDNA 3MKEA 2EX2A 2HP9A 3IXDA 5A93A 1AXBA 2OLUA 3O88A 4E3LA 3IXHA 2HP6A 4OQ0A 3O3VA 4PM7A 3S1YA 1BUEA 4ZJ3A 1KE0A 5FATA 2PU4A 4WMCA 1K55C 3MXSA 5KZHA 1XGJA 3C5AA 3OPPA 2Y2OA 3OZHA 1JTDA 4MBHA 2EFUA 3FWLA 1BTLA 2J9OA 5CHUA 4WZ5A 3SS3A 2Y4AA 2OSUA 3A3FA 2ZC4B 3PBSA 2XH9A
chains in the Genus database with same CATH superfamily
1BLPA 2FFFB 3MZDA 2JKFA 4QY6A 3W4OA 2HJ9C 2PHYA 1FR6A 1IYPA 3G34A 4E6WA 4WUJA 3ZDJA 3O87A 4HI4A 4ARZB 4X55A 4MMNA 1P9WA 1S4RA 4WZ5C 3PBQA 4CLCB 5E2EA 1GSVA 4GJ4A 2Y79A 4S2JA 3R4KA 3EEAA 4N1XA 4ZAMA 4CQHA 1IFQA 4E3OA 1JWVA 2O0YA 5AQBA 2JE5A 3VE3A 4NXBA 3QP5A 2G7UA 1K25A 1YMSA 5EVIA 3VP2A 2PU2A 3PBNA 1P97A 4BL2A 3OPRA 3F1NB 2P7JA 2E8IA 2XD5A 4S2OA 3D4FA 4QJGA 3KSGA 4IVKA 1CQAA 1YT4A 4B4ZA 1K57C 4O8GA 1E3UD 5L09A 3KX0X 2VV7A 3BECA 3UB8A 3UDFA 4ZTKA 3NY4A 5GHZA 2W3DA 3BJNA 1GHPA 4KG5A 4X69A 1NYMA 4GDNA 5CTNA 3IX3A 3CZDA 3IXGA 3ZYTA 1ERQA 3ZNTA 5JYPA 4OOMA 4U3TA 4Y15A 1XGIA 1NY0A 3BFDA 1IYQA 1KOUA 2WGIA 4WEJA 4CLCE 1H8YA 1LSXA 2VZWA 3LIEA 4I3AA 2ZMVA 2ZMFA 4I39A 4HY8A 5J4EA 2EXBA 2Q9NA 5HZHA 4JXWA 3DAVA 1T18A 4QD4A 4JKTA 1DP6A 5DKKA 5A90A 5FDSA 1VEUB 5F1GA 4KQQA 3MQQA 1J9MA 2HDUA 4JGPA 3W4QA 5AQ9A 4JGRA 3IHBA 3OC2A 2ZL1A 3UO9A 4GD8A 1FCMA 4EBPA 1CEGA 4FH4A 3EQUA 1T1BA 1K4FA 3FPWA 2HV1A 2XQZA 2M7UA 1PWDA 5GHXA 4IUKA 1HD8A 4UA7A 1GSWA 4Y0OA 4LV1A 1LI0A 3GRJA 3E4OA 4DDSA 1NZUA 4AFIA 4YOFA 1XA7A 4GD6A 2A24B 1MKIA 5L8MA 4MNRA 2BG1A 2R78A 4PKYG 2WK0A 3LICA 2WKIA 2Q0OA 3KSIA 4S2LA 3T1QB 2EFXA 1KGFA 3N8SA 4I3JA 4PM9A 4WL9A 2L1MA 2XA7M 2PBDP 4NXGA 3UMDA 4DJ3A 3VOLA 4JXGA 2OAQ1 1ESIA 4RVAA 2HDRA 2HDSA 3GQZA 4LRZE 1KE3A 5DVAA 3MQOA 3GV9A 1L0FA 4UHUA 4UQIS 3CG5A 4WBGA 1M6KA 1CF0A 4O7DA 3MXRA 4BLMA 4KENB 2R9XA 4MEZA 5HAPA 5KMWA 1G6AA 2WAEA 3ZG0A 1UWNX 1LT0A 3D72A 3ZG9B 3OBFA 4ZBEA 3MZFA 2JKTM 5U47A 2A3UA 3F1NA 4P6BA 3UE3A 1TF1A 3T4LA 1DP9A 4B9OA 3ZCZA 5IT5A 2Y59A 3IX8A 4X68A 1OTBA 4ZJ2A 2B02A 3OPHA 2VV8A 3VFFA 4OH0A 1PWCA 1HVBA 4PAUA 2XROA 2W27A 3JVUA 2ZC3B 2H28A 3E0YA 5EVEA 2OOLA 4HIAA 1K6SA 4JGQA 4X25A 1I5QA 4DXCA 4PMAA 3RXWA 4N92A 2VGKA 4GKUA 4EBNA 1HLUP 2A2LA 4L9GA 4BD0A 2XEPA 2HPBA 2UV0E 2YKFA 2Y8HA 4Y7PA 5CGWA 4JF5A 1DY6A 4OQHA 2ZQ9A 1N9NA 2VV6A 4HBUA 2V1AA 3V67A 4FH2A 1YPRA 4F3LB 4B93A 2O9BA 2P08A 1ZG6A 3BRMA 2QMIA 4EU0A 1W63Q 4LRYC 5EUAA 1YLWA 2RL3A 1LHYA 5KIZA 3HLDA 5LBRA 2XK1A 3OCNA 5EOOA 3C7VA 3DW0A 4E3MA 4I5SA 4OQIA 2ZJ9A 3CPTB 1VEUA 3Q82A 5FQJA 1TVFA 3ZG8B 3UY6A 1YMXA 2NUTC 3Q07A 2V1BA 4Y17A 1P9RA 1CI8A 5HWWA 4EUZA 3UB9A 1ES3A 3LR5A 3Q7VA 3JPUA 3ZVTA 2XSSA 3VP0A 1LSWA 3OOVA 3CHWP 3NCKA 1Y28A 2XA7S 4ZDXA 5J7EA 2QKPA 2WKEA 1AXBA 1S1YA 4OQ0A 2O99A 3LIAA 1YKDA 4YWZA 1G5UA 3MS6A 3IS2B 3OPPA 2Y2OA 1JTDA 5DKLA 2EFUA 2WKPA 4QWOA 5CHUA 2K7SA 2XH9A 3KSFA 3HJKA 2HP5A 1S0WA 3ZVWA 1MWTA 5HX9A 2QJ5A 3JYIA 3ZG5A 3B47A 3OLOA 3V3SA 2XFTA 4LFUA 2X01A 3UDXA 5A8BA 3BFFA 3NECA 1JWPA 1TS6A 2PDRA 2I9VA 3H7WB 5KSCA 2QJ7A 4WLAA 4K91A 1MC0A 2W1TA 2WKRA 5EVIB 3T1SA 4PHTA 4HP4A 2L4RA 2V8FA 4OPQA 1S4SA 3SH7A 2W3HA 4ESPA 1EW0A 3LUQA 4WELA 1OTDA 3DTEA 5FI7A 1VM1A 2IWCA 4HJ4A 4LCLA 4YINA 1MY8A 1YSPA 1ES5A 2PRFA 3FPVA 2PT7A 3PBOA 2WYXA 1IELA 2PAVP 1MKMA 2EX8A 3IT9A 5DTSA 2VJWA 4WYYA 3A0VA 2GX5A 4E3IA 3N4IA 2EWWA 3PR6A 3HJIA 3GR2A 3SW1A 2PBYA 4PKYA 4NK3A 3HLCA 2VX8A 4YNRA 2Y2HA 3MXQA 4EQ1A 4LPZA 3BWLA 3CJMA 3CMZA 3H82A 4LV2A 5DJTA 3IF6C 1E4DA 3MF0A 4BWIA 3A3JA 3PAEA 4GHIA 1A0KA 2WAFA 3WS0A 4IBXA 2Y2PA 3VOZA 3UDIA 3VP3A 4IVIA 2ZC6B 1S6RA 4EV4A 1YQSA 3C7UA 4EBLA 2NUPC 5AQ7A 5J8XA 4DXBA 3B33A 1RCJA 2ZBBA 3V50A 1XFQA 1XJ2A 3W8KA 2Y2JA 4DE1A 4ZJ1A 1YM1A 1FQGA 2ZC5B 3AGFA 4FUWA 3E2LA 1CI9A 3VP4A 1LL9A 3ISGA 4EWFA 2DNSA 1MBLA 4K0XA 4MCWA 3T1RA 1OTEA 4KZ3A 5HDSA 5GHYA 2J7VA 1ES4A 3NOTC 3M6BA 1OT9A 2WZXA 3IF6B 1VETA 5CGXA 4EQIA 3PBTA 4KUOA 4O01A 1TS8A 3A0SA 3A3EA 3T4TA 4GLQA 3HL9A 4OLGA 3M2JA 3BLSA 2JKTI 3NI9A 1PNEA 1KVMA 4OQGA 4BD1A 1OTIA 5FASA 3KYEA 4GDBA 4S2NC 2WGWB 2W1RA 4GW9A 4OKPA 1BZAA 1YLZA 1VHMA 4NEED 5F1FA 4HBTA 1IYOA 3G32A 1NRJA 4R4RA 1HZOA 1LSVA 2VK3A 4HHDA 5CRFA 1FSYA 4P87A 2ZQAA 4E04A 3SOIA 1EI5A 3BLMA 3LIDA 1PRQA 4BQMA 5FAQA 3BM6A 3HLFA 3BEBA 1ZHHB 3BQAA 3C8CA 2ACGA 4DE0A 3B3XA 4OVDA 1SHVA 1IOUA 5FA7A 2ZM8A 3C2WA 2Q9MA 1GA9A 2GJ3A 4JXSA 2JN7A 5DFXA 3NHQA 1QMEA 4FTXA 1RP5A 4NXFA 1PZOA 3VE4A 4Q8IA 3KYZA 4U0XA 3SH8A 3MJQA 5FL3A 3EEHA 2ZQCA 1OMEA 2QHKA 4Y3IA 3HLGA 4ID4A 3Q81A 3R7WA 1K55A 3RXXA 4II7A 4GS9A 3DTMA 4UAAA 4RX3A 3IQAA 2QWSA 1VETB 4P6ZM 3WS2A 2L0WA 2M1CA 4KG2A 3SH9A 4S2IA 1BULA 4I3IA 2XFSA 1NWZA 1IKIA 3K3CA 2XDMA 4MBKA 3FC7A 1TS0A 2ZC7A 1N4OA 5TBMA 4S2NA 3B42A 3FZCA 2KDKA 2VKSA 1WA9A 2Y2KA 1GHIA 3UPNA 2H0TA 4X1MA 3BFGA 3S7NA 4KQDA 4PM5A 2XD1A 3G30A 1H0MA 4C75A 2PYRA 2QYBA 1K4EA 1YAXA 4QB8A 4K08A 3N8RA 5AVFA 5HFOA 5HPFA 2EA9A 1LL8A 3C38A 5CHJA 2K2NA 3HUOA 3BFCA 1FSWA 4JXVA 2G2UA 4DMZA 1Z09A 3UE1A 4GNUA 2V8CA 3VV4A 3ICYA 3T1XA 1T1AA 4NKPA 1I2SA 5D3OA 3UB5P 4KZ5A 4E3NA 1STZA 4QPRA 4OPYA 4S2KA 1XKZA 5DTKA 3HUNA 2VGLM 1FCOA 1SDNA 1XFNA 3IXDA 4MN7A 3A0RA 2OLUA 2HP6A 1BYWA 3O3VA 3S1YA 4XT2B 4L9EA 5FATA 2PU4A 1TD5A 3LR3A 3MXSA 3C5AA 2JKRM 4MBHA 4WZ5A 2Y4AA 2OSUA 1AWIA 3IS2A 3NOUC 3A3FA 1E25A 2P9VB 3S22A 5CEDA 3IH9A 1K54C 4YFMA 1CJFA 4KUKA 4Q0HA 5TBMB 2ZOIA 3E4PA 4A5RA 3SS4A 1EROA 3UPOA 1LLBA 3IHAA 5CGSA 4X56A 5JYOA 1S66L 1U60A 3HVFA 5I94A 5HL6A 2B18A 2XLNA 2OLVA 2PR6A 2IWDA 3GMWA 3UE0A 3W4PA 4LRXC 4JGOA 2CC1A 2KX6A 1H8MA 4JF4A 2ZM0A 1FOFA 4GN2A 4ME4A 4ETZA 1BLHA 3GVBA 2J3TC 3UB7A 4NETA 4WF0A 1TDLA 4MN6A 4EW7A 1Q2PA 3UN7A 2MJ6A 2VEAA 1GHMA 1VQQA 4ETXA 5IS1A 1JTGA 4KZBA 5FEFA 1OPXA 2ZQ7A 1L0DA 1PIOA 3S4XA 2ZLYA 5M1AA 5EOEA 1YLPA 4MBFA 3BFEA 2B5RA 3FKWA 2OWJA 4XT2A 2WGWA 3HLWA 4X1LA 3MZEA 3I7JA 5GLBA 5M19A 3V39A 4HH3A 3MFXA 2GNXA 4DJ2A 3E2KA 1SKOB 4HEFA 3MFDA 3EGXC 3RJUA 4HP9A 3IF5A 1WE4A 5EVIC 3VSKA 3P01A 2O9AA 2XF3A 3WRZA 1L3LA 1LI9A 2ZD8A 5TGFA 4UQIM 4EESA 1FCNA 4LGWA 5EE8A 5TR7A 2W3FA 3EOIA 2OV5A 3BQ8A 1DJAA 5AJGA 1N9OA 2IWBA 5GLDA 2Z6DA 1IKGA 4Q0JA 2Y2LA 3SZTA 3P7NA 2J80A 1RGYA 3LEQA 2XRNA 4Y13A 4N1HA 1XPBA 5DF7A 3A3DA 1SKFA 3LGOA 1XX2A 1DJCA 1JNUA 5HAIA 2Y2GA 3D9YA 3H9WA 3IBRA 3S7PA 1TS7A 1MWUA 4OOLA 4L0LA 4GB7A 2ZQDA 4KZ8A 4FSFA 4UEYA 1C3BA 3QP6A 2V0UA 3NBLA 3O5YA 2BLSA 2EWVA 3EWKA 3PAGA 4ZRRA 5EFWA 3TE8A 5FQIA 1W79A 3C4PA 4QHCA 3CAXA 4FOFA 1NLYA 3NIAA 1F2KA 2HGVA 3LEZA 4KZ6A 2V2FF 3LYXA 4OOYA 3FV7A 5KSHA 1WYBA 2EX6A 3NDEA 4FD8A 2VLGA 4MLLA 2J3TD 3PYPA 5EPHA 3TW8A 1SKOA 1GA0A 3QP4A 1K57A 1E3UA 2JHEA 1FIKA 3LFVA 1D1JA 4BL3A 1PWGA 4NG2A 4Z9QA 3CI6A 4HH2A 3LI9A 3OPLA 3HUMA 3G2ZA 3LIBA 3ZHHA 1KDSA 4LV0A 1K38A 3H7WA 5FI2A 5HARA 4RX2A 1KVLA 2DCFA 2E8JA 2V20A 5AQAA 4Y2FA 5HDDA 3UPPA 4H6JB 3P98A 5FAPA 3LIFA 1H3QA 1ZTUA 1PW8A 2HDQA 5I5LA 4KQOA 2VGJA 5HW3A 2WGVA 3QP2A 1PYYA 3PHYA 4R6LA 3LI8A 4N9KA 4QU3A 1HTZA 1GSXA 5IU1A 4F94A 2Y55A 2W0NA 1ZKJA 3KYQA 4HJ3A 2Z2LB 4EUVA 3ITBA 4E3KA 5EV0A 5G18A 5CECA 1O07A 5TJJA 5J3WA 3N7WA 4HQAA 4D2OA 1XA1A 4LCMA 4DF6A 5F82A 1J3WA 5GLCA 2QPNA 3IWIA 5BOHA 4P6ZS 1W8QA 4IHQA 1NYYA 1RGZA 2K31A 4EXOA 3Q1FA 1G6OA 3UMEA 4WM9A 3UE6A 5G4ZA 4XXRA 2R9WA 1NRFA 2BASA 5HSQA 4WMCD 2ZM2A 2X02A 1PI4A 3FG8A 1Q2QA 1JVJA 5E2HA 1H8ZA 2HZ5A 5CXWA 1K0KA 3HCYA 3WWXA 5DTTA 3N6IA 1W8YA 5FQKA 4M4XA 5A91A 3NULA 1W7FA 3U2AA 4DE2A 4RYEA 3ITAA 1MXOA 4IEDA 2W3EA 3HREA 1MPLA 2B95A 1K6RA 4H8RA 4R1GA 2Z2MB 3M6HA 4CLCC 4DE3A 4QY5A 1ONHA 4R23A 2H5SA 2XR0A 4P85A 3BW6A 5L2FA 4B4XA 1X0OA 1ESUA 2JBFA 1S1ZA 4KZAA 3UNWA 5HD3A 4KG6A 1LL5A 3A3IA 4DN0A 2FZ0A 1PFLA 4XUXA 3IBJA 4BBTA 2W1TB 3TSGA 1TEMA 3T4SA 5HL1A 2M7VA 3ULFA 3AGDA 4O0PA 2H0YA 1OT6A 4OLDA 1YSQA 3T4QA 3QHYA 1XXMA 1NZOA 4X53A 3IH8A 4R0QA 1L0EA 5FEGA 3VOYA 4BBUA 4CPKA 4Q0IA 3N8LA 1MZUA 3GTCA 5FI6A 5A92A 1DJBA 1JWZA 2INWA 1ZG4A 3ZGAB 1PI5A 3MKEA 2EX2A 3TJZC 4R70A 1BUEA 4ZJ3A 1KE0A 1K55C 5KZHA 1XGJA 1OTAA 1BTLA 5F5YA 3UB6A 4DKIA 2DRWA 3K3DA 4B88A 2Z6CA 1L2SA 4PPRA 1SCWA 3RTYA 3DWZA 1ERMA 3D3OA 1F9IA 3MSHA 2G2WA 1ACFA 3M2KA 4WEKA 2HJEA 4Y0TA 1MWRA 3FYZA 3PBRA 5FQQA 1SDEA 1IEMA 1P0ZA 2JKRI 3FKVA 1ES2A 4BMWA 1EWZA 3CWFA 2AVXA 4GHIB 3VP1A 3PXPA 4NXEA 3L7HA 4R3JA 1K56A 4Y5FA 4CLCD 3QP8A 4KZ9A 3RFBA 2ZQ8A 4OP5A 4IBRA 5K5BA 3OCLA 2OWHA 1NXYA 5AVEA 4GS9B 1W63M 1K54A 3CPTA 3G31A 3LCEA 4IUHA 4OPZA 4JBFA 4KZ7A 1KE4A 1F5MA 3F1PA 3WRTA 3DBAA 1GCEA 2FH5A 3HLEA 4RQ9A 1YLTA 2CMNA 3ZNYA 2XGNA 1KGGA 4BJPA 2JCHA 2WADA 3RH8B 1BLCA 3BYDA 2ZL1B 3LY3A 1Y54A 5F83A 2JC7A 1WYCA 4R38A 1XJ3A 4GZBA 5GL9A 3WS4A 1FILA 1VB6A 1QMFA 3W2ZA 1ODVA 3TRCA 1OJGA 2PYPA 4E6XA 3EQVA 2PR5A 4LLOB 3T4JA 1ZC2A 4E3JA 4OONA 1O7EA 4OP8A 3O86A 5FQ9A 4N9LA 3E98A 2KOIA 5DFYA 5HPIA 4Y0UA 4GCZA 4WZ4A 4LV3A 1SZVA 4PM8A 1NLZA 5E2FA 4JLFA 4D60A 2D02A 4X6TA 5HAQA 3F1OA 4JF6A 1N9LA 4F3LA 2EX9A 3NJAA 5HWVA 4G3KA 5CERA 1KGEA 3TG9A 2OAP1 3DWKA 3NDGA 4I38A 2J8YA 1ONGA 2LB5A 4KZ4A 3Q7ZA 1Z6FA 3QNCA 3Q7VB 3T50A 3GDIA 4DDYA 5IHVA 4BENA 2P74A 2V9AA 2Y2IA 1W5DA 3L9KA 1K56D 4R3AA 3MKFA 5FSRA 4Z1WA 5TFQA 2EXAA 2C5WB 3ZQ5A 1BLSA 1N9BA 3C30A 4EETB 3ZG7B 5CEBA 3NOPC 3P09A 1CEFA 5C5KA 1KDWA 1T1CA 2WZZA 2LB9A 3VFHA 1T19A 1XJ6A 2UWXA 4MN5A 4RA7A 4ARZA 3JVVA 2Y2NA 5F6AA 3T12B 2X71A 4CLCA 1UGUA 3H82B 2PD7A 3MQ0A 3GECA 5DJUA 4C3QA 4FCFA 2RCXA 5HWTA 4EEPA 2HF6A 3MMHA 4XUZA 1OJ5A 2D01A 4HESA 5G4YA 1CK3A 3G35A 4CJNA 1IYSA 3CUEC 1I2WA 3C4OA 4C6YA 1MWSA 2GZAA 4BBVA 5E43A 1PW1A 2ZMAA 5EVID 3R7WB 3F1OB 4KQRA 4M3KA 1YLYA 1G28A 5HD5A 1YLJA 3G4PA 3HLBA 3TOIA 5FQMA 3MBZA 3V3RA 3GSGA 3S7OA 3VSLA 4U0TA 3LR0A 5GLAA 5EVLA 1G68A 3IF6A 5F68A 4IJGA 3CUEA 3EGDC 1D7EA 4G3VA 4R3BA 5EM0A 1V9YA 1F98A 2BTFP 2PD8A 1PZPA 2O9CA 3PTEA 2JKGA 2VGLS 3DTIA 2Y2MA 5HDCA 1H5XA 3T4OA 2V1ZA 3T4KA 2IA2A 2ZOHA 3IWOA 5EM1A 2V0WA 4HOIA 4UA9A 2P9VA 4P0MA 4R4SA 5F69A 4DRTA 3WS5A 4H6JA 3BY9A 3KO6A 5DF9A 5MC7A 1S67L 3IWQA 4EEUA 5FDHA 2Y2QA 3AGEA 1ALQA 2GDNA 2H10A 1FR1A 5M18A 3G2YA 4MDZA 1BT5A 5CHMA 3IX4A 3ZFZA 3QP1A 2I72A 3DTKA 5L10A 3LR4A 3MR0A 3BY8A 3CITA 1NJ4A 5E2GA 3WS1A 5EECA 2QZ6A 4HNBA 4JPMA 2YKHA 3F1PB 2Y91A 4K0WA 1BSGA 1Y4OA 2WUQA 4UA6A 3NC8A 4G3WA 3G6OA 1TDGA 2A49A 3HBRA 4EERA 1XP4A 3SS5A 2FFYA 1XJ4A 2C6WB 2DMWA 3E4QA 2WKQA 5FAOA 5DF8A 2J9PA 1L0GA 3LO7A 1DP8A 5CX7A 3LY4A 5CTMA 3QNBA 3V5MA 4S2PA 1M40A 3S7QA 4LENA 1DRMA 4HJ6A 2A24A 4OPRA 4S2MA 3VMAA 4GOGA 3K2NA 4PM6A 1UWPX 3IXBA 4WN5A 2W3GA 2WKHA 3U4LP 2KLIA 2VA0A 2HP9A 5A93A 3O88A 4E3LA 3IXHA 4PM7A 3KSHA 2P04A 2J3WA 4WMCA 3OZHA 1D06A 5L07A 1V9ZA 3FWLA 2J9OA 3SS3A 3CLOA 2ZC4B 3PBSA 4L9FA
chains in the Genus database with same CATH topology
1BLPA 2FFFB 2P9VB 3S22A 2DRWA 4B88A 5CEDA 3MZDA 2HP5A 1L2SA 1S0WA 4QY6A 3ZVWA 3W4OA 4PPRA 3IH9A 1K54C 1SCWA 1MWTA 4YFMA 3DWZA 1ERMA 1FR6A 5HX9A 1IYPA 3JYIA 2G2WA 3G34A 4E6WA 3M2KA 3ZG5A 4WEKA 4Y0TA 1MWRA 4A5RA 3SS4A 1EROA 3ZDJA 3O87A 3UPOA 3V3SA 1LLBA 3FYZA 3IHAA 2XFTA 3PBRA 1SDEA 5FQQA 1IEMA 5CGSA 2X01A 3UDXA 3BFFA 4X56A 1JWPA 4X55A 3FKVA 5JYOA 1ES2A 4WZ5C 1U60A 1EWZA 3HVFA 3PBQA 5I94A 5E2EA 5KSCA 4K91A 2XLNA 3VP1A 4S2JA 2OLVA 4N1XA 4R3JA 2IWDA 3GMWA 3UE0A 4ZAMA 3W4PA 1K56A 4KZ9A 5EVIB 2ZQ8A 4OP5A 4IBRA 4E3OA 2CC1A 1JWVA 3OCLA 5AQBA 4JF4A 4OPQA 2JE5A 3SH7A 2ZM0A 1FOFA 1K25A 1NXYA 1YMSA 5EVIA 4GN2A 3VP2A 2PU2A 1BLHA 3PBNA 3GVBA 4BL2A 3OPRA 1K54A 3G31A 2E8IA 3LCEA 4NETA 2XD5A 4OPZA 4S2OA 3D4FA 4WELA 1TDLA 4JBFA 4KZ7A 1KE4A 4QJGA 1Q2PA 5FI7A 1VM1A 3UN7A 2IWCA 3WRTA 1GHMA 1VQQA 1GCEA 4IVKA 4LCLA 1JTGA 4KZBA 4YINA 1MY8A 1YT4A 4B4ZA 1K57C 3HLEA 2ZQ7A 1YLTA 1L0DA 3ZNYA 2XGNA 1KGGA 1PIOA 1ES5A 3S4XA 2ZLYA 5M1AA 4BJPA 1E3UD 2JCHA 1YLPA 5EOEA 4MBFA 2WADA 3PBOA 1BLCA 2WYXA 3BFEA 3BYDA 2B5RA 3FKWA 1IELA 3BECA 2WGWA 3HLWA 4DKIA 3LY3A 3UDFA 1Y54A 5F83A 2JC7A 2EX8A 3MZEA 4ZTKA 3I7JA 3IT9A 5GLBA 5DTSA 4WYYA 3NY4A 5GHZA 3V39A 5M19A 1GHPA 4KG5A 4X69A 4E3IA 1WYCA 1NYMA 3E2KA 3N4IA 4HEFA 3MFDA 4GDNA 3GR2A 4GZBA 5GL9A 5CTNA 3RJUA 3WS4A 2PBYA 3IXGA 3CZDA 3IF5A 4NK3A 1WE4A 1ERQA 3HLCA 5EVIC 3ZNTA 3VSKA 5JYPA 2Y2HA 2XF3A 4OOMA 4U3TA 3WRZA 1LI9A 1XGIA 2ZD8A 1QMFA 5TGFA 1NY0A 1FCNA 3BFDA 1IYQA 2WGIA 5EE8A 4WEJA 5TR7A 3CJMA 4E6XA 3CMZA 3EQVA 1H8YA 2OV5A 4LV2A 1DJAA 3IF6C 1E4DA 2IWBA 5GLDA 1IKGA 1ZC2A 3A3JA 3PAEA 2Y2LA 4E3JA 4OONA 1O7EA 2EXBA 2Q9NA 2WAFA 1RGYA 4IBXA 2Y2PA 4OP8A 3VOZA 3O86A 3UDIA 3WS0A 5FQ9A 4JXWA 4N9LA 4QD4A 3VP3A 4JKTA 4IVIA 4Y0UA 4N1HA 4WZ4A 1XPBA 4LV3A 4PM8A 2ZC6B 5E2FA 1S6RA 5A90A 5DF7A 4JLFA 4EV4A 1YQSA 3A3DA 1SKFA 3C7UA 4EBLA 5F1GA 4KQQA 4X6TA 5AQ7A 5J8XA 1J9MA 4DXBA 2HDUA 5HAQA 1XX2A 1DJCA 1RCJA 5HAIA 3V50A 3W4QA 4JF6A 2Y2GA 5AQ9A 3W8KA 2Y2JA 3IHBA 3OC2A 2EX9A 4DE1A 4ZJ1A 5CERA 3UO9A 1YM1A 1FQGA 2ZC5B 1KGEA 3AGFA 4GD8A 3TG9A 3E2LA 1CI9A 3VP4A 1FCMA 1MWUA 4EBPA 1LL9A 4OOLA 1CEGA 3DWKA 3NDGA 3EQUA 4FH4A 4GB7A 4L0LA 2J8YA 3ISGA 2ZQDA 4KZ8A 4FSFA 1ONGA 4EWFA 1K4FA 2DNSA 1C3BA 1MBLA 4K0XA 2XQZA 3NBLA 4KZ4A 2BLSA 3Q7ZA 3PAGA 1Z6FA 1PWDA 3QNCA 3Q7VB 5GHXA 5FQIA 4DDYA 4KZ3A 1HD8A 1W79A 1E25A 2J7VA 4UA7A 1ES4A 5GHYA 4Y0OA 5IHVA 4BENA 2P74A 3M6BA 3C4PA 2Y2IA 1W5DA 2WZXA 3IF6B 4QHCA 5CGXA 4EQIA 1K56D 3PBTA 4LV1A 3NIAA 1LI0A 3A3EA 3GRJA 3MKFA 5FSRA 3HL9A 5TFQA 2EXAA 3LEZA 4KZ6A 2C5WB 2V2FF 4OLGA 4DDSA 1NZUA 1BLSA 3M2JA 1N9BA 4OOYA 3BLSA 1XA7A 3FV7A 4GD6A 3ZG7B 5CEBA 1MKIA 3NI9A 5KSHA 3P09A 1WYBA 2EX6A 1CEFA 3NDEA 2BG1A 4MNRA 1KDWA 4FD8A 4MLLA 5EPHA 2WK0A 1KVMA 2WZZA 2WKIA 4OQGA 4S2LA 1GA0A 4BD1A 1K57A 1E3UA 5FASA 2EFXA 1KGFA 3N8SA 3VFHA 4PM9A 4BL3A 2UWXA 4GDBA 4RA7A 1PWGA 4S2NC 4Z9QA 2WGWB 2Y2NA 3OPLA 4OKPA 3HUMA 1BZAA 1YLZA 3G2ZA 4JXGA 2X71A 3ZHHA 5F1FA 1ESIA 1KDSA 4RVAA 4LV0A 1K38A 2HDRA 2HDSA 4HBTA 5FI2A 3GQZA 1IYOA 1KE3A 3G32A 5DVAA 5HARA 4RX2A 4R4RA 1HZOA 1KVLA 2DCFA 4C3QA 2V20A 5AQAA 3UPPA 3GV9A 1L0FA 4UHUA 5FAPA 3P98A 4FCFA 2RCXA 5CRFA 1FSYA 4P87A 1PW8A 3CG5A 2ZQAA 4WBGA 2HDQA 4XUZA 3SOIA 1EI5A 3BLMA 1M6KA 4HESA 4KQOA 1CK3A 2VGJA 3G35A 4CJNA 5HW3A 1IYSA 4BQMA 2WGVA 4O7DA 5FAQA 1PYYA 3BM6A 1I2WA 3MXRA 3HLFA 3BEBA 4KENB 2R9XA 3C4OA 4MEZA 4QU3A 4N9KA 4BLMA 4C6YA 4DE0A 1MWSA 1HTZA 5HAPA 1G6AA 5KMWA 2WAEA 3ZG0A 3B3XA 4OVDA 4F94A 1SHVA 2Y55A 5E43A 1ZKJA 1PW1A 5FA7A 2ZMAA 5EVID 2Z2LB 2ZM8A 2Q9MA 1GA9A 3ITBA 4KQRA 4M3KA 4JXSA 4E3KA 3ZG9B 1YLYA 5G18A 4ZBEA 3MZFA 5CECA 1YLJA 1O07A 1QMEA 3G4PA 5U47A 2A3UA 3HLBA 3N7WA 4D2OA 1XA1A 4LCMA 1RP5A 4P6BA 3TOIA 3UE3A 4DF6A 5FQMA 4Q8IA 1PZOA 3MBZA 5F82A 3V3RA 3GSGA 5GLCA 3ZCZA 2QPNA 3VSLA 4U0TA 3IWIA 5BOHA 2Y59A 4X68A 4U0XA 3SH8A 1W8QA 5GLAA 4ZJ2A 1G68A 3OPHA 1NYYA 3IF6A 2ZQCA 5EVLA 4OH0A 3VFFA 1PWCA 1RGZA 1OMEA 3Q1FA 1HVBA 4R3BA 2ZC3B 3HLGA 4ID4A 1PZPA 3Q81A 4WM9A 1K55A 3RXXA 4XXRA 1K6SA 3DTMA 3PTEA 4UAAA 4RX3A 2R9WA 1NRFA 3IQAA 3WS2A 2Y2MA 1H5XA 2V1ZA 3IWOA 4WMCD 2ZM2A 1I5QA 2X02A 4UA9A 1PI4A 4DXCA 4PMAA 3RXWA 4KG2A 1Q2QA 2P9VA 4N92A 4P0MA 4S2IA 1BULA 2VGKA 3SH9A 2XFSA 4R4SA 4DRTA 4GKUA 3WS5A 1JVJA 5E2HA 1IKIA 1H8ZA 4EBNA 5CXWA 2XDMA 3WWXA 4MBKA 5DF9A 4BD0A 5DTTA 2ZC7A 3N6IA 1N4OA 2XEPA 4S2NA 2HPBA 1W8YA 5FQKA 3IWQA 3FZCA 5A91A 1W7FA 4Y7PA 5CGWA 2Y2QA 5FDHA 3AGEA 1ALQA 2Y2KA 1GHIA 4JF5A 4DE2A 1DY6A 2GDNA 3UPNA 2H0TA 2H10A 4OQHA 1FR1A 3BFGA 5M18A 3G2YA 2ZQ9A 4RYEA 1BT5A 3ITAA 1MXOA 5CHMA 4HBUA 4IEDA 3ZFZA 2I72A 4FH2A 3HREA 4PM5A 2XD1A 1MPLA 1K6RA 3G30A 4H8RA 4R1GA 2Z2MB 3M6HA 4DE3A 1NJ4A 4C75A 5E2GA 4QY5A 1ONHA 3WS1A 5EECA 1ZG6A 3BRMA 2XR0A 2H5SA 4R23A 2QMIA 2QZ6A 4P85A 5L2FA 4JPMA 1K4EA 5EUAA 4B4XA 1YLWA 4QB8A 2RL3A 1LHYA 2Y91A 1ESUA 3HLDA 4K0WA 2JBFA 2XK1A 3OCNA 3N8RA 1BSGA 5HFOA 4KZAA 5EOOA 2WUQA 3UNWA 3C7VA 4KG6A 4UA6A 3NC8A 1LL5A 3A3IA 5CHJA 3DW0A 1TDGA 2A49A 3HUOA 4E3MA 3BFCA 3HBRA 1XP4A 1FSWA 4JXVA 4XUXA 2G2UA 4OQIA 3SS5A 2FFYA 2ZJ9A 3TSGA 1TEMA 2C6WB 3Q82A 3UE1A 5HL1A 5FQJA 4GNUA 1TVFA 3AGDA 3ZG8B 3UY6A 5DF8A 1YMXA 3Q07A 5FAOA 2J9PA 2H0YA 1L0GA 1I2SA 3LO7A 5D3OA 4OLDA 4KZ5A 3LY4A 5CTMA 4E3NA 3QHYA 1CI8A 1XXMA 3QNBA 1NZOA 4X53A 3V5MA 3IH8A 4S2PA 4OPYA 4EUZA 1M40A 4R0QA 4S2KA 1ES3A 1L0EA 3Q7VA 1XKZA 3VOYA 4LENA 4CPKA 3ZVTA 4OPRA 3VP0A 4S2MA 3N8LA 3VMAA 4GOGA 3NCKA 3GTCA 5FI6A 4PM6A 5A92A 1DJBA 3IXBA 1JWZA 1ZG4A 5DTKA 3ZGAB 2WKHA 3HUNA 4ZDXA 2WKEA 1FCOA 1PI5A 1SDNA 3MKEA 2EX2A 2HP9A 3IXDA 5A93A 1AXBA 2OLUA 3O88A 4E3LA 3IXHA 2HP6A 4OQ0A 3O3VA 4PM7A 3S1YA 1BUEA 4ZJ3A 1KE0A 5FATA 2PU4A 4WMCA 1K55C 3MXSA 5KZHA 1XGJA 3C5AA 3OPPA 2Y2OA 3OZHA 1JTDA 4MBHA 2EFUA 3FWLA 1BTLA 2J9OA 5CHUA 4WZ5A 3SS3A 2Y4AA 2OSUA 3A3FA 2ZC4B 3PBSA 2XH9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BLP A;  2FFF B;  2P9V B;  3S22 A;  2DRW A;  4B88 A;  5CED A;  3MZD A;  2HP5 A;  1L2S A;  1S0W A;  4QY6 A;  3ZVW A;  3W4O A;  4PPR A;  3IH9 A;  1K54 C;  1SCW A;  1MWT A;  4YFM A;  3DWZ A;  1ERM A;  1FR6 A;  5HX9 A;  1IYP A;  3JYI A;  2G2W A;  3G34 A;  4E6W A;  3M2K A;  3ZG5 A;  4WEK A;  4Y0T A;  1MWR A;  4A5R A;  3SS4 A;  1ERO A;  3ZDJ A;  3O87 A;  3UPO A;  3V3S A;  1LLB A;  3FYZ A;  3IHA A;  2XFT A;  3PBR A;  1SDE A;  5FQQ A;  1IEM A;  5CGS A;  2X01 A;  3UDX A;  3BFF A;  4X56 A;  1JWP A;  4X55 A;  3FKV A;  5JYO A;  1ES2 A;  4WZ5 C;  1U60 A;  1EWZ A;  3HVF A;  3PBQ A;  5I94 A;  5E2E A;  5KSC A;  4K91 A;  2XLN A;  3VP1 A;  4S2J A;  2OLV A;  4N1X A;  4R3J A;  2IWD A;  3GMW A;  3UE0 A;  4ZAM A;  3W4P A;  1K56 A;  4KZ9 A;  5EVI B;  2ZQ8 A;  4OP5 A;  4IBR A;  4E3O A;  2CC1 A;  1JWV A;  3OCL A;  5AQB A;  4JF4 A;  4OPQ A;  2JE5 A;  3SH7 A;  2ZM0 A;  1FOF A;  1K25 A;  1NXY A;  1YMS A;  5EVI A;  4GN2 A;  3VP2 A;  2PU2 A;  1BLH A;  3PBN A;  3GVB A;  4BL2 A;  3OPR A;  1K54 A;  3G31 A;  2E8I A;  3LCE A;  4NET A;  2XD5 A;  4OPZ A;  4S2O A;  3D4F A;  4WEL A;  1TDL A;  4JBF A;  4KZ7 A;  1KE4 A;  4QJG A;  1Q2P A;  5FI7 A;  1VM1 A;  3UN7 A;  2IWC A;  3WRT A;  1GHM A;  1VQQ A;  1GCE A;  4IVK A;  4LCL A;  1JTG A;  4KZB A;  4YIN A;  1MY8 A;  1YT4 A;  4B4Z A;  1K57 C;  3HLE A;  2ZQ7 A;  1YLT A;  1L0D A;  3ZNY A;  2XGN A;  1KGG A;  1PIO A;  1ES5 A;  3S4X A;  2ZLY A;  5M1A A;  4BJP A;  1E3U D;  2JCH A;  1YLP A;  5EOE A;  4MBF A;  2WAD A;  3PBO A;  1BLC A;  2WYX A;  3BFE A;  3BYD A;  2B5R A;  3FKW A;  1IEL A;  3BEC A;  2WGW A;  3HLW A;  4DKI A;  3LY3 A;  3UDF A;  1Y54 A;  5F83 A;  2JC7 A;  2EX8 A;  3MZE A;  4ZTK A;  3I7J A;  3IT9 A;  5GLB A;  5DTS A;  4WYY A;  3NY4 A;  5GHZ A;  3V39 A;  5M19 A;  1GHP A;  4KG5 A;  4X69 A;  4E3I A;  1WYC A;  1NYM A;  3E2K A;  3N4I A;  4HEF A;  3MFD A;  4GDN A;  3GR2 A;  4GZB A;  5GL9 A;  5CTN A;  3RJU A;  3WS4 A;  2PBY A;  3IXG A;  3CZD A;  3IF5 A;  4NK3 A;  1WE4 A;  1ERQ A;  3HLC A;  5EVI C;  3ZNT A;  3VSK A;  5JYP A;  2Y2H A;  2XF3 A;  4OOM A;  4U3T A;  3WRZ A;  1LI9 A;  1XGI A;  2ZD8 A;  1QMF A;  5TGF A;  1NY0 A;  1FCN A;  3BFD A;  1IYQ A;  2WGI A;  5EE8 A;  4WEJ A;  5TR7 A;  3CJM A;  4E6X A;  3CMZ A;  3EQV A;  1H8Y A;  2OV5 A;  4LV2 A;  1DJA A;  3IF6 C;  1E4D A;  2IWB A;  5GLD A;  1IKG A;  1ZC2 A;  3A3J A;  3PAE A;  2Y2L A;  4E3J A;  4OON A;  1O7E A;  2EXB A;  2Q9N A;  2WAF A;  1RGY A;  4IBX A;  2Y2P A;  4OP8 A;  3VOZ A;  3O86 A;  3UDI A;  3WS0 A;  5FQ9 A;  4JXW A;  4N9L A;  4QD4 A;  3VP3 A;  4JKT A;  4IVI A;  4Y0U A;  4N1H A;  4WZ4 A;  1XPB A;  4LV3 A;  4PM8 A;  2ZC6 B;  5E2F A;  1S6R A;  5A90 A;  5DF7 A;  4JLF A;  4EV4 A;  1YQS A;  3A3D A;  1SKF A;  3C7U A;  4EBL A;  5F1G A;  4KQQ A;  4X6T A;  5AQ7 A;  5J8X A;  1J9M A;  4DXB A;  2HDU A;  5HAQ A;  1XX2 A;  1DJC A;  1RCJ A;  5HAI A;  3V50 A;  3W4Q A;  4JF6 A;  2Y2G A;  5AQ9 A;  3W8K A;  2Y2J A;  3IHB A;  3OC2 A;  2EX9 A;  4DE1 A;  4ZJ1 A;  5CER A;  3UO9 A;  1YM1 A;  1FQG A;  2ZC5 B;  1KGE A;  3AGF A;  4GD8 A;  3TG9 A;  3E2L A;  1CI9 A;  3VP4 A;  1FCM A;  1MWU A;  4EBP A;  1LL9 A;  4OOL A;  1CEG A;  3DWK A;  3NDG A;  3EQU A;  4FH4 A;  4GB7 A;  4L0L A;  2J8Y A;  3ISG A;  2ZQD A;  4KZ8 A;  4FSF A;  1ONG A;  4EWF A;  1K4F A;  2DNS A;  1C3B A;  1MBL A;  4K0X A;  2XQZ A;  3NBL A;  4KZ4 A;  2BLS A;  3Q7Z A;  3PAG A;  1Z6F A;  1PWD A;  3QNC A;  3Q7V B;  5GHX A;  5FQI A;  4DDY A;  4KZ3 A;  1HD8 A;  1W79 A;  1E25 A;  2J7V A;  4UA7 A;  1ES4 A;  5GHY A;  4Y0O A;  5IHV A;  4BEN A;  2P74 A;  3M6B A;  3C4P A;  2Y2I A;  1W5D A;  2WZX A;  3IF6 B;  4QHC A;  5CGX A;  4EQI A;  1K56 D;  3PBT A;  4LV1 A;  3NIA A;  1LI0 A;  3A3E A;  3GRJ A;  3MKF A;  5FSR A;  3HL9 A;  5TFQ A;  2EXA A;  3LEZ A;  4KZ6 A;  2C5W B;  2V2F F;  4OLG A;  4DDS A;  1NZU A;  1BLS A;  3M2J A;  1N9B A;  4OOY A;  3BLS A;  1XA7 A;  3FV7 A;  4GD6 A;  3ZG7 B;  5CEB A;  1MKI A;  3NI9 A;  5KSH A;  3P09 A;  1WYB A;  2EX6 A;  1CEF A;  3NDE A;  2BG1 A;  4MNR A;  1KDW A;  4FD8 A;  4MLL A;  5EPH A;  2WK0 A;  1KVM A;  2WZZ A;  2WKI A;  4OQG A;  4S2L A;  1GA0 A;  4BD1 A;  1K57 A;  1E3U A;  5FAS A;  2EFX A;  1KGF A;  3N8S A;  3VFH A;  4PM9 A;  4BL3 A;  2UWX A;  4GDB A;  4RA7 A;  1PWG A;  4S2N C;  4Z9Q A;  2WGW B;  2Y2N A;  3OPL A;  4OKP A;  3HUM A;  1BZA A;  1YLZ A;  3G2Z A;  4JXG A;  2X71 A;  3ZHH A;  5F1F A;  1ESI A;  1KDS A;  4RVA A;  4LV0 A;  1K38 A;  2HDR A;  2HDS A;  4HBT A;  5FI2 A;  3GQZ A;  1IYO A;  1KE3 A;  3G32 A;  5DVA A;  5HAR A;  4RX2 A;  4R4R A;  1HZO A;  1KVL A;  2DCF A;  4C3Q A;  2V20 A;  5AQA A;  3UPP A;  3GV9 A;  1L0F A;  4UHU A;  5FAP A;  3P98 A;  4FCF A;  2RCX A;  5CRF A;  1FSY A;  4P87 A;  1PW8 A;  3CG5 A;  2ZQA A;  4WBG A;  2HDQ A;  4XUZ A;  3SOI A;  1EI5 A;  3BLM A;  1M6K A;  4HES A;  4KQO A;  1CK3 A;  2VGJ A;  3G35 A;  4CJN A;  5HW3 A;  1IYS A;  4BQM A;  2WGV A;  4O7D A;  5FAQ A;  1PYY A;  3BM6 A;  1I2W A;  3MXR A;  3HLF A;  3BEB A;  4KEN B;  2R9X A;  3C4O A;  4MEZ A;  4QU3 A;  4N9K A;  4BLM A;  4C6Y A;  4DE0 A;  1MWS A;  1HTZ A;  5HAP A;  1G6A A;  5KMW A;  2WAE A;  3ZG0 A;  3B3X A;  4OVD A;  4F94 A;  1SHV A;  2Y55 A;  5E43 A;  1ZKJ A;  1PW1 A;  5FA7 A;  2ZMA A;  5EVI D;  2Z2L B;  2ZM8 A;  2Q9M A;  1GA9 A;  3ITB A;  4KQR A;  4M3K A;  4JXS A;  4E3K A;  3ZG9 B;  1YLY A;  5G18 A;  4ZBE A;  3MZF A;  5CEC A;  1YLJ A;  1O07 A;  1QME A;  3G4P A;  5U47 A;  2A3U A;  3HLB A;  3N7W A;  4D2O A;  1XA1 A;  4LCM A;  1RP5 A;  4P6B A;  3TOI A;  3UE3 A;  4DF6 A;  5FQM A;  4Q8I A;  1PZO A;  3MBZ A;  5F82 A;  3V3R A;  3GSG A;  5GLC A;  3ZCZ A;  2QPN A;  3VSL A;  4U0T A;  3IWI A;  5BOH A;  2Y59 A;  4X68 A;  4U0X A;  3SH8 A;  1W8Q A;  5GLA A;  4ZJ2 A;  1G68 A;  3OPH A;  1NYY A;  3IF6 A;  2ZQC A;  5EVL A;  4OH0 A;  3VFF A;  1PWC A;  1RGZ A;  1OME A;  3Q1F A;  1HVB A;  4R3B A;  2ZC3 B;  3HLG A;  4ID4 A;  1PZP A;  3Q81 A;  4WM9 A;  1K55 A;  3RXX A;  4XXR A;  1K6S A;  3DTM A;  3PTE A;  4UAA A;  4RX3 A;  2R9W A;  1NRF A;  3IQA A;  3WS2 A;  2Y2M A;  1H5X A;  2V1Z A;  3IWO A;  4WMC D;  2ZM2 A;  1I5Q A;  2X02 A;  4UA9 A;  1PI4 A;  4DXC A;  4PMA A;  3RXW A;  4KG2 A;  1Q2Q A;  2P9V A;  4N92 A;  4P0M A;  4S2I A;  1BUL A;  2VGK A;  3SH9 A;  2XFS A;  4R4S A;  4DRT A;  4GKU A;  3WS5 A;  1JVJ A;  5E2H A;  1IKI A;  1H8Z A;  4EBN A;  5CXW A;  2XDM A;  3WWX A;  4MBK A;  5DF9 A;  4BD0 A;  5DTT A;  2ZC7 A;  3N6I A;  1N4O A;  2XEP A;  4S2N A;  2HPB A;  1W8Y A;  5FQK A;  3IWQ A;  3FZC A;  5A91 A;  1W7F A;  4Y7P A;  5CGW A;  2Y2Q A;  5FDH A;  3AGE A;  1ALQ A;  2Y2K A;  1GHI A;  4JF5 A;  4DE2 A;  1DY6 A;  2GDN A;  3UPN A;  2H0T A;  2H10 A;  4OQH A;  1FR1 A;  3BFG A;  5M18 A;  3G2Y A;  2ZQ9 A;  4RYE A;  1BT5 A;  3ITA A;  1MXO A;  5CHM A;  4HBU A;  4IED A;  3ZFZ A;  2I72 A;  4FH2 A;  3HRE A;  4PM5 A;  2XD1 A;  1MPL A;  1K6R A;  3G30 A;  4H8R A;  4R1G A;  2Z2M B;  3M6H A;  4DE3 A;  1NJ4 A;  4C75 A;  5E2G A;  4QY5 A;  1ONH A;  3WS1 A;  5EEC A;  1ZG6 A;  3BRM A;  2XR0 A;  2H5S A;  4R23 A;  2QMI A;  2QZ6 A;  4P85 A;  5L2F A;  4JPM A;  1K4E A;  5EUA A;  4B4X A;  1YLW A;  4QB8 A;  2RL3 A;  1LHY A;  2Y91 A;  1ESU A;  3HLD A;  4K0W A;  2JBF A;  2XK1 A;  3OCN A;  3N8R A;  1BSG A;  5HFO A;  4KZA A;  5EOO A;  2WUQ A;  3UNW A;  3C7V A;  4KG6 A;  4UA6 A;  3NC8 A;  1LL5 A;  3A3I A;  5CHJ A;  3DW0 A;  1TDG A;  2A49 A;  3HUO A;  4E3M A;  3BFC A;  3HBR A;  1XP4 A;  1FSW A;  4JXV A;  4XUX A;  2G2U A;  4OQI A;  3SS5 A;  2FFY A;  2ZJ9 A;  3TSG A;  1TEM A;  2C6W B;  3Q82 A;  3UE1 A;  5HL1 A;  5FQJ A;  4GNU A;  1TVF A;  3AGD A;  3ZG8 B;  3UY6 A;  5DF8 A;  1YMX A;  3Q07 A;  5FAO A;  2J9P A;  2H0Y A;  1L0G A;  1I2S A;  3LO7 A;  5D3O A;  4OLD A;  4KZ5 A;  3LY4 A;  5CTM A;  4E3N A;  3QHY A;  1CI8 A;  1XXM A;  3QNB A;  1NZO A;  4X53 A;  3V5M A;  3IH8 A;  4S2P A;  4OPY A;  4EUZ A;  1M40 A;  4R0Q A;  4S2K A;  1ES3 A;  1L0E A;  3Q7V A;  1XKZ A;  3VOY A;  4LEN A;  4CPK A;  3ZVT A;  4OPR A;  3VP0 A;  4S2M A;  3N8L A;  3VMA A;  4GOG A;  3NCK A;  3GTC A;  5FI6 A;  4PM6 A;  5A92 A;  1DJB A;  3IXB A;  1JWZ A;  1ZG4 A;  5DTK A;  3ZGA B;  2WKH A;  3HUN A;  4ZDX A;  2WKE A;  1FCO A;  1PI5 A;  1SDN A;  3MKE A;  2EX2 A;  2HP9 A;  3IXD A;  5A93 A;  1AXB A;  2OLU A;  3O88 A;  4E3L A;  3IXH A;  2HP6 A;  4OQ0 A;  3O3V A;  4PM7 A;  3S1Y A;  1BUE A;  4ZJ3 A;  1KE0 A;  5FAT A;  2PU4 A;  4WMC A;  1K55 C;  3MXS A;  5KZH A;  1XGJ A;  3C5A A;  3OPP A;  2Y2O A;  3OZH A;  1JTD A;  4MBH A;  2EFU A;  3FWL A;  1BTL A;  2J9O A;  5CHU A;  4WZ5 A;  3SS3 A;  2Y4A A;  2OSU A;  3A3F A;  2ZC4 B;  3PBS A;  2XH9 A; 
#chains in the Genus database with same CATH topology
 1BLP A;  2FFF B;  3MZD A;  2JKF A;  4QY6 A;  3W4O A;  2HJ9 C;  2PHY A;  1FR6 A;  1IYP A;  3G34 A;  4E6W A;  4WUJ A;  3ZDJ A;  3O87 A;  4HI4 A;  4ARZ B;  4X55 A;  4MMN A;  1P9W A;  1S4R A;  4WZ5 C;  3PBQ A;  4CLC B;  5E2E A;  1GSV A;  4GJ4 A;  2Y79 A;  4S2J A;  3R4K A;  3EEA A;  4N1X A;  4ZAM A;  4CQH A;  1IFQ A;  4E3O A;  1JWV A;  2O0Y A;  5AQB A;  2JE5 A;  3VE3 A;  4NXB A;  3QP5 A;  2G7U A;  1K25 A;  1YMS A;  5EVI A;  3VP2 A;  2PU2 A;  3PBN A;  1P97 A;  4BL2 A;  3OPR A;  3F1N B;  2P7J A;  2E8I A;  2XD5 A;  4S2O A;  3D4F A;  4QJG A;  3KSG A;  4IVK A;  1CQA A;  1YT4 A;  4B4Z A;  1K57 C;  4O8G A;  1E3U D;  5L09 A;  3KX0 X;  2VV7 A;  3BEC A;  3UB8 A;  3UDF A;  4ZTK A;  3NY4 A;  5GHZ A;  2W3D A;  3BJN A;  1GHP A;  4KG5 A;  4X69 A;  1NYM A;  4GDN A;  5CTN A;  3IX3 A;  3CZD A;  3IXG A;  3ZYT A;  1ERQ A;  3ZNT A;  5JYP A;  4OOM A;  4U3T A;  4Y15 A;  1XGI A;  1NY0 A;  3BFD A;  1IYQ A;  1KOU A;  2WGI A;  4WEJ A;  4CLC E;  1H8Y A;  1LSX A;  2VZW A;  3LIE A;  4I3A A;  2ZMV A;  2ZMF A;  4I39 A;  4HY8 A;  5J4E A;  2EXB A;  2Q9N A;  5HZH A;  4JXW A;  3DAV A;  1T18 A;  4QD4 A;  4JKT A;  1DP6 A;  5DKK A;  5A90 A;  5FDS A;  1VEU B;  5F1G A;  4KQQ A;  3MQQ A;  1J9M A;  2HDU A;  4JGP A;  3W4Q A;  5AQ9 A;  4JGR A;  3IHB A;  3OC2 A;  2ZL1 A;  3UO9 A;  4GD8 A;  1FCM A;  4EBP A;  1CEG A;  4FH4 A;  3EQU A;  1T1B A;  1K4F A;  3FPW A;  2HV1 A;  2XQZ A;  2M7U A;  1PWD A;  5GHX A;  4IUK A;  1HD8 A;  4UA7 A;  1GSW A;  4Y0O A;  4LV1 A;  1LI0 A;  3GRJ A;  3E4O A;  4DDS A;  1NZU A;  4AFI A;  4YOF A;  1XA7 A;  4GD6 A;  2A24 B;  1MKI A;  5L8M A;  4MNR A;  2BG1 A;  2R78 A;  4PKY G;  2WK0 A;  3LIC A;  2WKI A;  2Q0O A;  3KSI A;  4S2L A;  3T1Q B;  2EFX A;  1KGF A;  3N8S A;  4I3J A;  4PM9 A;  4WL9 A;  2L1M A;  2XA7 M;  2PBD P;  4NXG A;  3UMD A;  4DJ3 A;  3VOL A;  4JXG A;  2OAQ 1;  1ESI A;  4RVA A;  2HDR A;  2HDS A;  3GQZ A;  4LRZ E;  1KE3 A;  5DVA A;  3MQO A;  3GV9 A;  1L0F A;  4UHU A;  4UQI S;  3CG5 A;  4WBG A;  1M6K A;  1CF0 A;  4O7D A;  3MXR A;  4BLM A;  4KEN B;  2R9X A;  4MEZ A;  5HAP A;  5KMW A;  1G6A A;  2WAE A;  3ZG0 A;  1UWN X;  1LT0 A;  3D72 A;  3ZG9 B;  3OBF A;  4ZBE A;  3MZF A;  2JKT M;  5U47 A;  2A3U A;  3F1N A;  4P6B A;  3UE3 A;  1TF1 A;  3T4L A;  1DP9 A;  4B9O A;  3ZCZ A;  5IT5 A;  2Y59 A;  3IX8 A;  4X68 A;  1OTB A;  4ZJ2 A;  2B02 A;  3OPH A;  2VV8 A;  3VFF A;  4OH0 A;  1PWC A;  1HVB A;  4PAU A;  2XRO A;  2W27 A;  3JVU A;  2ZC3 B;  2H28 A;  3E0Y A;  5EVE A;  2OOL A;  4HIA A;  1K6S A;  4JGQ A;  4X25 A;  1I5Q A;  4DXC A;  4PMA A;  3RXW A;  4N92 A;  2VGK A;  4GKU A;  4EBN A;  1HLU P;  2A2L A;  4L9G A;  4BD0 A;  2XEP A;  2HPB A;  2UV0 E;  2YKF A;  2Y8H A;  4Y7P A;  5CGW A;  4JF5 A;  1DY6 A;  4OQH A;  2ZQ9 A;  1N9N A;  2VV6 A;  4HBU A;  2V1A A;  3V67 A;  4FH2 A;  1YPR A;  4F3L B;  4B93 A;  2O9B A;  2P08 A;  1ZG6 A;  3BRM A;  2QMI A;  4EU0 A;  1W63 Q;  4LRY C;  5EUA A;  1YLW A;  2RL3 A;  1LHY A;  5KIZ A;  3HLD A;  5LBR A;  2XK1 A;  3OCN A;  5EOO A;  3C7V A;  3DW0 A;  4E3M A;  4I5S A;  4OQI A;  2ZJ9 A;  3CPT B;  1VEU A;  3Q82 A;  5FQJ A;  1TVF A;  3ZG8 B;  3UY6 A;  1YMX A;  2NUT C;  3Q07 A;  2V1B A;  4Y17 A;  1P9R A;  1CI8 A;  5HWW A;  4EUZ A;  3UB9 A;  1ES3 A;  3LR5 A;  3Q7V A;  3JPU A;  3ZVT A;  2XSS A;  3VP0 A;  1LSW A;  3OOV A;  3CHW P;  3NCK A;  1Y28 A;  2XA7 S;  4ZDX A;  5J7E A;  2QKP A;  2WKE A;  1AXB A;  1S1Y A;  4OQ0 A;  2O99 A;  3LIA A;  1YKD A;  4YWZ A;  1G5U A;  3MS6 A;  3IS2 B;  3OPP A;  2Y2O A;  1JTD A;  5DKL A;  2EFU A;  2WKP A;  4QWO A;  5CHU A;  2K7S A;  2XH9 A;  3KSF A;  3HJK A;  2HP5 A;  1S0W A;  3ZVW A;  1MWT A;  5HX9 A;  2QJ5 A;  3JYI A;  3ZG5 A;  3B47 A;  3OLO A;  3V3S A;  2XFT A;  4LFU A;  2X01 A;  3UDX A;  5A8B A;  3BFF A;  3NEC A;  1JWP A;  1TS6 A;  2PDR A;  2I9V A;  3H7W B;  5KSC A;  2QJ7 A;  4WLA A;  4K91 A;  1MC0 A;  2W1T A;  2WKR A;  5EVI B;  3T1S A;  4PHT A;  4HP4 A;  2L4R A;  2V8F A;  4OPQ A;  1S4S A;  3SH7 A;  2W3H A;  4ESP A;  1EW0 A;  3LUQ A;  4WEL A;  1OTD A;  3DTE A;  5FI7 A;  1VM1 A;  2IWC A;  4HJ4 A;  4LCL A;  4YIN A;  1MY8 A;  1YSP A;  1ES5 A;  2PRF A;  3FPV A;  2PT7 A;  3PBO A;  2WYX A;  1IEL A;  2PAV P;  1MKM A;  2EX8 A;  3IT9 A;  5DTS A;  2VJW A;  4WYY A;  3A0V A;  2GX5 A;  4E3I A;  3N4I A;  2EWW A;  3PR6 A;  3HJI A;  3GR2 A;  3SW1 A;  2PBY A;  4PKY A;  4NK3 A;  3HLC A;  2VX8 A;  4YNR A;  2Y2H A;  3MXQ A;  4EQ1 A;  4LPZ A;  3BWL A;  3CJM A;  3CMZ A;  3H82 A;  4LV2 A;  5DJT A;  3IF6 C;  1E4D A;  3MF0 A;  4BWI A;  3A3J A;  3PAE A;  4GHI A;  1A0K A;  2WAF A;  3WS0 A;  4IBX A;  2Y2P A;  3VOZ A;  3UDI A;  3VP3 A;  4IVI A;  2ZC6 B;  1S6R A;  4EV4 A;  1YQS A;  3C7U A;  4EBL A;  2NUP C;  5AQ7 A;  5J8X A;  4DXB A;  3B33 A;  1RCJ A;  2ZBB A;  3V50 A;  1XFQ A;  1XJ2 A;  3W8K A;  2Y2J A;  4DE1 A;  4ZJ1 A;  1YM1 A;  1FQG A;  2ZC5 B;  3AGF A;  4FUW A;  3E2L A;  1CI9 A;  3VP4 A;  1LL9 A;  3ISG A;  4EWF A;  2DNS A;  1MBL A;  4K0X A;  4MCW A;  3T1R A;  1OTE A;  4KZ3 A;  5HDS A;  5GHY A;  2J7V A;  1ES4 A;  3NOT C;  3M6B A;  1OT9 A;  2WZX A;  3IF6 B;  1VET A;  5CGX A;  4EQI A;  3PBT A;  4KUO A;  4O01 A;  1TS8 A;  3A0S A;  3A3E A;  3T4T A;  4GLQ A;  3HL9 A;  4OLG A;  3M2J A;  3BLS A;  2JKT I;  3NI9 A;  1PNE A;  1KVM A;  4OQG A;  4BD1 A;  1OTI A;  5FAS A;  3KYE A;  4GDB A;  4S2N C;  2WGW B;  2W1R A;  4GW9 A;  4OKP A;  1BZA A;  1YLZ A;  1VHM A;  4NEE D;  5F1F A;  4HBT A;  1IYO A;  3G32 A;  1NRJ A;  4R4R A;  1HZO A;  1LSV A;  2VK3 A;  4HHD A;  5CRF A;  1FSY A;  4P87 A;  2ZQA A;  4E04 A;  3SOI A;  1EI5 A;  3BLM A;  3LID A;  1PRQ A;  4BQM A;  5FAQ A;  3BM6 A;  3HLF A;  3BEB A;  1ZHH B;  3BQA A;  3C8C A;  2ACG A;  4DE0 A;  3B3X A;  4OVD A;  1SHV A;  1IOU A;  5FA7 A;  2ZM8 A;  3C2W A;  2Q9M A;  1GA9 A;  2GJ3 A;  4JXS A;  2JN7 A;  5DFX A;  3NHQ A;  1QME A;  4FTX A;  1RP5 A;  4NXF A;  1PZO A;  3VE4 A;  4Q8I A;  3KYZ A;  4U0X A;  3SH8 A;  3MJQ A;  5FL3 A;  3EEH A;  2ZQC A;  1OME A;  2QHK A;  4Y3I A;  3HLG A;  4ID4 A;  3Q81 A;  3R7W A;  1K55 A;  3RXX A;  4II7 A;  4GS9 A;  3DTM A;  4UAA A;  4RX3 A;  3IQA A;  2QWS A;  1VET B;  4P6Z M;  3WS2 A;  2L0W A;  2M1C A;  4KG2 A;  3SH9 A;  4S2I A;  1BUL A;  4I3I A;  2XFS A;  1NWZ A;  1IKI A;  3K3C A;  2XDM A;  4MBK A;  3FC7 A;  1TS0 A;  2ZC7 A;  1N4O A;  5TBM A;  4S2N A;  3B42 A;  3FZC A;  2KDK A;  2VKS A;  1WA9 A;  2Y2K A;  1GHI A;  3UPN A;  2H0T A;  4X1M A;  3BFG A;  3S7N A;  4KQD A;  4PM5 A;  2XD1 A;  3G30 A;  1H0M A;  4C75 A;  2PYR A;  2QYB A;  1K4E A;  1YAX A;  4QB8 A;  4K08 A;  3N8R A;  5AVF A;  5HFO A;  5HPF A;  2EA9 A;  1LL8 A;  3C38 A;  5CHJ A;  2K2N A;  3HUO A;  3BFC A;  1FSW A;  4JXV A;  2G2U A;  4DMZ A;  1Z09 A;  3UE1 A;  4GNU A;  2V8C A;  3VV4 A;  3ICY A;  3T1X A;  1T1A A;  4NKP A;  1I2S A;  5D3O A;  3UB5 P;  4KZ5 A;  4E3N A;  1STZ A;  4QPR A;  4OPY A;  4S2K A;  1XKZ A;  5DTK A;  3HUN A;  2VGL M;  1FCO A;  1SDN A;  1XFN A;  3IXD A;  4MN7 A;  3A0R A;  2OLU A;  2HP6 A;  1BYW A;  3O3V A;  3S1Y A;  4XT2 B;  4L9E A;  5FAT A;  2PU4 A;  1TD5 A;  3LR3 A;  3MXS A;  3C5A A;  2JKR M;  4MBH A;  4WZ5 A;  2Y4A A;  2OSU A;  1AWI A;  3IS2 A;  3NOU C;  3A3F A;  1E25 A;  2P9V B;  3S22 A;  5CED A;  3IH9 A;  1K54 C;  4YFM A;  1CJF A;  4KUK A;  4Q0H A;  5TBM B;  2ZOI A;  3E4P A;  4A5R A;  3SS4 A;  1ERO A;  3UPO A;  1LLB A;  3IHA A;  5CGS A;  4X56 A;  5JYO A;  1S66 L;  1U60 A;  3HVF A;  5I94 A;  5HL6 A;  2B18 A;  2XLN A;  2OLV A;  2PR6 A;  2IWD A;  3GMW A;  3UE0 A;  3W4P A;  4LRX C;  4JGO A;  2CC1 A;  2KX6 A;  1H8M A;  4JF4 A;  2ZM0 A;  1FOF A;  4GN2 A;  4ME4 A;  4ETZ A;  1BLH A;  3GVB A;  2J3T C;  3UB7 A;  4NET A;  4WF0 A;  1TDL A;  4MN6 A;  4EW7 A;  1Q2P A;  3UN7 A;  2MJ6 A;  2VEA A;  1GHM A;  1VQQ A;  4ETX A;  5IS1 A;  1JTG A;  4KZB A;  5FEF A;  1OPX A;  2ZQ7 A;  1L0D A;  1PIO A;  3S4X A;  2ZLY A;  5M1A A;  5EOE A;  1YLP A;  4MBF A;  3BFE A;  2B5R A;  3FKW A;  2OWJ A;  4XT2 A;  2WGW A;  3HLW A;  4X1L A;  3MZE A;  3I7J A;  5GLB A;  5M19 A;  3V39 A;  4HH3 A;  3MFX A;  2GNX A;  4DJ2 A;  3E2K A;  1SKO B;  4HEF A;  3MFD A;  3EGX C;  3RJU A;  4HP9 A;  3IF5 A;  1WE4 A;  5EVI C;  3VSK A;  3P01 A;  2O9A A;  2XF3 A;  3WRZ A;  1L3L A;  1LI9 A;  2ZD8 A;  5TGF A;  4UQI M;  4EES A;  1FCN A;  4LGW A;  5EE8 A;  5TR7 A;  2W3F A;  3EOI A;  2OV5 A;  3BQ8 A;  1DJA A;  5AJG A;  1N9O A;  2IWB A;  5GLD A;  2Z6D A;  1IKG A;  4Q0J A;  2Y2L A;  3SZT A;  3P7N A;  2J80 A;  1RGY A;  3LEQ A;  2XRN A;  4Y13 A;  4N1H A;  1XPB A;  5DF7 A;  3A3D A;  1SKF A;  3LGO A;  1XX2 A;  1DJC A;  1JNU A;  5HAI A;  2Y2G A;  3D9Y A;  3H9W A;  3IBR A;  3S7P A;  1TS7 A;  1MWU A;  4OOL A;  4L0L A;  4GB7 A;  2ZQD A;  4KZ8 A;  4FSF A;  4UEY A;  1C3B A;  3QP6 A;  2V0U A;  3NBL A;  3O5Y A;  2BLS A;  2EWV A;  3EWK A;  3PAG A;  4ZRR A;  5EFW A;  3TE8 A;  5FQI A;  1W79 A;  3C4P A;  4QHC A;  3CAX A;  4FOF A;  1NLY A;  3NIA A;  1F2K A;  2HGV A;  3LEZ A;  4KZ6 A;  2V2F F;  3LYX A;  4OOY A;  3FV7 A;  5KSH A;  1WYB A;  2EX6 A;  3NDE A;  4FD8 A;  2VLG A;  4MLL A;  2J3T D;  3PYP A;  5EPH A;  3TW8 A;  1SKO A;  1GA0 A;  3QP4 A;  1K57 A;  1E3U A;  2JHE A;  1FIK A;  3LFV A;  1D1J A;  4BL3 A;  1PWG A;  4NG2 A;  4Z9Q A;  3CI6 A;  4HH2 A;  3LI9 A;  3OPL A;  3HUM A;  3G2Z A;  3LIB A;  3ZHH A;  1KDS A;  4LV0 A;  1K38 A;  3H7W A;  5FI2 A;  5HAR A;  4RX2 A;  1KVL A;  2DCF A;  2E8J A;  2V20 A;  5AQA A;  4Y2F A;  5HDD A;  3UPP A;  4H6J B;  3P98 A;  5FAP A;  3LIF A;  1H3Q A;  1ZTU A;  1PW8 A;  2HDQ A;  5I5L A;  4KQO A;  2VGJ A;  5HW3 A;  2WGV A;  3QP2 A;  1PYY A;  3PHY A;  4R6L A;  3LI8 A;  4N9K A;  4QU3 A;  1HTZ A;  1GSX A;  5IU1 A;  4F94 A;  2Y55 A;  2W0N A;  1ZKJ A;  3KYQ A;  4HJ3 A;  2Z2L B;  4EUV A;  3ITB A;  4E3K A;  5EV0 A;  5G18 A;  5CEC A;  1O07 A;  5TJJ A;  5J3W A;  3N7W A;  4HQA A;  4D2O A;  1XA1 A;  4LCM A;  4DF6 A;  5F82 A;  1J3W A;  5GLC A;  2QPN A;  3IWI A;  5BOH A;  4P6Z S;  1W8Q A;  4IHQ A;  1NYY A;  1RGZ A;  2K31 A;  4EXO A;  3Q1F A;  1G6O A;  3UME A;  4WM9 A;  3UE6 A;  5G4Z A;  4XXR A;  2R9W A;  1NRF A;  2BAS A;  5HSQ A;  4WMC D;  2ZM2 A;  2X02 A;  1PI4 A;  3FG8 A;  1Q2Q A;  1JVJ A;  5E2H A;  1H8Z A;  2HZ5 A;  5CXW A;  1K0K A;  3HCY A;  3WWX A;  5DTT A;  3N6I A;  1W8Y A;  5FQK A;  4M4X A;  5A91 A;  3NUL A;  1W7F A;  3U2A A;  4DE2 A;  4RYE A;  3ITA A;  1MXO A;  4IED A;  2W3E A;  3HRE A;  1MPL A;  2B95 A;  1K6R A;  4H8R A;  4R1G A;  2Z2M B;  3M6H A;  4CLC C;  4DE3 A;  4QY5 A;  1ONH A;  4R23 A;  2H5S A;  2XR0 A;  4P85 A;  3BW6 A;  5L2F A;  4B4X A;  1X0O A;  1ESU A;  2JBF A;  1S1Z A;  4KZA A;  3UNW A;  5HD3 A;  4KG6 A;  1LL5 A;  3A3I A;  4DN0 A;  2FZ0 A;  1PFL A;  4XUX A;  3IBJ A;  4BBT A;  2W1T B;  3TSG A;  1TEM A;  3T4S A;  5HL1 A;  2M7V A;  3ULF A;  3AGD A;  4O0P A;  2H0Y A;  1OT6 A;  4OLD A;  1YSQ A;  3T4Q A;  3QHY A;  1XXM A;  1NZO A;  4X53 A;  3IH8 A;  4R0Q A;  1L0E A;  5FEG A;  3VOY A;  4BBU A;  4CPK A;  4Q0I A;  3N8L A;  1MZU A;  3GTC A;  5FI6 A;  5A92 A;  1DJB A;  1JWZ A;  2INW A;  1ZG4 A;  3ZGA B;  1PI5 A;  3MKE A;  2EX2 A;  3TJZ C;  4R70 A;  1BUE A;  4ZJ3 A;  1KE0 A;  1K55 C;  5KZH A;  1XGJ A;  1OTA A;  1BTL A;  5F5Y A;  3UB6 A;  4DKI A;  2DRW A;  3K3D A;  4B88 A;  2Z6C A;  1L2S A;  4PPR A;  1SCW A;  3RTY A;  3DWZ A;  1ERM A;  3D3O A;  1F9I A;  3MSH A;  2G2W A;  1ACF A;  3M2K A;  4WEK A;  2HJE A;  4Y0T A;  1MWR A;  3FYZ A;  3PBR A;  5FQQ A;  1SDE A;  1IEM A;  1P0Z A;  2JKR I;  3FKV A;  1ES2 A;  4BMW A;  1EWZ A;  3CWF A;  2AVX A;  4GHI B;  3VP1 A;  3PXP A;  4NXE A;  3L7H A;  4R3J A;  1K56 A;  4Y5F A;  4CLC D;  3QP8 A;  4KZ9 A;  3RFB A;  2ZQ8 A;  4OP5 A;  4IBR A;  5K5B A;  3OCL A;  2OWH A;  1NXY A;  5AVE A;  4GS9 B;  1W63 M;  1K54 A;  3CPT A;  3G31 A;  3LCE A;  4IUH A;  4OPZ A;  4JBF A;  4KZ7 A;  1KE4 A;  1F5M A;  3F1P A;  3WRT A;  3DBA A;  1GCE A;  2FH5 A;  3HLE A;  4RQ9 A;  1YLT A;  2CMN A;  3ZNY A;  2XGN A;  1KGG A;  4BJP A;  2JCH A;  2WAD A;  3RH8 B;  1BLC A;  3BYD A;  2ZL1 B;  3LY3 A;  1Y54 A;  5F83 A;  2JC7 A;  1WYC A;  4R38 A;  1XJ3 A;  4GZB A;  5GL9 A;  3WS4 A;  1FIL A;  1VB6 A;  1QMF A;  3W2Z A;  1ODV A;  3TRC A;  1OJG A;  2PYP A;  4E6X A;  3EQV A;  2PR5 A;  4LLO B;  3T4J A;  1ZC2 A;  4E3J A;  4OON A;  1O7E A;  4OP8 A;  3O86 A;  5FQ9 A;  4N9L A;  3E98 A;  2KOI A;  5DFY A;  5HPI A;  4Y0U A;  4GCZ A;  4WZ4 A;  4LV3 A;  1SZV A;  4PM8 A;  1NLZ A;  5E2F A;  4JLF A;  4D60 A;  2D02 A;  4X6T A;  5HAQ A;  3F1O A;  4JF6 A;  1N9L A;  4F3L A;  2EX9 A;  3NJA A;  5HWV A;  4G3K A;  5CER A;  1KGE A;  3TG9 A;  2OAP 1;  3DWK A;  3NDG A;  4I38 A;  2J8Y A;  1ONG A;  2LB5 A;  4KZ4 A;  3Q7Z A;  1Z6F A;  3QNC A;  3Q7V B;  3T50 A;  3GDI A;  4DDY A;  5IHV A;  4BEN A;  2P74 A;  2V9A A;  2Y2I A;  1W5D A;  3L9K A;  1K56 D;  4R3A A;  3MKF A;  5FSR A;  4Z1W A;  5TFQ A;  2EXA A;  2C5W B;  3ZQ5 A;  1BLS A;  1N9B A;  3C30 A;  4EET B;  3ZG7 B;  5CEB A;  3NOP C;  3P09 A;  1CEF A;  5C5K A;  1KDW A;  1T1C A;  2WZZ A;  2LB9 A;  3VFH A;  1T19 A;  1XJ6 A;  2UWX A;  4MN5 A;  4RA7 A;  4ARZ A;  3JVV A;  2Y2N A;  5F6A A;  3T12 B;  2X71 A;  4CLC A;  1UGU A;  3H82 B;  2PD7 A;  3MQ0 A;  3GEC A;  5DJU A;  4C3Q A;  4FCF A;  2RCX A;  5HWT A;  4EEP A;  2HF6 A;  3MMH A;  4XUZ A;  1OJ5 A;  2D01 A;  4HES A;  5G4Y A;  1CK3 A;  3G35 A;  4CJN A;  1IYS A;  3CUE C;  1I2W A;  3C4O A;  4C6Y A;  1MWS A;  2GZA A;  4BBV A;  5E43 A;  1PW1 A;  2ZMA A;  5EVI D;  3R7W B;  3F1O B;  4KQR A;  4M3K A;  1YLY A;  1G28 A;  5HD5 A;  1YLJ A;  3G4P A;  3HLB A;  3TOI A;  5FQM A;  3MBZ A;  3V3R A;  3GSG A;  3S7O A;  3VSL A;  4U0T A;  3LR0 A;  5GLA A;  5EVL A;  1G68 A;  3IF6 A;  5F68 A;  4IJG A;  3CUE A;  3EGD C;  1D7E A;  4G3V A;  4R3B A;  5EM0 A;  1V9Y A;  1F98 A;  2BTF P;  2PD8 A;  1PZP A;  2O9C A;  3PTE A;  2JKG A;  2VGL S;  3DTI A;  2Y2M A;  5HDC A;  1H5X A;  3T4O A;  2V1Z A;  3T4K A;  2IA2 A;  2ZOH A;  3IWO A;  5EM1 A;  2V0W A;  4HOI A;  4UA9 A;  2P9V A;  4P0M A;  4R4S A;  5F69 A;  4DRT A;  3WS5 A;  4H6J A;  3BY9 A;  3KO6 A;  5DF9 A;  5MC7 A;  1S67 L;  3IWQ A;  4EEU A;  5FDH A;  2Y2Q A;  3AGE A;  1ALQ A;  2GDN A;  2H10 A;  1FR1 A;  5M18 A;  3G2Y A;  4MDZ A;  1BT5 A;  5CHM A;  3IX4 A;  3ZFZ A;  3QP1 A;  2I72 A;  3DTK A;  5L10 A;  3LR4 A;  3MR0 A;  3BY8 A;  3CIT A;  1NJ4 A;  5E2G A;  3WS1 A;  5EEC A;  2QZ6 A;  4HNB A;  4JPM A;  2YKH A;  3F1P B;  2Y91 A;  4K0W A;  1BSG A;  1Y4O A;  2WUQ A;  4UA6 A;  3NC8 A;  4G3W A;  3G6O A;  1TDG A;  2A49 A;  3HBR A;  4EER A;  1XP4 A;  3SS5 A;  2FFY A;  1XJ4 A;  2C6W B;  2DMW A;  3E4Q A;  2WKQ A;  5FAO A;  5DF8 A;  2J9P A;  1L0G A;  3LO7 A;  1DP8 A;  5CX7 A;  3LY4 A;  5CTM A;  3QNB A;  3V5M A;  4S2P A;  1M40 A;  3S7Q A;  4LEN A;  1DRM A;  4HJ6 A;  2A24 A;  4OPR A;  4S2M A;  3VMA A;  4GOG A;  3K2N A;  4PM6 A;  1UWP X;  3IXB A;  4WN5 A;  2W3G A;  2WKH A;  3U4L P;  2KLI A;  2VA0 A;  2HP9 A;  5A93 A;  3O88 A;  4E3L A;  3IXH A;  4PM7 A;  3KSH A;  2P04 A;  2J3W A;  4WMC A;  3OZH A;  1D06 A;  5L07 A;  1V9Z A;  3FWL A;  2J9O A;  3SS3 A;  3CLO A;  2ZC4 B;  3PBS A;  4L9F A; 
#chains in the Genus database with same CATH homology
 1BLP A;  2FFF B;  2P9V B;  3S22 A;  2DRW A;  4B88 A;  5CED A;  3MZD A;  2HP5 A;  1L2S A;  1S0W A;  4QY6 A;  3ZVW A;  3W4O A;  4PPR A;  3IH9 A;  1K54 C;  1SCW A;  1MWT A;  4YFM A;  3DWZ A;  1ERM A;  1FR6 A;  5HX9 A;  1IYP A;  3JYI A;  2G2W A;  3G34 A;  4E6W A;  3M2K A;  3ZG5 A;  4WEK A;  4Y0T A;  1MWR A;  4A5R A;  3SS4 A;  1ERO A;  3ZDJ A;  3O87 A;  3UPO A;  3V3S A;  1LLB A;  3FYZ A;  3IHA A;  2XFT A;  3PBR A;  1SDE A;  5FQQ A;  1IEM A;  5CGS A;  2X01 A;  3UDX A;  3BFF A;  4X56 A;  1JWP A;  4X55 A;  3FKV A;  5JYO A;  1ES2 A;  4WZ5 C;  1U60 A;  1EWZ A;  3HVF A;  3PBQ A;  5I94 A;  5E2E A;  5KSC A;  4K91 A;  2XLN A;  3VP1 A;  4S2J A;  2OLV A;  4N1X A;  4R3J A;  2IWD A;  3GMW A;  3UE0 A;  4ZAM A;  3W4P A;  1K56 A;  4KZ9 A;  5EVI B;  2ZQ8 A;  4OP5 A;  4IBR A;  4E3O A;  2CC1 A;  1JWV A;  3OCL A;  5AQB A;  4JF4 A;  4OPQ A;  2JE5 A;  3SH7 A;  2ZM0 A;  1FOF A;  1K25 A;  1NXY A;  1YMS A;  5EVI A;  4GN2 A;  3VP2 A;  2PU2 A;  1BLH A;  3PBN A;  3GVB A;  4BL2 A;  3OPR A;  1K54 A;  3G31 A;  2E8I A;  3LCE A;  4NET A;  2XD5 A;  4OPZ A;  4S2O A;  3D4F A;  4WEL A;  1TDL A;  4JBF A;  4KZ7 A;  1KE4 A;  4QJG A;  1Q2P A;  5FI7 A;  1VM1 A;  3UN7 A;  2IWC A;  3WRT A;  1GHM A;  1VQQ A;  1GCE A;  4IVK A;  4LCL A;  1JTG A;  4KZB A;  4YIN A;  1MY8 A;  1YT4 A;  4B4Z A;  1K57 C;  3HLE A;  2ZQ7 A;  1YLT A;  1L0D A;  3ZNY A;  2XGN A;  1KGG A;  1PIO A;  1ES5 A;  3S4X A;  2ZLY A;  5M1A A;  4BJP A;  1E3U D;  2JCH A;  1YLP A;  5EOE A;  4MBF A;  2WAD A;  3PBO A;  1BLC A;  2WYX A;  3BFE A;  3BYD A;  2B5R A;  3FKW A;  1IEL A;  3BEC A;  2WGW A;  3HLW A;  4DKI A;  3LY3 A;  3UDF A;  1Y54 A;  5F83 A;  2JC7 A;  2EX8 A;  3MZE A;  4ZTK A;  3I7J A;  3IT9 A;  5GLB A;  5DTS A;  4WYY A;  3NY4 A;  5GHZ A;  3V39 A;  5M19 A;  1GHP A;  4KG5 A;  4X69 A;  4E3I A;  1WYC A;  1NYM A;  3E2K A;  3N4I A;  4HEF A;  3MFD A;  4GDN A;  3GR2 A;  4GZB A;  5GL9 A;  5CTN A;  3RJU A;  3WS4 A;  2PBY A;  3IXG A;  3CZD A;  3IF5 A;  4NK3 A;  1WE4 A;  1ERQ A;  3HLC A;  5EVI C;  3ZNT A;  3VSK A;  5JYP A;  2Y2H A;  2XF3 A;  4OOM A;  4U3T A;  3WRZ A;  1LI9 A;  1XGI A;  2ZD8 A;  1QMF A;  5TGF A;  1NY0 A;  1FCN A;  3BFD A;  1IYQ A;  2WGI A;  5EE8 A;  4WEJ A;  5TR7 A;  3CJM A;  4E6X A;  3CMZ A;  3EQV A;  1H8Y A;  2OV5 A;  4LV2 A;  1DJA A;  3IF6 C;  1E4D A;  2IWB A;  5GLD A;  1IKG A;  1ZC2 A;  3A3J A;  3PAE A;  2Y2L A;  4E3J A;  4OON A;  1O7E A;  2EXB A;  2Q9N A;  2WAF A;  1RGY A;  4IBX A;  2Y2P A;  4OP8 A;  3VOZ A;  3O86 A;  3UDI A;  3WS0 A;  5FQ9 A;  4JXW A;  4N9L A;  4QD4 A;  3VP3 A;  4JKT A;  4IVI A;  4Y0U A;  4N1H A;  4WZ4 A;  1XPB A;  4LV3 A;  4PM8 A;  2ZC6 B;  5E2F A;  1S6R A;  5A90 A;  5DF7 A;  4JLF A;  4EV4 A;  1YQS A;  3A3D A;  1SKF A;  3C7U A;  4EBL A;  5F1G A;  4KQQ A;  4X6T A;  5AQ7 A;  5J8X A;  1J9M A;  4DXB A;  2HDU A;  5HAQ A;  1XX2 A;  1DJC A;  1RCJ A;  5HAI A;  3V50 A;  3W4Q A;  4JF6 A;  2Y2G A;  5AQ9 A;  3W8K A;  2Y2J A;  3IHB A;  3OC2 A;  2EX9 A;  4DE1 A;  4ZJ1 A;  5CER A;  3UO9 A;  1YM1 A;  1FQG A;  2ZC5 B;  1KGE A;  3AGF A;  4GD8 A;  3TG9 A;  3E2L A;  1CI9 A;  3VP4 A;  1FCM A;  1MWU A;  4EBP A;  1LL9 A;  4OOL A;  1CEG A;  3DWK A;  3NDG A;  3EQU A;  4FH4 A;  4GB7 A;  4L0L A;  2J8Y A;  3ISG A;  2ZQD A;  4KZ8 A;  4FSF A;  1ONG A;  4EWF A;  1K4F A;  2DNS A;  1C3B A;  1MBL A;  4K0X A;  2XQZ A;  3NBL A;  4KZ4 A;  2BLS A;  3Q7Z A;  3PAG A;  1Z6F A;  1PWD A;  3QNC A;  3Q7V B;  5GHX A;  5FQI A;  4DDY A;  4KZ3 A;  1HD8 A;  1W79 A;  1E25 A;  2J7V A;  4UA7 A;  1ES4 A;  5GHY A;  4Y0O A;  5IHV A;  4BEN A;  2P74 A;  3M6B A;  3C4P A;  2Y2I A;  1W5D A;  2WZX A;  3IF6 B;  4QHC A;  5CGX A;  4EQI A;  1K56 D;  3PBT A;  4LV1 A;  3NIA A;  1LI0 A;  3A3E A;  3GRJ A;  3MKF A;  5FSR A;  3HL9 A;  5TFQ A;  2EXA A;  3LEZ A;  4KZ6 A;  2C5W B;  2V2F F;  4OLG A;  4DDS A;  1NZU A;  1BLS A;  3M2J A;  1N9B A;  4OOY A;  3BLS A;  1XA7 A;  3FV7 A;  4GD6 A;  3ZG7 B;  5CEB A;  1MKI A;  3NI9 A;  5KSH A;  3P09 A;  1WYB A;  2EX6 A;  1CEF A;  3NDE A;  2BG1 A;  4MNR A;  1KDW A;  4FD8 A;  4MLL A;  5EPH A;  2WK0 A;  1KVM A;  2WZZ A;  2WKI A;  4OQG A;  4S2L A;  1GA0 A;  4BD1 A;  1K57 A;  1E3U A;  5FAS A;  2EFX A;  1KGF A;  3N8S A;  3VFH A;  4PM9 A;  4BL3 A;  2UWX A;  4GDB A;  4RA7 A;  1PWG A;  4S2N C;  4Z9Q A;  2WGW B;  2Y2N A;  3OPL A;  4OKP A;  3HUM A;  1BZA A;  1YLZ A;  3G2Z A;  4JXG A;  2X71 A;  3ZHH A;  5F1F A;  1ESI A;  1KDS A;  4RVA A;  4LV0 A;  1K38 A;  2HDR A;  2HDS A;  4HBT A;  5FI2 A;  3GQZ A;  1IYO A;  1KE3 A;  3G32 A;  5DVA A;  5HAR A;  4RX2 A;  4R4R A;  1HZO A;  1KVL A;  2DCF A;  4C3Q A;  2V20 A;  5AQA A;  3UPP A;  3GV9 A;  1L0F A;  4UHU A;  5FAP A;  3P98 A;  4FCF A;  2RCX A;  5CRF A;  1FSY A;  4P87 A;  1PW8 A;  3CG5 A;  2ZQA A;  4WBG A;  2HDQ A;  4XUZ A;  3SOI A;  1EI5 A;  3BLM A;  1M6K A;  4HES A;  4KQO A;  1CK3 A;  2VGJ A;  3G35 A;  4CJN A;  5HW3 A;  1IYS A;  4BQM A;  2WGV A;  4O7D A;  5FAQ A;  1PYY A;  3BM6 A;  1I2W A;  3MXR A;  3HLF A;  3BEB A;  4KEN B;  2R9X A;  3C4O A;  4MEZ A;  4QU3 A;  4N9K A;  4BLM A;  4C6Y A;  4DE0 A;  1MWS A;  1HTZ A;  5HAP A;  1G6A A;  5KMW A;  2WAE A;  3ZG0 A;  3B3X A;  4OVD A;  4F94 A;  1SHV A;  2Y55 A;  5E43 A;  1ZKJ A;  1PW1 A;  5FA7 A;  2ZMA A;  5EVI D;  2Z2L B;  2ZM8 A;  2Q9M A;  1GA9 A;  3ITB A;  4KQR A;  4M3K A;  4JXS A;  4E3K A;  3ZG9 B;  1YLY A;  5G18 A;  4ZBE A;  3MZF A;  5CEC A;  1YLJ A;  1O07 A;  1QME A;  3G4P A;  5U47 A;  2A3U A;  3HLB A;  3N7W A;  4D2O A;  1XA1 A;  4LCM A;  1RP5 A;  4P6B A;  3TOI A;  3UE3 A;  4DF6 A;  5FQM A;  4Q8I A;  1PZO A;  3MBZ A;  5F82 A;  3V3R A;  3GSG A;  5GLC A;  3ZCZ A;  2QPN A;  3VSL A;  4U0T A;  3IWI A;  5BOH A;  2Y59 A;  4X68 A;  4U0X A;  3SH8 A;  1W8Q A;  5GLA A;  4ZJ2 A;  1G68 A;  3OPH A;  1NYY A;  3IF6 A;  2ZQC A;  5EVL A;  4OH0 A;  3VFF A;  1PWC A;  1RGZ A;  1OME A;  3Q1F A;  1HVB A;  4R3B A;  2ZC3 B;  3HLG A;  4ID4 A;  1PZP A;  3Q81 A;  4WM9 A;  1K55 A;  3RXX A;  4XXR A;  1K6S A;  3DTM A;  3PTE A;  4UAA A;  4RX3 A;  2R9W A;  1NRF A;  3IQA A;  3WS2 A;  2Y2M A;  1H5X A;  2V1Z A;  3IWO A;  4WMC D;  2ZM2 A;  1I5Q A;  2X02 A;  4UA9 A;  1PI4 A;  4DXC A;  4PMA A;  3RXW A;  4KG2 A;  1Q2Q A;  2P9V A;  4N92 A;  4P0M A;  4S2I A;  1BUL A;  2VGK A;  3SH9 A;  2XFS A;  4R4S A;  4DRT A;  4GKU A;  3WS5 A;  1JVJ A;  5E2H A;  1IKI A;  1H8Z A;  4EBN A;  5CXW A;  2XDM A;  3WWX A;  4MBK A;  5DF9 A;  4BD0 A;  5DTT A;  2ZC7 A;  3N6I A;  1N4O A;  2XEP A;  4S2N A;  2HPB A;  1W8Y A;  5FQK A;  3IWQ A;  3FZC A;  5A91 A;  1W7F A;  4Y7P A;  5CGW A;  2Y2Q A;  5FDH A;  3AGE A;  1ALQ A;  2Y2K A;  1GHI A;  4JF5 A;  4DE2 A;  1DY6 A;  2GDN A;  3UPN A;  2H0T A;  2H10 A;  4OQH A;  1FR1 A;  3BFG A;  5M18 A;  3G2Y A;  2ZQ9 A;  4RYE A;  1BT5 A;  3ITA A;  1MXO A;  5CHM A;  4HBU A;  4IED A;  3ZFZ A;  2I72 A;  4FH2 A;  3HRE A;  4PM5 A;  2XD1 A;  1MPL A;  1K6R A;  3G30 A;  4H8R A;  4R1G A;  2Z2M B;  3M6H A;  4DE3 A;  1NJ4 A;  4C75 A;  5E2G A;  4QY5 A;  1ONH A;  3WS1 A;  5EEC A;  1ZG6 A;  3BRM A;  2XR0 A;  2H5S A;  4R23 A;  2QMI A;  2QZ6 A;  4P85 A;  5L2F A;  4JPM A;  1K4E A;  5EUA A;  4B4X A;  1YLW A;  4QB8 A;  2RL3 A;  1LHY A;  2Y91 A;  1ESU A;  3HLD A;  4K0W A;  2JBF A;  2XK1 A;  3OCN A;  3N8R A;  1BSG A;  5HFO A;  4KZA A;  5EOO A;  2WUQ A;  3UNW A;  3C7V A;  4KG6 A;  4UA6 A;  3NC8 A;  1LL5 A;  3A3I A;  5CHJ A;  3DW0 A;  1TDG A;  2A49 A;  3HUO A;  4E3M A;  3BFC A;  3HBR A;  1XP4 A;  1FSW A;  4JXV A;  4XUX A;  2G2U A;  4OQI A;  3SS5 A;  2FFY A;  2ZJ9 A;  3TSG A;  1TEM A;  2C6W B;  3Q82 A;  3UE1 A;  5HL1 A;  5FQJ A;  4GNU A;  1TVF A;  3AGD A;  3ZG8 B;  3UY6 A;  5DF8 A;  1YMX A;  3Q07 A;  5FAO A;  2J9P A;  2H0Y A;  1L0G A;  1I2S A;  3LO7 A;  5D3O A;  4OLD A;  4KZ5 A;  3LY4 A;  5CTM A;  4E3N A;  3QHY A;  1CI8 A;  1XXM A;  3QNB A;  1NZO A;  4X53 A;  3V5M A;  3IH8 A;  4S2P A;  4OPY A;  4EUZ A;  1M40 A;  4R0Q A;  4S2K A;  1ES3 A;  1L0E A;  3Q7V A;  1XKZ A;  3VOY A;  4LEN A;  4CPK A;  3ZVT A;  4OPR A;  3VP0 A;  4S2M A;  3N8L A;  3VMA A;  4GOG A;  3NCK A;  3GTC A;  5FI6 A;  4PM6 A;  5A92 A;  1DJB A;  3IXB A;  1JWZ A;  1ZG4 A;  5DTK A;  3ZGA B;  2WKH A;  3HUN A;  4ZDX A;  2WKE A;  1FCO A;  1PI5 A;  1SDN A;  3MKE A;  2EX2 A;  2HP9 A;  3IXD A;  5A93 A;  1AXB A;  2OLU A;  3O88 A;  4E3L A;  3IXH A;  2HP6 A;  4OQ0 A;  3O3V A;  4PM7 A;  3S1Y A;  1BUE A;  4ZJ3 A;  1KE0 A;  5FAT A;  2PU4 A;  4WMC A;  1K55 C;  3MXS A;  5KZH A;  1XGJ A;  3C5A A;  3OPP A;  2Y2O A;  3OZH A;  1JTD A;  4MBH A;  2EFU A;  3FWL A;  1BTL A;  2J9O A;  5CHU A;  4WZ5 A;  3SS3 A;  2Y4A A;  2OSU A;  3A3F A;  2ZC4 B;  3PBS A;  2XH9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...