4X53A

Structure of the class d beta-lactamase oxa-160 v130d in acyl-enzyme complex with aztreonam
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
245
structure length
243
Chain Sequence
b'MHISSQQHEKAIKSYFDEAQTQGVIIIKEGKNLSTYGNALARANKEYVPASTFKMLNALIGLENHKATTNEIFKWDGKKRTYPMWEKDMTLGEAMALSADPVYQELARRTGLELMQKEVKRVNFGNTNIGTQVDNFWGPLKITPVQEVNFADDLAHNRLPFKLETQEEVKKMLLIKEVNGSKIYAKSGWGMGVTSQVGWLTGWVEQANGKKIPFSLNLEMKEGMSGSIRNEITYKSLENLGII'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Class D beta-lactamase OXA-160
molecule tags Hydrolase
source organism Acinetobacter baumannii
publication title Structural Basis of Activity against Aztreonam and Extended Spectrum Cephalosporins for Two Carbapenem-Hydrolyzing Class D beta-Lactamases from Acinetobacter baumannii.
pubmed doi rcsb
total genus 80
structure length 243
sequence length 245
ec nomenclature
pdb deposition date 2014-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4x53A00
1IKIA 3GVBA 1GHMA 4S2PA 4IBRA 2ZC3B 5E43A 2IWDA 3M2JA 3N8RA 1EWZA 3GSGA 5E2GA 1MWRA 4UA9A 2QPNA 3IT9A 2V20A 4QHCA 1LHYA 4FD8A 1YLTA 5DF7A 5JYPA 2HP6A 3UE0A 1FOFA 2GDNA 2PU2A 3FWLA 3HVFA 2ZC4B 4HBUA 4PM9A 5CGSA 1FCMA 4UA7A 5F83A 3ZVWA 5FASA 2PBYA 2G2WA 1MY8A 3Q07A 1MXOA 1NYMA 4JXGA 3G30A 3UDXA 4PM5A 2DCFA 3W4OA 2H0YA 2FFYA 1NZUA 1RGYA 3O3VA 4RA7A 2WUQA 2HP9A 2HDSA 2Y2KA 3LCEA 1ES2A 4R4RA 3V3SA 4KZ6A 2R9WA 2UWXA 2WZXA 3IHAA 1KDSA 1BLHA 1BZAA 1QMFA 2Q9NA 3AGDA 4KQOA 4S2JA 3VSLA 3LY3A 3RXXA 5KZHA 5U47A 3FKVA 2C5WB 1RP5A 2VGKA 3WS5A 1LI0A 4S2NA 1EI5A 5EVIC 1K6SA 3ZCZA 3IF5A 3V3RA 4EV4A 1K38A 4KENB 1YLZA 2P9VB 1BULA 1WYBA 4Q8IA 4R3JA 5FSRA 4PM6A 3ZG5A 4HEFA 1LI9A 1PWGA 5FQMA 4N92A 4OLGA 4GOGA 1YLWA 4R4SA 4LCLA 3E2LA 3NDGA 3UE1A 4BL3A 4BLMA 3WS4A 2Q9MA 3UPOA 1ONGA 3PBNA 4JXSA 4Z9QA 4K0XA 2Y2QA 4JXVA 4E3JA 3HBRA 3BEBA 4MLLA 1PW8A 3AGFA 1L0DA 4JF4A 3TSGA 3SH9A 3M2KA 2ZC6B 1XA1A 1ZC2A 1LL9A 2WGWA 5EPHA 4ZAMA 2JCHA 4WMCD 1GHPA 1ES3A 3ZFZA 3S1YA 1ZG4A 1YLYA 3UDIA 1K54C 1S6RA 1FQGA 3A3JA 3VFHA 1N4OA 1CI8A 3NBLA 3G35A 5CECA 3BFCA 3FV7A 2Y2GA 4KG5A 1IYQA 2X01A 4PM8A 4K0WA 2XFSA 2WKHA 3IXHA 3DW0A 3NY4A 5DVAA 3WS1A 5HW3A 1K4FA 3ZVTA 5KSCA 5G18A 4E3OA 4CPKA 3SOIA 3PAEA 2J7VA 3IQAA 2XEPA 4KZ5A 4OLDA 3DWZA 3A3DA 3OC2A 1SHVA 3NCKA 4OVDA 1PWCA 2ZQ8A 1SCWA 4ZBEA 4WELA 4ZJ3A 1KDWA 3TG9A 4DRTA 3PBRA 3PTEA 2C6WB 3Q7ZA 3FZCA 4NK3A 4MBFA 5CGWA 2ZQAA 5FQJA 4DE1A 2X71A 5E2HA 1SKFA 1XKZA 4DF6A 4OPYA 2XH9A 4LV2A 4U0TA 3ITAA 3QNBA 1JWVA 5FI7A 1W5DA 2XDMA 2P74A 3AGEA 1PZOA 2QMIA 4XUZA 5GLBA 3WRZA 3HREA 3G31A 2ZD8A 3IXBA 1ZKJA 5M1AA 5TGFA 3Q81A 1FCNA 3VOYA 5A93A 4S2MA 4OPQA 2Y91A 1GCEA 3I7JA 3VP1A 1G6AA 4IBXA 4S2IA 1KVLA 1SDEA 4UA6A 1JTDA 4OPRA 1O7EA 4GKUA 1MPLA 4WBGA 4JXWA 1XP4A 1QMEA 4GNUA 2A49A 4MNRA 4C75A 1GHIA 3HLBA 4XXRA 3G32A 5FAPA 4X53A 3WWXA 3IWOA 2XF3A 4WEKA 1XPBA 1YQSA 4N9KA 5CRFA 4B88A 4RVAA 4L0LA 3UY6A 1J9MA 4PMAA 4EBLA 3WRTA 3OPHA 5FAOA 4LENA 1MWUA 2BG1A 3OCLA 5EVIB 3NDEA 2IWBA 3UO9A 4RYEA 4U0XA 3VP3A 1PI4A 3M6BA 3DWKA 4P85A 1AXBA 5EVLA 5CGXA 3DTMA 2PU4A 3BYDA 5E2FA 4QB8A 4BD0A 3FKWA 5EUAA 5A92A 3S4XA 1BSGA 3Q7VB 1JVJA 4WM9A 5HX9A 4S2LA 4K91A 1BUEA 4OOLA 2XK1A 2H10A 3BLMA 3Q82A 1ERQA 1HZOA 3SH8A 5CEBA 3HUNA 3N6IA 3ZG8B 3ITBA 3HLDA 1KE0A 4ZDXA 3MFDA 1E3UA 1GA9A 3G34A 3ZNTA 1NZOA 1EROA 1H5XA 4ZTKA 3GTCA 2XD5A 1CEGA 1IYPA 1K55A 3IF6B 1K56D 1CI9A 4E3MA 5D3OA 2WAFA 2WAEA 3MBZA 2ZMAA 4FH2A 3IF6C 2XFTA 2OV5A 4DDYA 4JLFA 5J8XA 5HARA 5FDHA 4DXBA 1DJBA 3VP2A 4KQRA 4QJGA 3OPPA 4MBKA 1I2WA 3IWQA 3OCNA 4NETA 2HDUA 3BM6A 4IVIA 3SH7A 5KSHA 1WYCA 3ZG9B 4EBNA 5FAQA 3PBSA 5CEDA 1ES5A 3HUOA 5GHZA 5FA7A 5AQBA 3TOIA 3OPLA 5L2FA 3A3FA 3ZG7B 4C3QA 1YMSA 1NJ4A 5KMWA 2J9OA 3PBOA 2Y2JA 3VMAA 4LCMA 2HDRA 2EXBA 1JWZA 1VM1A 1IKGA 1K56A 3IWIA 2X02A 5FQQA 5TFQA 4KZ9A 4S2KA 3MKEA 3CZDA 5CXWA 1LLBA 1ES4A 2R9XA 3RJUA 1NRFA 5EOOA 1KGFA 4GDNA 3CG5A 3MZEA 4P87A 3ZG0A 1FCOA 2OLVA 2RL3A 5FATA 1FR1A 4X69A 3C4PA 1PYYA 1L0FA 1RGZA 3MXRA 2H0TA 3OPRA 4DKIA 4OPZA 5CTMA 3P09A 2OSUA 1YT4A 1K4EA 4N1XA 3MZFA 4B4XA 1K57C 1K25A 4Y7PA 5GHXA 4ZJ1A 2ZQ7A 3WS2A 4FH4A 4EQIA 4YINA 3IF6A 4KZ3A 2Y2LA 4ID4A 5DF9A 1IYOA 2Y2OA 3O86A 4JF6A 3CMZA 4E3IA 2EXAA 3G2YA 2I72A 1Y54A 3Q1FA 1E3UD 2WGIA 3ISGA 5EVIA 2Y2HA 1KGGA 1JTGA 4A5RA 2Y2NA 3O87A 3EQVA 4DE3A 1Z6FA 2V2FF 5F82A 3IXDA 5IHVA 5A91A 3PAGA 4OKPA 3Q7VA 4GDBA 3SS3A 5TR7A 2G2UA 5AQ9A 3NI9A 2Y55A 1U60A 3A3IA 4R3BA 2QZ6A 4UHUA 3ZNYA 1HD8A 4MBHA 1IYSA 1TDLA 3BFDA 3ZHHA 4BJPA 1ERMA 4LV3A 2WKIA 3HLGA 1W8YA 1G68A 3JYIA 2Y2PA 5DF8A 4E3NA 5M18A 4BL2A 3W8KA 2ZJ9A 4O7DA 2HP5A 1I5QA 1ESUA 1VQQA 2OLUA 5HAIA 4DDSA 2ZM0A 3HL9A 1YM1A 5CTNA 3CJMA 4F94A 4QY5A 4X55A 1K54A 3C7VA 1ZG6A 4E3LA 2WK0A 3QNCA 1NYYA 2XLNA 3SS5A 3N7WA 4KZBA 1K57A 1S0WA 3C5AA 5JYOA 2DRWA 4X56A 3M6HA 1YLJA 3BFFA 4RX2A 4S2OA 4OQGA 1L0EA 4DE0A 1W8QA 1NXYA 2EFUA 3VFFA 1NY0A 5CHMA 4WYYA 1OMEA 4WZ5C 4C6YA 1TDGA 1FSYA 1TEMA 3OZHA 3BLSA 2ZQCA 2ZQDA 5GHYA 3W4QA 1C3BA 5CERA 4UAAA 5FI2A 4GN2A 5BOHA 3UPNA 3WS0A 3HLEA 4N1HA 5FI6A 1E4DA 1PW1A 4P6BA 2ZLYA 5E2EA 1RCJA 4CJNA 3LEZA 1BLCA 2Y2MA 1L2SA 1BTLA 5DTSA 2Y4AA 1ALQA 2ZC5B 4HESA 1PI5A 4PM7A 1SDNA 2BLSA 1I2SA 1XGIA 3G4PA 4X6TA 4ZJ2A 2XGNA 2XR0A 4WZ4A 1IEMA 1PWDA 2EX6A 5AQAA 5FQ9A 1BLSA 3UN7A 1PZPA 3V5MA 1H8YA 4OH0A 5EE8A 5EECA 2JC7A 3N8SA 1YMXA 3ZDJA 4GD8A 4LV1A 3PBQA 3V50A 1W7FA 1H8ZA 2HDQA 3MXSA 4P0MA 4DE2A 3GMWA 4GD6A 2WZZA 3GQZA 4WEJA 4GB7A 2WGWB 4Y0UA 4HBTA 5AQ7A 5A90A 1KE3A 1HVBA 3G2ZA 1BLPA 3NIAA 2EFXA 2Y59A 2DNSA 5CHUA 5EVID 1FSWA 4OP5A 3VOZA 1TVFA 3EQUA 5GLDA 4R0QA 3E2KA 3BRMA 4WZ5A 3ZGAB 2IWCA 5F1FA 1K6RA 2ZQ9A 3MZDA 4EUZA 4JF5A 1CK3A 4YFMA 1DY6A 3GR2A 4U3TA 4QU3A 1KGEA 4RX3A 1GA0A 4E6XA 1LL5A 4JPMA 3IXGA 2VGJA 3BFEA 3C4OA 3A3EA 3B3XA 2Z2MB 5I94A 2ZM2A 2XD1A 4EBPA 1KE4A 2ZC7A 4X68A 4WMCA 4DXCA 2JBFA 2P9VA 4N9LA 1CEFA 3VSKA 1L0GA 4JKTA 1M6KA 4OP8A 3LY4A 4XUXA 4BQMA 2WGVA 4B4ZA 4E3KA 4E6WA 1KVMA 1HTZA 1MKIA 2Z2LB 4JBFA 1PIOA 3D4FA 5HAQA 1YLPA 4QY6A 4OQIA 3HLFA 1Q2PA 1O07A 5F1GA 3UPPA 1WE4A 1XX2A 2WADA 4EWFA 3IHBA 4Y0OA 3UE3A 2J9PA 2JE5A 2WYXA 3GV9A 4IEDA 4KG6A 1N9BA 4KZ4A 4FSFA 1DJAA 1MWSA 3QHYA 2EX8A 5GLAA 2RCXA 3MKFA 3N8LA 2B5RA 3O88A 4QD4A 1FR6A 1XGJA 4IVKA 1XA7A 4KG2A 5CHJA 3NC8A 1MBLA 4KQQA 4H8RA 3FYZA 4PPRA 1K55C 3P98A 3S22A 4Y0TA 4BENA 4FCFA 2H5SA 5DTTA 2V1ZA 1M40A 3BFGA 4R23A 2J8YA 1BT5A 5HFOA 5FQKA 3IH8A 1MWTA 3N4IA 4KZ7A 4KZAA 3VP0A 1ONHA 4OOMA 5GLCA 1ESIA 2Y2IA 3HLCA 4OOYA 3HUMA 2WKEA 4OQ0A 5M19A 3UDFA 2E8IA 3GRJA 4GZBA 4OQHA 4S2NC 1W79A 3PBTA 3RXWA 3SS4A 4D2OA 4M3KA 5FQIA 3IH9A 3VP4A 5DTKA 1DJCA 2A3UA 3BECA 4KZ8A 1Q2QA 4BD1A 2ZM8A 5EOEA 2EX9A 4MEZA 1XXMA 1IELA 4LV0A 3UNWA 2EX2A 3LO7A 3HLWA 5GL9A 3V39A 2FFFB 5HAPA 4OONA 3C7UA 2XQZA 1E25A 3W4PA 4R1GA 1JWPA 5HL1A 2HPBA 2CC1A
chains in the Genus database with same CATH superfamily
2R78A 3GVBA 1GHMA 4UEYA 4UA9A 2M1CA 3T4OA 1XFNA 5HDSA 1YLTA 5JYPA 3HVFA 5CGSA 2WKQA 4UA7A 4JXGA 3G30A 1UWNX 2FFYA 1NZUA 2WUQA 1OTIA 3LCEA 2R9WA 2UWXA 2WZXA 1KDSA 4DMZA 1BLHA 4KQOA 3AGDA 1VEUA 3FG8A 5KZHA 5U47A 3FKVA 4O0PA 1K6SA 5HDDA 3IF5A 2VX8A 2A2LA 2P9VB 1IOUA 4R3JA 5FSRA 4CLCC 4PM6A 2BASA 4HEFA 1LI9A 4OLGA 4R4SA 3E2LA 1LSXA 1A0KA 4JXSA 4Z9QA 4K0XA 2HJEA 4E3JA 3HBRA 3AGFA 4ARZB 1ZC2A 1P9RA 2WGWA 3ZFZA 1ES3A 1G6OA 4Q0JA 1OTAA 5EFWA 4HQAA 3LICA 1IYQA 2X01A 4PM8A 3LIFA 4K0WA 3DW0A 3NY4A 5DVAA 5HW3A 1K4FA 4I5SA 4EW7A 1S67L 3SOIA 5DKLA 1XJ2A 1YKDA 3L7HA 4CLCA 1LT0A 1SHVA 1SCWA 3CI6A 3F1OA 3Q7ZA 3E98A 1SKFA 2W0NA 1XFQA 5EV0A 4LV2A 3ITAA 3QNBA 1JWVA 2CMNA 1W5DA 3EEHA 4I3IA 4HIAA 1ZKJA 5A93A 2E8JA 4FTXA 3I7JA 1G6AA 3ICYA 4IBXA 3T1QB 1V9YA 4CQHA 1O7EA 1MPLA 4WBGA 2VA0A 3UB9A 2A49A 3H82A 4MNRA 4HP9A 2VZWA 4R3AA 4WEKA 3EOIA 4N9KA 4RVAA 4XT2A 4EBLA 5FAOA 2O99A 2IWBA 5LBRA 3VP3A 1PI4A 4B93A 5EVLA 5CGXA 2HZ5A 3R7WB 4BD0A 3UB6A 2XROA 4WM9A 2XSSA 2XK1A 4ESPA 2H10A 4WL9A 3Q82A 1HZOA 4BBUA 3ZG8B 1KE0A 1GA9A 1H5XA 4ZTKA 2XD5A 1CEGA 1NWZA 1LSWA 5G4YA 1SZVA 5D3OA 3D9YA 1P97A 2ZMAA 4FH2A 5J8XA 5HARA 4DXBA 4Q0IA 5L8MA 1I2WA 4BMWA 3IWQA 3OCNA 3QP2A 4LRZE 1WYCA 3ZG9B 4EBNA 5FAQA 2PT7A 5GHZA 5G4ZA 4HNBA 3ZG7B 3BY8A 4KZ9A 1T1AA 4S2KA 3MKEA 1SKOB 2QYBA 1LLBA 3KYZA 3FC7A 2RL3A 3KYQA 1YPRA 5FATA 3S7OA 5AJGA 1TS7A 3C4PA 4Y17A 2XRNA 3MXRA 2H0TA 2VV8A 5F6AA 3P09A 1VETA 3EEAA 4ZJ1A 1K25A 4EQIA 2ACGA 3CMZA 2EXAA 4E3IA 1E3UD 3CPTA 3ISGA 3NHQA 5EVIA 3A0VA 3EQVA 5HD3A 5A91A 1T1BA 3Q7VA 3LIDA 3SS3A 2WKRA 5TR7A 2G2UA 3NI9A 1U60A 2H28A 2QZ6A 3ZNYA 2EWVA 4MBHA 1IYSA 4BJPA 4CLCB 1ERMA 1W8YA 1T1CA 5C5KA 2ZJ9A 3TW8A 1I5QA 2OLUA 5CTNA 4F94A 1ZG6A 3LR5A 5K5BA 4E3LA 2WK0A 2XLNA 3N7WA 4KZBA 1VETB 1S0WA 4X56A 3M6HA 1YLJA 1NY0A 5J4EA 3TE8A 1CQAA 4WZ5C 2V1AA 4C6YA 3LR0A 3PHYA 1TDGA 3C8CA 3BLSA 2ZQDA 5CX7A 4LPZA 5BOHA 2ZLYA 5E2EA 2I9VA 2ZC5B 3SW1A 4X6TA 1XGIA 3G4PA 2XGNA 3QP6A 2M7UA 1PWDA 4Y15A 1FILA 5EE8A 2JC7A 3N8SA 1J3WA 1W7FA 1H8ZA 2HDQA 2HJ9C 2PHYA 4GB7A 3E4OA 2Y59A 5EVID 3VOZA 1TVFA 3EQUA 2FH5A 2J80A 4R0QA 3E2KA 3LYXA 4WZ5A 2IWCA 5F1FA 1CK3A 1XJ3A 3T4JA 1KGEA 4E6XA 1OTBA 4RQ9A 5L10A 4KQDA 3JVUA 3B3XA 2B95A 1KE4A 4X68A 2JBFA 2P9VA 2JKFA 1L3LA 4JKTA 1S66L 1MZUA 4IUHA 1OJ5A 1XJ6A 1MKIA 2JHEA 3MXQA 3GDIA 5HWVA 5F1GA 4EWFA 3IHBA 3UE3A 2ZOIA 3KSFA 4FSFA 1DJAA 3DTKA 2JKRM 5FEFA 3UMDA 3O88A 5CHJA 4Y2FA 2H5SA 1BT5A 4OOMA 3IBRA 5M19A 2E8IA 3KSHA 1W79A 4M3KA 5DTKA 2A3UA 4KZ8A 3BECA 2ZM8A 2EX9A 3C2WA 2V0UA 3F1NB 4LV0A 3HLWA 4MN6A 1E25A 4R1GA 5DF8A 2HPBA 4GW9A 5E43A 2Z6CA 2ZC3B 3M2JA 5E2GA 2BTFP 1DP8A 2QPNA 1IFQA 2HP6A 1FOFA 3FWLA 4L9GA 3ZVWA 1UGUA 1FCMA 5F83A 5FASA 2PBYA 2V9AA 4BBTA 4Y3IA 2ZL1B 1RGYA 3MJQA 2W3DA 2HP9A 2Y2KA 3V3SA 1ES2A 4KZ6A 3S7NA 3IHAA 1BZAA 2Q9NA 3KSIA 3VSLA 1CF0A 3LY3A 3PYPA 3KSGA 1RP5A 3V67A 5EVIC 1K38A 4KENB 4Q8IA 2HV1A 1PWGA 4GOGA 1YLWA 4LCLA 1P0ZA 3NDGA 3F1NA 3QP4A 3UE1A 3A0RA 4BL3A 4BLMA 2Q9MA 4Y13A 4NEED 1L0DA 1OPXA 4JF4A 4YOFA 4HOIA 2B02A 5J3WA 1LL9A 4ZAMA 2JCHA 4WMCD 1VEUB 1YLYA 1K54C 1S6RA 1CI8A 5F68A 3BFCA 4KG5A 4HJ6A 4E3OA 1YAXA 4CPKA 3PAEA 2J7VA 2XEPA 4OLDA 3OC2A 3NCKA 1PWCA 4LLOB 4WELA 3TG9A 2W1RA 2C6WB 2ZQAA 3MR0A 3G6OA 4EUVA 1OTEA 2Y79A 4I3AA 5FI7A 2M7VA 2P74A 3G31A 2ZD8A 3Q81A 1FCNA 2P04A 1KVLA 4I38A 1JTDA 4JGRA 1ODVA 3LIAA 2QKPA 2XF3A 1NRJA 5CRFA 4B88A 4PMAA 3OPHA 1MWUA 4WUJA 3OCLA 1AWIA 2QHKA 3NJAA 1K0KA 1V9ZA 4P85A 2W3FA 4QB8A 4K08A 4GHIB 1WA9A 3Q7VB 1EW0A 3IX8A 5HX9A 4K91A 2PAVP 1ERQA 3SH8A 2VV6A 3MFDA 3G34A 1EROA 4ETZA 3GTCA 1IYPA 3IF6B 1K56D 1CI9A 2WAFA 2FZ0A 3IF6C 5FDHA 3DBAA 1OT6A 4NETA 4CLCE 3F1PA 4IVIA 3CWFA 4HI4A 5KIZA 4ZRRA 5FA7A 2P7JA 5AQBA 4Q0HA 5HD5A 3OPLA 3TOIA 5KMWA 2V8CA 3VMAA 4LCMA 2EXBA 1JWZA 1VM1A 5FQQA 3T50A 5TFQA 2B18A 3OBFA 1ES4A 1KGFA 4GDNA 3CG5A 2OLVA 1PYYA 1L0FA 1RGZA 4OPZA 1K4EA 4B4XA 3IX3A 4Y7PA 3WS2A 3MQOA 4YINA 3IF6A 4JF6A 3G2YA 1Y54A 3Q1FA 5DJUA 3CITA 4YWZA 2Y2HA 3DTEA 2Y2NA 3ZYTA 2A24A 4KUOA 1GSVA 2XA7M 4GDBA 5AQ9A 3LI9A 4JGPA 3KO6A 3JYIA 3LI8A 4O7DA 3VE3A 4DDSA 1YM1A 2VK3A 1K54A 5TJJA 4L9EA 2JN7A 2GX5A 2O9AA 3C5AA 4LFUA 3CAXA 1L0EA 4DE0A 3VFFA 5CHMA 1OMEA 1PNEA 4QWOA 2ZQCA 1G5UA 3KYEA 4FOFA 4N1HA 2VKSA 4P6BA 3LIBA 4R38A 3MF0A 4CJNA 3LEZA 5A8BA 1BLCA 2XR0A 4HJ3A 5FQ9A 1BLSA 3UN7A 3V5MA 3ZDJA 2W3GA 4LV1A 1F9IA 3MXSA 4P0MA 3LR4A 4GD6A 5A90A 4HBTA 2EFXA 3MFXA 4EESA 1FSWA 2PR5A 2Y8HA 4G3WA 5EM1A 3ZGAB 4GCZA 4JF5A 3GR2A 4U3TA 3MMHA 4EXOA 1GA0A 1YSQA 2VGJA 3BFEA 1LL8A 4GS9A 1DRMA 3NECA 2JKGA 2ZC7A 4WMCA 4X1LA 1L0GA 1M6KA 3CHWP 4XUXA 3KX0X 4II7A 4B4ZA 4E3KA 1SKOA 1T19A 2J3TD 1PIOA 4XT2B 3RH8B 5HAQA 4QY6A 4O8GA 3UPPA 2WADA 3NOTC 3DTIA 2J9PA 2JE5A 4IEDA 3GV9A 4KZ4A 1MKMA 3QHYA 2EX8A 3MKFA 3N8LA 2B5RA 4QD4A 1FR6A 3E0YA 5F69A 4NXBA 1MBLA 4P6ZM 4LRYC 3FYZA 4Y5FA 3P98A 2O0YA 2J8YA 2QWSA 5HFOA 3N4IA 3VP0A 5HSQA 1ONHA 3T12B 2Y2IA 1ZHHB 3HUMA 3A0SA 2WKEA 4DN0A 3UDFA 3GRJA 4GZBA 4S2NC 3K2NA 3PBTA 5FQIA 4BD1A 1DJCA 2XQZA 2CC1A 1X0OA 3WS5A 4S2PA 4IBRA 2IWDA 3N8RA 1EWZA 3IT9A 2V20A 4GLQA 4QHCA 3T1RA 1H0MA 4FD8A 1P9WA 4PAUA 3UE0A 2L0WA 2PU2A 4I3JA 2PRFA 2ZC4B 3HJIA 2G2WA 3Q07A 1NYMA 3UDXA 4EEUA 2H0YA 2VEAA 3O3VA 2HDSA 3CLOA 5F5YA 1QMFA 2J3WA 3LEQA 3BQ8A 2C5WB 2VGKA 2ZMVA 1KOUA 2DMWA 4S2NA 3ZCZA 4JGOA 3H7WA 1YLZA 2UV0E 4GS9B 3HCYA 2VLGA 5FQMA 3P01A 3UPOA 3PBNA 2Y2QA 3B47A 1PW8A 3SZTA 4EERA 2MJ6A 1VHMA 3TSGA 3SH9A 3M2KA 2ZC6B 5EPHA 1ZG4A 5J7EA 2K7SA 1TF1A 4NKPA 1FQGA 3VFHA 2PD7A 2OAP1 2Y2GA 3IX4A 4G3VA 2W3EA 2WKHA 3IXHA 1UWPX 3WS1A 2PD8A 3ZVTA 5KSCA 5G18A 3E4QA 3S7PA 3A3DA 4IJGA 4ZJ3A 1NLYA 1KDWA 3PTEA 3FZCA 4NK3A 3CUEA 4DE1A 2X71A 5E2HA 2PYRA 3CPTB 3AGEA 1PZOA 2ZL1A 3U2AA 5TGFA 3VOYA 4F3LA 4S2IA 3T4LA 5IT5A 4OPRA 1FIKA 4GKUA 1XP4A 4ARZA 5MC7A 3D3OA 3UE6A 4C75A 2KOIA 3HLBA 5DKKA 3G32A 5FAPA 4X53A 1DP9A 2GJ3A 1YQSA 3BY9A 4L0LA 1J9MA 1H3QA 2BG1A 3T1XA 3UO9A 4RYEA 2L1MA 4U0XA 3DTMA 3RTYA 2OOLA 3BYDA 5E2FA 4BWIA 1PRQA 2L4RA 5TBMB 4PKYA 2HF6A 4S2LA 1BUEA 4OOLA 5CEBA 3N6IA 3ITBA 2D02A 4ZDXA 1E3UA 3ZNTA 1S1ZA 5FEGA 2G7UA 3MBZA 2W27A 2OV5A 1DJBA 4KQRA 5HPFA 1GSXA 4MBKA 2HDUA 3SH7A 5KSHA 5HWTA 3PBSA 3VE4A 4WF0A 1ES5A 3HUOA 4GJ4A 1S4RA 3QP5A 4HJ4A 2Y2JA 2A24B 1DP6A 3IWIA 1IKGA 1K56A 3RJUA 2R9XA 5EOOA 4HHDA 3NOPC 3ZQ5A 5HPIA 3MZEA 3R4KA 3ZG0A 4X69A 2ZBBA 4DKIA 5CTMA 4IUKA 4LRXC 3OLOA 2ZQ7A 5DF9A 3O86A 2Y2OA 5IU1A 2WGIA 1G28A 4X25A 4E04A 3O87A 1Z6FA 2V2FF 5F82A 3IXDA 5IHVA 2Y55A 3A3IA 4R3BA 4UHUA 1TDLA 3BFDA 3ZHHA 4LV3A 2WKIA 2Y2PA 4E3NA 4BL2A 3W8KA 1W63M 1ESUA 1VQQA 5HAIA 3CJMA 3BJNA 4WLAA 4X55A 3QNCA 1F98A 3SS5A 3TRCA 4EU0A 3BFFA 4ME4A 4S2OA 4OQGA 3IS2B 3BWLA 2YKHA 1TEMA 3UB7A 4F3LB 1C3BA 5CERA 4UAAA 4MN5A 4GN2A 3B42A 3WS0A 3HLEA 1E4DA 1VB6A 3GECA 3H9WA 2Y2MA 2Q0OA 1ACFA 1BTLA 3CUEC 2Y4AA 4HESA 5DTSA 1LSVA 1SDNA 1I2SA 2GNXA 1XJ4A 4ZJ2A 4WZ4A 1IEMA 3OOVA 2EX6A 3H7WB 5AQAA 1H8YA 3P7NA 3GMWA 3GQZA 4Y0UA 2WGWB 5DFYA 3UB5P 3ULFA 3G2ZA 4R6LA 4R70A 5CHUA 3LFVA 1K6RA 2ZQ9A 3MQQA 4EEPA 4EUZA 4YFMA 1DY6A 3PR6A 4QU3A 4RX3A 1LL5A 3K3DA 3UMEA 4DJ2A 3A3EA 2Z2MB 2ZM2A 1CEFA 3VSKA 4OP8A 4BQMA 3F1OB 1TS0A 2Z2LB 4JBFA 3D4FA 1YLPA 2QJ7A 1Q2PA 5DJTA 1O07A 4UQIS 2NUTC 4Y0OA 1N9BA 3H82B 1MWSA 3BW6A 2RCXA 5I5LA 1XA7A 4KG2A 3NC8A 4H8RA 5HL6A 2W3HA 3TJZC 1M40A 1H8MA 3T4SA 5FQKA 4KZ7A 1MWTA 4KZAA 3HLCA 4OOYA 3NOUC 1CJFA 4D2OA 3RXWA 2KDKA 3DAVA 5EOEA 4MEZA 4DJ3A 1N9OA 3UNWA 5GL9A 5HAPA 3VOLA 4JGQA 4BBVA 5AVFA 4I39A 1JWPA 1OJGA 3WWXA 1IKIA 1TS6A 3GSGA 3EGXC 1MWRA 4P6ZS 1LHYA 3MS6A 5DF7A 4PM9A 2GDNA 4HBUA 3BQAA 1MY8A 1MXOA 4PM5A 2DCFA 3W4OA 4RA7A 4R4RA 5HWWA 4S2JA 1D06A 3RXXA 2ZMFA 1Y4OA 1LI0A 1EI5A 2JKTM 4LGWA 3VV4A 3S7QA 3V3RA 1OT9A 4EV4A 1BULA 1WYBA 3U4LP 3ZG5A 2VJWA 3LGOA 4N92A 4EQ1A 4M4XA 1F2KA 3O5YA 3WS4A 1ONGA 3QP8A 3EGDC 4JXVA 4X1MA 3BEBA 1PFLA 4MLLA 1XA1A 2V0WA 4Z1WA 1GHPA 3S1YA 3UDIA 2OWJA 3A3JA 5FL3A 1N4OA 2VV7A 3NBLA 3G35A 2Z6DA 1YSPA 5CECA 3FV7A 4HP4A 1S4SA 2AVXA 2XFSA 1HLUP 1TS8A 3T1SA 5L07A 3IQAA 4KZ5A 3DWZA 4OVDA 2ZQ8A 4ZBEA 2D01A 4DRTA 3PBRA 4MBFA 5CGWA 5FQJA 3C30A 1XKZA 4DF6A 4OPYA 2PBDP 2XH9A 4U0TA 2PDRA 2XDMA 2QMIA 2QJ5A 2INWA 4XUZA 5GLBA 3WRZA 3HREA 3IXBA 3IBJA 5M1AA 4S2MA 4OPQA 3EWKA 2Y91A 3LUQA 1GCEA 3VP1A 1SDEA 4UA6A 4IHQA 4H6JA 4JXWA 4GNUA 1QMEA 1GHIA 4XXRA 3IWOA 4B9OA 1XPBA 3B33A 4HH3A 3UY6A 1D7EA 3WRTA 4LENA 2IA2A 5EVIB 3NDEA 2W1TB 3M6BA 2OWHA 2LB5A 3DWKA 1AXBA 4ETXA 2PU4A 4EETB 3FKWA 5EUAA 5IS1A 5A92A 3S4XA 4QPRA 1BSGA 1JVJA 3BLMA 3HUNA 1BYWA 3HLDA 4NXFA 5L09A 1NZOA 4MCWA 2O9CA 2KLIA 3T4TA 1K55A 4E3MA 2WAEA 4DDYA 2XFTA 4JLFA 4QJGA 3OPPA 1F5MA 5TBMA 3BM6A 4O01A 2VGLM 2JKTI 3R7WA 5HZHA 5CEDA 5L2FA 4MMNA 3HJKA 3A3FA 1ZTUA 4C3QA 1YMSA 1NJ4A 2J9OA 3PBOA 2HDRA 2X02A 3CZDA 5CXWA 3E4PA 1NRFA 1W63Q 1S1YA 4P87A 1FCOA 2J3TC 4CLCD 1FR1A 2XA7S 2WKPA 3OPRA 2OSUA 1YT4A 4N1XA 3MZFA 4GHIA 4D60A 3QP1A 1K57C 5GHXA 4FH4A 1Z09A 3VP2A 4KZ3A 2Y2LA 4ID4A 1IYOA 2I72A 2O9BA 1KGGA 4MDZA 1JTGA 4A5RA 4DE3A 3PAGA 2YKFA 4OKPA 3MQ0A 3UB8A 1TD5A 4G3KA 1HD8A 3F1PB 3HLGA 2ZOHA 3FPWA 1G68A 2W1TA 4NG2A 3NULA 5M18A 4YNRA 2HP5A 1OTDA 3W2ZA 3MSHA 2GZAA 2ZM0A 3HL9A 2HGVA 3RFBA 4QY5A 3C7VA 3L9KA 5EM0A 2PR6A 4PHTA 1STZA 2JKRI 1NYYA 4WN5A 2EA9A 1K57A 5JYOA 2DRWA 4RX2A 3K3CA 1W8QA 1NXYA 2EFUA 1N9NA 1N9LA 4WYYA 4L9FA 2V1BA 1FSYA 5AVEA 3OZHA 5GHYA 3W4QA 2VGLS 2OAQ1 5FI2A 3UPNA 5FI6A 1PW1A 1RCJA 3JPUA 2P08A 5FDSA 1L2SA 4AFIA 1ALQA 1PI5A 4PM7A 2BLSA 4MN7A 2KX6A 5EVEA 1PZPA 4OH0A 5EECA 1YMXA 3LIEA 4GD8A 3PBQA 3V50A 3JVVA 4DE2A 2WZZA 4H6JB 4NXGA 4WEJA 3IS2A 5AQ7A 1Y28A 5HDCA 1KE3A 1HVBA 3D72A 1BLPA 3NIAA 2DNSA 1GSWA 4OP5A 1MC0A 2NUPC 5GLDA 3BRMA 3FPVA 3MZDA 1D1JA 1JNUA 1NLZA 2K2NA 3T4KA 2K31A 4JPMA 3IXGA 3C4OA 5I94A 2XD1A 4EBPA 3PXPA 4DXCA 4N9LA 2EWWA 3LY4A 4UQIM 2WGVA 4E6WA 4KUKA 1KVMA 1HTZA 3LR3A 2LB9A 4OQIA 3HLFA 1T18A 1WE4A 1XX2A 3C38A 4PKYG 2WYXA 4KG6A 3T4QA 5GLAA 1XGJA 4IVKA 4HH2A 4KQQA 4PPRA 1K55C 2PYPA 5DFXA 3S22A 4Y0TA 4BENA 4FCFA 5DTTA 2V1ZA 3BFGA 4R23A 2V8FA 3IH8A 5GLCA 1ESIA 4OQ0A 3SS4A 4OQHA 3IH9A 3VP4A 1Q2QA 1XXMA 4NXEA 1IELA 4FUWA 2EX2A 3LO7A 3V39A 2FFFB 4OONA 3C7UA 3W4PA 5HL1A 4HY8A
chains in the Genus database with same CATH topology
1IKIA 3GVBA 1GHMA 4S2PA 4IBRA 2ZC3B 5E43A 2IWDA 3M2JA 3N8RA 1EWZA 3GSGA 5E2GA 1MWRA 4UA9A 2QPNA 3IT9A 2V20A 4QHCA 1LHYA 4FD8A 1YLTA 5DF7A 5JYPA 2HP6A 3UE0A 1FOFA 2GDNA 2PU2A 3FWLA 3HVFA 2ZC4B 4HBUA 4PM9A 5CGSA 1FCMA 4UA7A 5F83A 3ZVWA 5FASA 2PBYA 2G2WA 1MY8A 3Q07A 1MXOA 1NYMA 4JXGA 3G30A 3UDXA 4PM5A 2DCFA 3W4OA 2H0YA 2FFYA 1NZUA 1RGYA 3O3VA 4RA7A 2WUQA 2HP9A 2HDSA 2Y2KA 3LCEA 1ES2A 4R4RA 3V3SA 4KZ6A 2R9WA 2UWXA 2WZXA 3IHAA 1KDSA 1BLHA 1BZAA 1QMFA 2Q9NA 3AGDA 4KQOA 4S2JA 3VSLA 3LY3A 3RXXA 5KZHA 5U47A 3FKVA 2C5WB 1RP5A 2VGKA 3WS5A 1LI0A 4S2NA 1EI5A 5EVIC 1K6SA 3ZCZA 3IF5A 3V3RA 4EV4A 1K38A 4KENB 1YLZA 2P9VB 1BULA 1WYBA 4Q8IA 4R3JA 5FSRA 4PM6A 3ZG5A 4HEFA 1LI9A 1PWGA 5FQMA 4N92A 4OLGA 4GOGA 1YLWA 4R4SA 4LCLA 3E2LA 3NDGA 3UE1A 4BL3A 4BLMA 3WS4A 2Q9MA 3UPOA 1ONGA 3PBNA 4JXSA 4Z9QA 4K0XA 2Y2QA 4JXVA 4E3JA 3HBRA 3BEBA 4MLLA 1PW8A 3AGFA 1L0DA 4JF4A 3TSGA 3SH9A 3M2KA 2ZC6B 1XA1A 1ZC2A 1LL9A 2WGWA 5EPHA 4ZAMA 2JCHA 4WMCD 1GHPA 1ES3A 3ZFZA 3S1YA 1ZG4A 1YLYA 3UDIA 1K54C 1S6RA 1FQGA 3A3JA 3VFHA 1N4OA 1CI8A 3NBLA 3G35A 5CECA 3BFCA 3FV7A 2Y2GA 4KG5A 1IYQA 2X01A 4PM8A 4K0WA 2XFSA 2WKHA 3IXHA 3DW0A 3NY4A 5DVAA 3WS1A 5HW3A 1K4FA 3ZVTA 5KSCA 5G18A 4E3OA 4CPKA 3SOIA 3PAEA 2J7VA 3IQAA 2XEPA 4KZ5A 4OLDA 3DWZA 3A3DA 3OC2A 1SHVA 3NCKA 4OVDA 1PWCA 2ZQ8A 1SCWA 4ZBEA 4WELA 4ZJ3A 1KDWA 3TG9A 4DRTA 3PBRA 3PTEA 2C6WB 3Q7ZA 3FZCA 4NK3A 4MBFA 5CGWA 2ZQAA 5FQJA 4DE1A 2X71A 5E2HA 1SKFA 1XKZA 4DF6A 4OPYA 2XH9A 4LV2A 4U0TA 3ITAA 3QNBA 1JWVA 5FI7A 1W5DA 2XDMA 2P74A 3AGEA 1PZOA 2QMIA 4XUZA 5GLBA 3WRZA 3HREA 3G31A 2ZD8A 3IXBA 1ZKJA 5M1AA 5TGFA 3Q81A 1FCNA 3VOYA 5A93A 4S2MA 4OPQA 2Y91A 1GCEA 3I7JA 3VP1A 1G6AA 4IBXA 4S2IA 1KVLA 1SDEA 4UA6A 1JTDA 4OPRA 1O7EA 4GKUA 1MPLA 4WBGA 4JXWA 1XP4A 1QMEA 4GNUA 2A49A 4MNRA 4C75A 1GHIA 3HLBA 4XXRA 3G32A 5FAPA 4X53A 3WWXA 3IWOA 2XF3A 4WEKA 1XPBA 1YQSA 4N9KA 5CRFA 4B88A 4RVAA 4L0LA 3UY6A 1J9MA 4PMAA 4EBLA 3WRTA 3OPHA 5FAOA 4LENA 1MWUA 2BG1A 3OCLA 5EVIB 3NDEA 2IWBA 3UO9A 4RYEA 4U0XA 3VP3A 1PI4A 3M6BA 3DWKA 4P85A 1AXBA 5EVLA 5CGXA 3DTMA 2PU4A 3BYDA 5E2FA 4QB8A 4BD0A 3FKWA 5EUAA 5A92A 3S4XA 1BSGA 3Q7VB 1JVJA 4WM9A 5HX9A 4S2LA 4K91A 1BUEA 4OOLA 2XK1A 2H10A 3BLMA 3Q82A 1ERQA 1HZOA 3SH8A 5CEBA 3HUNA 3N6IA 3ZG8B 3ITBA 3HLDA 1KE0A 4ZDXA 3MFDA 1E3UA 1GA9A 3G34A 3ZNTA 1NZOA 1EROA 1H5XA 4ZTKA 3GTCA 2XD5A 1CEGA 1IYPA 1K55A 3IF6B 1K56D 1CI9A 4E3MA 5D3OA 2WAFA 2WAEA 3MBZA 2ZMAA 4FH2A 3IF6C 2XFTA 2OV5A 4DDYA 4JLFA 5J8XA 5HARA 5FDHA 4DXBA 1DJBA 3VP2A 4KQRA 4QJGA 3OPPA 4MBKA 1I2WA 3IWQA 3OCNA 4NETA 2HDUA 3BM6A 4IVIA 3SH7A 5KSHA 1WYCA 3ZG9B 4EBNA 5FAQA 3PBSA 5CEDA 1ES5A 3HUOA 5GHZA 5FA7A 5AQBA 3TOIA 3OPLA 5L2FA 3A3FA 3ZG7B 4C3QA 1YMSA 1NJ4A 5KMWA 2J9OA 3PBOA 2Y2JA 3VMAA 4LCMA 2HDRA 2EXBA 1JWZA 1VM1A 1IKGA 1K56A 3IWIA 2X02A 5FQQA 5TFQA 4KZ9A 4S2KA 3MKEA 3CZDA 5CXWA 1LLBA 1ES4A 2R9XA 3RJUA 1NRFA 5EOOA 1KGFA 4GDNA 3CG5A 3MZEA 4P87A 3ZG0A 1FCOA 2OLVA 2RL3A 5FATA 1FR1A 4X69A 3C4PA 1PYYA 1L0FA 1RGZA 3MXRA 2H0TA 3OPRA 4DKIA 4OPZA 5CTMA 3P09A 2OSUA 1YT4A 1K4EA 4N1XA 3MZFA 4B4XA 1K57C 1K25A 4Y7PA 5GHXA 4ZJ1A 2ZQ7A 3WS2A 4FH4A 4EQIA 4YINA 3IF6A 4KZ3A 2Y2LA 4ID4A 5DF9A 1IYOA 2Y2OA 3O86A 4JF6A 3CMZA 4E3IA 2EXAA 3G2YA 2I72A 1Y54A 3Q1FA 1E3UD 2WGIA 3ISGA 5EVIA 2Y2HA 1KGGA 1JTGA 4A5RA 2Y2NA 3O87A 3EQVA 4DE3A 1Z6FA 2V2FF 5F82A 3IXDA 5IHVA 5A91A 3PAGA 4OKPA 3Q7VA 4GDBA 3SS3A 5TR7A 2G2UA 5AQ9A 3NI9A 2Y55A 1U60A 3A3IA 4R3BA 2QZ6A 4UHUA 3ZNYA 1HD8A 4MBHA 1IYSA 1TDLA 3BFDA 3ZHHA 4BJPA 1ERMA 4LV3A 2WKIA 3HLGA 1W8YA 1G68A 3JYIA 2Y2PA 5DF8A 4E3NA 5M18A 4BL2A 3W8KA 2ZJ9A 4O7DA 2HP5A 1I5QA 1ESUA 1VQQA 2OLUA 5HAIA 4DDSA 2ZM0A 3HL9A 1YM1A 5CTNA 3CJMA 4F94A 4QY5A 4X55A 1K54A 3C7VA 1ZG6A 4E3LA 2WK0A 3QNCA 1NYYA 2XLNA 3SS5A 3N7WA 4KZBA 1K57A 1S0WA 3C5AA 5JYOA 2DRWA 4X56A 3M6HA 1YLJA 3BFFA 4RX2A 4S2OA 4OQGA 1L0EA 4DE0A 1W8QA 1NXYA 2EFUA 3VFFA 1NY0A 5CHMA 4WYYA 1OMEA 4WZ5C 4C6YA 1TDGA 1FSYA 1TEMA 3OZHA 3BLSA 2ZQCA 2ZQDA 5GHYA 3W4QA 1C3BA 5CERA 4UAAA 5FI2A 4GN2A 5BOHA 3UPNA 3WS0A 3HLEA 4N1HA 5FI6A 1E4DA 1PW1A 4P6BA 2ZLYA 5E2EA 1RCJA 4CJNA 3LEZA 1BLCA 2Y2MA 1L2SA 1BTLA 5DTSA 2Y4AA 1ALQA 2ZC5B 4HESA 1PI5A 4PM7A 1SDNA 2BLSA 1I2SA 1XGIA 3G4PA 4X6TA 4ZJ2A 2XGNA 2XR0A 4WZ4A 1IEMA 1PWDA 2EX6A 5AQAA 5FQ9A 1BLSA 3UN7A 1PZPA 3V5MA 1H8YA 4OH0A 5EE8A 5EECA 2JC7A 3N8SA 1YMXA 3ZDJA 4GD8A 4LV1A 3PBQA 3V50A 1W7FA 1H8ZA 2HDQA 3MXSA 4P0MA 4DE2A 3GMWA 4GD6A 2WZZA 3GQZA 4WEJA 4GB7A 2WGWB 4Y0UA 4HBTA 5AQ7A 5A90A 1KE3A 1HVBA 3G2ZA 1BLPA 3NIAA 2EFXA 2Y59A 2DNSA 5CHUA 5EVID 1FSWA 4OP5A 3VOZA 1TVFA 3EQUA 5GLDA 4R0QA 3E2KA 3BRMA 4WZ5A 3ZGAB 2IWCA 5F1FA 1K6RA 2ZQ9A 3MZDA 4EUZA 4JF5A 1CK3A 4YFMA 1DY6A 3GR2A 4U3TA 4QU3A 1KGEA 4RX3A 1GA0A 4E6XA 1LL5A 4JPMA 3IXGA 2VGJA 3BFEA 3C4OA 3A3EA 3B3XA 2Z2MB 5I94A 2ZM2A 2XD1A 4EBPA 1KE4A 2ZC7A 4X68A 4WMCA 4DXCA 2JBFA 2P9VA 4N9LA 1CEFA 3VSKA 1L0GA 4JKTA 1M6KA 4OP8A 3LY4A 4XUXA 4BQMA 2WGVA 4B4ZA 4E3KA 4E6WA 1KVMA 1HTZA 1MKIA 2Z2LB 4JBFA 1PIOA 3D4FA 5HAQA 1YLPA 4QY6A 4OQIA 3HLFA 1Q2PA 1O07A 5F1GA 3UPPA 1WE4A 1XX2A 2WADA 4EWFA 3IHBA 4Y0OA 3UE3A 2J9PA 2JE5A 2WYXA 3GV9A 4IEDA 4KG6A 1N9BA 4KZ4A 4FSFA 1DJAA 1MWSA 3QHYA 2EX8A 5GLAA 2RCXA 3MKFA 3N8LA 2B5RA 3O88A 4QD4A 1FR6A 1XGJA 4IVKA 1XA7A 4KG2A 5CHJA 3NC8A 1MBLA 4KQQA 4H8RA 3FYZA 4PPRA 1K55C 3P98A 3S22A 4Y0TA 4BENA 4FCFA 2H5SA 5DTTA 2V1ZA 1M40A 3BFGA 4R23A 2J8YA 1BT5A 5HFOA 5FQKA 3IH8A 1MWTA 3N4IA 4KZ7A 4KZAA 3VP0A 1ONHA 4OOMA 5GLCA 1ESIA 2Y2IA 3HLCA 4OOYA 3HUMA 2WKEA 4OQ0A 5M19A 3UDFA 2E8IA 3GRJA 4GZBA 4OQHA 4S2NC 1W79A 3PBTA 3RXWA 3SS4A 4D2OA 4M3KA 5FQIA 3IH9A 3VP4A 5DTKA 1DJCA 2A3UA 3BECA 4KZ8A 1Q2QA 4BD1A 2ZM8A 5EOEA 2EX9A 4MEZA 1XXMA 1IELA 4LV0A 3UNWA 2EX2A 3LO7A 3HLWA 5GL9A 3V39A 2FFFB 5HAPA 4OONA 3C7UA 2XQZA 1E25A 3W4PA 4R1GA 1JWPA 5HL1A 2HPBA 2CC1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IKI A;  3GVB A;  1GHM A;  4S2P A;  4IBR A;  2ZC3 B;  5E43 A;  2IWD A;  3M2J A;  3N8R A;  1EWZ A;  3GSG A;  5E2G A;  1MWR A;  4UA9 A;  2QPN A;  3IT9 A;  2V20 A;  4QHC A;  1LHY A;  4FD8 A;  1YLT A;  5DF7 A;  5JYP A;  2HP6 A;  3UE0 A;  1FOF A;  2GDN A;  2PU2 A;  3FWL A;  3HVF A;  2ZC4 B;  4HBU A;  4PM9 A;  5CGS A;  1FCM A;  4UA7 A;  5F83 A;  3ZVW A;  5FAS A;  2PBY A;  2G2W A;  1MY8 A;  3Q07 A;  1MXO A;  1NYM A;  4JXG A;  3G30 A;  3UDX A;  4PM5 A;  2DCF A;  3W4O A;  2H0Y A;  2FFY A;  1NZU A;  1RGY A;  3O3V A;  4RA7 A;  2WUQ A;  2HP9 A;  2HDS A;  2Y2K A;  3LCE A;  1ES2 A;  4R4R A;  3V3S A;  4KZ6 A;  2R9W A;  2UWX A;  2WZX A;  3IHA A;  1KDS A;  1BLH A;  1BZA A;  1QMF A;  2Q9N A;  3AGD A;  4KQO A;  4S2J A;  3VSL A;  3LY3 A;  3RXX A;  5KZH A;  5U47 A;  3FKV A;  2C5W B;  1RP5 A;  2VGK A;  3WS5 A;  1LI0 A;  4S2N A;  1EI5 A;  5EVI C;  1K6S A;  3ZCZ A;  3IF5 A;  3V3R A;  4EV4 A;  1K38 A;  4KEN B;  1YLZ A;  2P9V B;  1BUL A;  1WYB A;  4Q8I A;  4R3J A;  5FSR A;  4PM6 A;  3ZG5 A;  4HEF A;  1LI9 A;  1PWG A;  5FQM A;  4N92 A;  4OLG A;  4GOG A;  1YLW A;  4R4S A;  4LCL A;  3E2L A;  3NDG A;  3UE1 A;  4BL3 A;  4BLM A;  3WS4 A;  2Q9M A;  3UPO A;  1ONG A;  3PBN A;  4JXS A;  4Z9Q A;  4K0X A;  2Y2Q A;  4JXV A;  4E3J A;  3HBR A;  3BEB A;  4MLL A;  1PW8 A;  3AGF A;  1L0D A;  4JF4 A;  3TSG A;  3SH9 A;  3M2K A;  2ZC6 B;  1XA1 A;  1ZC2 A;  1LL9 A;  2WGW A;  5EPH A;  4ZAM A;  2JCH A;  4WMC D;  1GHP A;  1ES3 A;  3ZFZ A;  3S1Y A;  1ZG4 A;  1YLY A;  3UDI A;  1K54 C;  1S6R A;  1FQG A;  3A3J A;  3VFH A;  1N4O A;  1CI8 A;  3NBL A;  3G35 A;  5CEC A;  3BFC A;  3FV7 A;  2Y2G A;  4KG5 A;  1IYQ A;  2X01 A;  4PM8 A;  4K0W A;  2XFS A;  2WKH A;  3IXH A;  3DW0 A;  3NY4 A;  5DVA A;  3WS1 A;  5HW3 A;  1K4F A;  3ZVT A;  5KSC A;  5G18 A;  4E3O A;  4CPK A;  3SOI A;  3PAE A;  2J7V A;  3IQA A;  2XEP A;  4KZ5 A;  4OLD A;  3DWZ A;  3A3D A;  3OC2 A;  1SHV A;  3NCK A;  4OVD A;  1PWC A;  2ZQ8 A;  1SCW A;  4ZBE A;  4WEL A;  4ZJ3 A;  1KDW A;  3TG9 A;  4DRT A;  3PBR A;  3PTE A;  2C6W B;  3Q7Z A;  3FZC A;  4NK3 A;  4MBF A;  5CGW A;  2ZQA A;  5FQJ A;  4DE1 A;  2X71 A;  5E2H A;  1SKF A;  1XKZ A;  4DF6 A;  4OPY A;  2XH9 A;  4LV2 A;  4U0T A;  3ITA A;  3QNB A;  1JWV A;  5FI7 A;  1W5D A;  2XDM A;  2P74 A;  3AGE A;  1PZO A;  2QMI A;  4XUZ A;  5GLB A;  3WRZ A;  3HRE A;  3G31 A;  2ZD8 A;  3IXB A;  1ZKJ A;  5M1A A;  5TGF A;  3Q81 A;  1FCN A;  3VOY A;  5A93 A;  4S2M A;  4OPQ A;  2Y91 A;  1GCE A;  3I7J A;  3VP1 A;  1G6A A;  4IBX A;  4S2I A;  1KVL A;  1SDE A;  4UA6 A;  1JTD A;  4OPR A;  1O7E A;  4GKU A;  1MPL A;  4WBG A;  4JXW A;  1XP4 A;  1QME A;  4GNU A;  2A49 A;  4MNR A;  4C75 A;  1GHI A;  3HLB A;  4XXR A;  3G32 A;  5FAP A;  4X53 A;  3WWX A;  3IWO A;  2XF3 A;  4WEK A;  1XPB A;  1YQS A;  4N9K A;  5CRF A;  4B88 A;  4RVA A;  4L0L A;  3UY6 A;  1J9M A;  4PMA A;  4EBL A;  3WRT A;  3OPH A;  5FAO A;  4LEN A;  1MWU A;  2BG1 A;  3OCL A;  5EVI B;  3NDE A;  2IWB A;  3UO9 A;  4RYE A;  4U0X A;  3VP3 A;  1PI4 A;  3M6B A;  3DWK A;  4P85 A;  1AXB A;  5EVL A;  5CGX A;  3DTM A;  2PU4 A;  3BYD A;  5E2F A;  4QB8 A;  4BD0 A;  3FKW A;  5EUA A;  5A92 A;  3S4X A;  1BSG A;  3Q7V B;  1JVJ A;  4WM9 A;  5HX9 A;  4S2L A;  4K91 A;  1BUE A;  4OOL A;  2XK1 A;  2H10 A;  3BLM A;  3Q82 A;  1ERQ A;  1HZO A;  3SH8 A;  5CEB A;  3HUN A;  3N6I A;  3ZG8 B;  3ITB A;  3HLD A;  1KE0 A;  4ZDX A;  3MFD A;  1E3U A;  1GA9 A;  3G34 A;  3ZNT A;  1NZO A;  1ERO A;  1H5X A;  4ZTK A;  3GTC A;  2XD5 A;  1CEG A;  1IYP A;  1K55 A;  3IF6 B;  1K56 D;  1CI9 A;  4E3M A;  5D3O A;  2WAF A;  2WAE A;  3MBZ A;  2ZMA A;  4FH2 A;  3IF6 C;  2XFT A;  2OV5 A;  4DDY A;  4JLF A;  5J8X A;  5HAR A;  5FDH A;  4DXB A;  1DJB A;  3VP2 A;  4KQR A;  4QJG A;  3OPP A;  4MBK A;  1I2W A;  3IWQ A;  3OCN A;  4NET A;  2HDU A;  3BM6 A;  4IVI A;  3SH7 A;  5KSH A;  1WYC A;  3ZG9 B;  4EBN A;  5FAQ A;  3PBS A;  5CED A;  1ES5 A;  3HUO A;  5GHZ A;  5FA7 A;  5AQB A;  3TOI A;  3OPL A;  5L2F A;  3A3F A;  3ZG7 B;  4C3Q A;  1YMS A;  1NJ4 A;  5KMW A;  2J9O A;  3PBO A;  2Y2J A;  3VMA A;  4LCM A;  2HDR A;  2EXB A;  1JWZ A;  1VM1 A;  1IKG A;  1K56 A;  3IWI A;  2X02 A;  5FQQ A;  5TFQ A;  4KZ9 A;  4S2K A;  3MKE A;  3CZD A;  5CXW A;  1LLB A;  1ES4 A;  2R9X A;  3RJU A;  1NRF A;  5EOO A;  1KGF A;  4GDN A;  3CG5 A;  3MZE A;  4P87 A;  3ZG0 A;  1FCO A;  2OLV A;  2RL3 A;  5FAT A;  1FR1 A;  4X69 A;  3C4P A;  1PYY A;  1L0F A;  1RGZ A;  3MXR A;  2H0T A;  3OPR A;  4DKI A;  4OPZ A;  5CTM A;  3P09 A;  2OSU A;  1YT4 A;  1K4E A;  4N1X A;  3MZF A;  4B4X A;  1K57 C;  1K25 A;  4Y7P A;  5GHX A;  4ZJ1 A;  2ZQ7 A;  3WS2 A;  4FH4 A;  4EQI A;  4YIN A;  3IF6 A;  4KZ3 A;  2Y2L A;  4ID4 A;  5DF9 A;  1IYO A;  2Y2O A;  3O86 A;  4JF6 A;  3CMZ A;  4E3I A;  2EXA A;  3G2Y A;  2I72 A;  1Y54 A;  3Q1F A;  1E3U D;  2WGI A;  3ISG A;  5EVI A;  2Y2H A;  1KGG A;  1JTG A;  4A5R A;  2Y2N A;  3O87 A;  3EQV A;  4DE3 A;  1Z6F A;  2V2F F;  5F82 A;  3IXD A;  5IHV A;  5A91 A;  3PAG A;  4OKP A;  3Q7V A;  4GDB A;  3SS3 A;  5TR7 A;  2G2U A;  5AQ9 A;  3NI9 A;  2Y55 A;  1U60 A;  3A3I A;  4R3B A;  2QZ6 A;  4UHU A;  3ZNY A;  1HD8 A;  4MBH A;  1IYS A;  1TDL A;  3BFD A;  3ZHH A;  4BJP A;  1ERM A;  4LV3 A;  2WKI A;  3HLG A;  1W8Y A;  1G68 A;  3JYI A;  2Y2P A;  5DF8 A;  4E3N A;  5M18 A;  4BL2 A;  3W8K A;  2ZJ9 A;  4O7D A;  2HP5 A;  1I5Q A;  1ESU A;  1VQQ A;  2OLU A;  5HAI A;  4DDS A;  2ZM0 A;  3HL9 A;  1YM1 A;  5CTN A;  3CJM A;  4F94 A;  4QY5 A;  4X55 A;  1K54 A;  3C7V A;  1ZG6 A;  4E3L A;  2WK0 A;  3QNC A;  1NYY A;  2XLN A;  3SS5 A;  3N7W A;  4KZB A;  1K57 A;  1S0W A;  3C5A A;  5JYO A;  2DRW A;  4X56 A;  3M6H A;  1YLJ A;  3BFF A;  4RX2 A;  4S2O A;  4OQG A;  1L0E A;  4DE0 A;  1W8Q A;  1NXY A;  2EFU A;  3VFF A;  1NY0 A;  5CHM A;  4WYY A;  1OME A;  4WZ5 C;  4C6Y A;  1TDG A;  1FSY A;  1TEM A;  3OZH A;  3BLS A;  2ZQC A;  2ZQD A;  5GHY A;  3W4Q A;  1C3B A;  5CER A;  4UAA A;  5FI2 A;  4GN2 A;  5BOH A;  3UPN A;  3WS0 A;  3HLE A;  4N1H A;  5FI6 A;  1E4D A;  1PW1 A;  4P6B A;  2ZLY A;  5E2E A;  1RCJ A;  4CJN A;  3LEZ A;  1BLC A;  2Y2M A;  1L2S A;  1BTL A;  5DTS A;  2Y4A A;  1ALQ A;  2ZC5 B;  4HES A;  1PI5 A;  4PM7 A;  1SDN A;  2BLS A;  1I2S A;  1XGI A;  3G4P A;  4X6T A;  4ZJ2 A;  2XGN A;  2XR0 A;  4WZ4 A;  1IEM A;  1PWD A;  2EX6 A;  5AQA A;  5FQ9 A;  1BLS A;  3UN7 A;  1PZP A;  3V5M A;  1H8Y A;  4OH0 A;  5EE8 A;  5EEC A;  2JC7 A;  3N8S A;  1YMX A;  3ZDJ A;  4GD8 A;  4LV1 A;  3PBQ A;  3V50 A;  1W7F A;  1H8Z A;  2HDQ A;  3MXS A;  4P0M A;  4DE2 A;  3GMW A;  4GD6 A;  2WZZ A;  3GQZ A;  4WEJ A;  4GB7 A;  2WGW B;  4Y0U A;  4HBT A;  5AQ7 A;  5A90 A;  1KE3 A;  1HVB A;  3G2Z A;  1BLP A;  3NIA A;  2EFX A;  2Y59 A;  2DNS A;  5CHU A;  5EVI D;  1FSW A;  4OP5 A;  3VOZ A;  1TVF A;  3EQU A;  5GLD A;  4R0Q A;  3E2K A;  3BRM A;  4WZ5 A;  3ZGA B;  2IWC A;  5F1F A;  1K6R A;  2ZQ9 A;  3MZD A;  4EUZ A;  4JF5 A;  1CK3 A;  4YFM A;  1DY6 A;  3GR2 A;  4U3T A;  4QU3 A;  1KGE A;  4RX3 A;  1GA0 A;  4E6X A;  1LL5 A;  4JPM A;  3IXG A;  2VGJ A;  3BFE A;  3C4O A;  3A3E A;  3B3X A;  2Z2M B;  5I94 A;  2ZM2 A;  2XD1 A;  4EBP A;  1KE4 A;  2ZC7 A;  4X68 A;  4WMC A;  4DXC A;  2JBF A;  2P9V A;  4N9L A;  1CEF A;  3VSK A;  1L0G A;  4JKT A;  1M6K A;  4OP8 A;  3LY4 A;  4XUX A;  4BQM A;  2WGV A;  4B4Z A;  4E3K A;  4E6W A;  1KVM A;  1HTZ A;  1MKI A;  2Z2L B;  4JBF A;  1PIO A;  3D4F A;  5HAQ A;  1YLP A;  4QY6 A;  4OQI A;  3HLF A;  1Q2P A;  1O07 A;  5F1G A;  3UPP A;  1WE4 A;  1XX2 A;  2WAD A;  4EWF A;  3IHB A;  4Y0O A;  3UE3 A;  2J9P A;  2JE5 A;  2WYX A;  3GV9 A;  4IED A;  4KG6 A;  1N9B A;  4KZ4 A;  4FSF A;  1DJA A;  1MWS A;  3QHY A;  2EX8 A;  5GLA A;  2RCX A;  3MKF A;  3N8L A;  2B5R A;  3O88 A;  4QD4 A;  1FR6 A;  1XGJ A;  4IVK A;  1XA7 A;  4KG2 A;  5CHJ A;  3NC8 A;  1MBL A;  4KQQ A;  4H8R A;  3FYZ A;  4PPR A;  1K55 C;  3P98 A;  3S22 A;  4Y0T A;  4BEN A;  4FCF A;  2H5S A;  5DTT A;  2V1Z A;  1M40 A;  3BFG A;  4R23 A;  2J8Y A;  1BT5 A;  5HFO A;  5FQK A;  3IH8 A;  1MWT A;  3N4I A;  4KZ7 A;  4KZA A;  3VP0 A;  1ONH A;  4OOM A;  5GLC A;  1ESI A;  2Y2I A;  3HLC A;  4OOY A;  3HUM A;  2WKE A;  4OQ0 A;  5M19 A;  3UDF A;  2E8I A;  3GRJ A;  4GZB A;  4OQH A;  4S2N C;  1W79 A;  3PBT A;  3RXW A;  3SS4 A;  4D2O A;  4M3K A;  5FQI A;  3IH9 A;  3VP4 A;  5DTK A;  1DJC A;  2A3U A;  3BEC A;  4KZ8 A;  1Q2Q A;  4BD1 A;  2ZM8 A;  5EOE A;  2EX9 A;  4MEZ A;  1XXM A;  1IEL A;  4LV0 A;  3UNW A;  2EX2 A;  3LO7 A;  3HLW A;  5GL9 A;  3V39 A;  2FFF B;  5HAP A;  4OON A;  3C7U A;  2XQZ A;  1E25 A;  3W4P A;  4R1G A;  1JWP A;  5HL1 A;  2HPB A;  2CC1 A; 
#chains in the Genus database with same CATH topology
 2R78 A;  3GVB A;  1GHM A;  4UEY A;  4UA9 A;  2M1C A;  3T4O A;  1XFN A;  5HDS A;  1YLT A;  5JYP A;  3HVF A;  5CGS A;  2WKQ A;  4UA7 A;  4JXG A;  3G30 A;  1UWN X;  2FFY A;  1NZU A;  2WUQ A;  1OTI A;  3LCE A;  2R9W A;  2UWX A;  2WZX A;  1KDS A;  4DMZ A;  1BLH A;  4KQO A;  3AGD A;  1VEU A;  3FG8 A;  5KZH A;  5U47 A;  3FKV A;  4O0P A;  1K6S A;  5HDD A;  3IF5 A;  2VX8 A;  2A2L A;  2P9V B;  1IOU A;  4R3J A;  5FSR A;  4CLC C;  4PM6 A;  2BAS A;  4HEF A;  1LI9 A;  4OLG A;  4R4S A;  3E2L A;  1LSX A;  1A0K A;  4JXS A;  4Z9Q A;  4K0X A;  2HJE A;  4E3J A;  3HBR A;  3AGF A;  4ARZ B;  1ZC2 A;  1P9R A;  2WGW A;  3ZFZ A;  1ES3 A;  1G6O A;  4Q0J A;  1OTA A;  5EFW A;  4HQA A;  3LIC A;  1IYQ A;  2X01 A;  4PM8 A;  3LIF A;  4K0W A;  3DW0 A;  3NY4 A;  5DVA A;  5HW3 A;  1K4F A;  4I5S A;  4EW7 A;  1S67 L;  3SOI A;  5DKL A;  1XJ2 A;  1YKD A;  3L7H A;  4CLC A;  1LT0 A;  1SHV A;  1SCW A;  3CI6 A;  3F1O A;  3Q7Z A;  3E98 A;  1SKF A;  2W0N A;  1XFQ A;  5EV0 A;  4LV2 A;  3ITA A;  3QNB A;  1JWV A;  2CMN A;  1W5D A;  3EEH A;  4I3I A;  4HIA A;  1ZKJ A;  5A93 A;  2E8J A;  4FTX A;  3I7J A;  1G6A A;  3ICY A;  4IBX A;  3T1Q B;  1V9Y A;  4CQH A;  1O7E A;  1MPL A;  4WBG A;  2VA0 A;  3UB9 A;  2A49 A;  3H82 A;  4MNR A;  4HP9 A;  2VZW A;  4R3A A;  4WEK A;  3EOI A;  4N9K A;  4RVA A;  4XT2 A;  4EBL A;  5FAO A;  2O99 A;  2IWB A;  5LBR A;  3VP3 A;  1PI4 A;  4B93 A;  5EVL A;  5CGX A;  2HZ5 A;  3R7W B;  4BD0 A;  3UB6 A;  2XRO A;  4WM9 A;  2XSS A;  2XK1 A;  4ESP A;  2H10 A;  4WL9 A;  3Q82 A;  1HZO A;  4BBU A;  3ZG8 B;  1KE0 A;  1GA9 A;  1H5X A;  4ZTK A;  2XD5 A;  1CEG A;  1NWZ A;  1LSW A;  5G4Y A;  1SZV A;  5D3O A;  3D9Y A;  1P97 A;  2ZMA A;  4FH2 A;  5J8X A;  5HAR A;  4DXB A;  4Q0I A;  5L8M A;  1I2W A;  4BMW A;  3IWQ A;  3OCN A;  3QP2 A;  4LRZ E;  1WYC A;  3ZG9 B;  4EBN A;  5FAQ A;  2PT7 A;  5GHZ A;  5G4Z A;  4HNB A;  3ZG7 B;  3BY8 A;  4KZ9 A;  1T1A A;  4S2K A;  3MKE A;  1SKO B;  2QYB A;  1LLB A;  3KYZ A;  3FC7 A;  2RL3 A;  3KYQ A;  1YPR A;  5FAT A;  3S7O A;  5AJG A;  1TS7 A;  3C4P A;  4Y17 A;  2XRN A;  3MXR A;  2H0T A;  2VV8 A;  5F6A A;  3P09 A;  1VET A;  3EEA A;  4ZJ1 A;  1K25 A;  4EQI A;  2ACG A;  3CMZ A;  2EXA A;  4E3I A;  1E3U D;  3CPT A;  3ISG A;  3NHQ A;  5EVI A;  3A0V A;  3EQV A;  5HD3 A;  5A91 A;  1T1B A;  3Q7V A;  3LID A;  3SS3 A;  2WKR A;  5TR7 A;  2G2U A;  3NI9 A;  1U60 A;  2H28 A;  2QZ6 A;  3ZNY A;  2EWV A;  4MBH A;  1IYS A;  4BJP A;  4CLC B;  1ERM A;  1W8Y A;  1T1C A;  5C5K A;  2ZJ9 A;  3TW8 A;  1I5Q A;  2OLU A;  5CTN A;  4F94 A;  1ZG6 A;  3LR5 A;  5K5B A;  4E3L A;  2WK0 A;  2XLN A;  3N7W A;  4KZB A;  1VET B;  1S0W A;  4X56 A;  3M6H A;  1YLJ A;  1NY0 A;  5J4E A;  3TE8 A;  1CQA A;  4WZ5 C;  2V1A A;  4C6Y A;  3LR0 A;  3PHY A;  1TDG A;  3C8C A;  3BLS A;  2ZQD A;  5CX7 A;  4LPZ A;  5BOH A;  2ZLY A;  5E2E A;  2I9V A;  2ZC5 B;  3SW1 A;  4X6T A;  1XGI A;  3G4P A;  2XGN A;  3QP6 A;  2M7U A;  1PWD A;  4Y15 A;  1FIL A;  5EE8 A;  2JC7 A;  3N8S A;  1J3W A;  1W7F A;  1H8Z A;  2HDQ A;  2HJ9 C;  2PHY A;  4GB7 A;  3E4O A;  2Y59 A;  5EVI D;  3VOZ A;  1TVF A;  3EQU A;  2FH5 A;  2J80 A;  4R0Q A;  3E2K A;  3LYX A;  4WZ5 A;  2IWC A;  5F1F A;  1CK3 A;  1XJ3 A;  3T4J A;  1KGE A;  4E6X A;  1OTB A;  4RQ9 A;  5L10 A;  4KQD A;  3JVU A;  3B3X A;  2B95 A;  1KE4 A;  4X68 A;  2JBF A;  2P9V A;  2JKF A;  1L3L A;  4JKT A;  1S66 L;  1MZU A;  4IUH A;  1OJ5 A;  1XJ6 A;  1MKI A;  2JHE A;  3MXQ A;  3GDI A;  5HWV A;  5F1G A;  4EWF A;  3IHB A;  3UE3 A;  2ZOI A;  3KSF A;  4FSF A;  1DJA A;  3DTK A;  2JKR M;  5FEF A;  3UMD A;  3O88 A;  5CHJ A;  4Y2F A;  2H5S A;  1BT5 A;  4OOM A;  3IBR A;  5M19 A;  2E8I A;  3KSH A;  1W79 A;  4M3K A;  5DTK A;  2A3U A;  4KZ8 A;  3BEC A;  2ZM8 A;  2EX9 A;  3C2W A;  2V0U A;  3F1N B;  4LV0 A;  3HLW A;  4MN6 A;  1E25 A;  4R1G A;  5DF8 A;  2HPB A;  4GW9 A;  5E43 A;  2Z6C A;  2ZC3 B;  3M2J A;  5E2G A;  2BTF P;  1DP8 A;  2QPN A;  1IFQ A;  2HP6 A;  1FOF A;  3FWL A;  4L9G A;  3ZVW A;  1UGU A;  1FCM A;  5F83 A;  5FAS A;  2PBY A;  2V9A A;  4BBT A;  4Y3I A;  2ZL1 B;  1RGY A;  3MJQ A;  2W3D A;  2HP9 A;  2Y2K A;  3V3S A;  1ES2 A;  4KZ6 A;  3S7N A;  3IHA A;  1BZA A;  2Q9N A;  3KSI A;  3VSL A;  1CF0 A;  3LY3 A;  3PYP A;  3KSG A;  1RP5 A;  3V67 A;  5EVI C;  1K38 A;  4KEN B;  4Q8I A;  2HV1 A;  1PWG A;  4GOG A;  1YLW A;  4LCL A;  1P0Z A;  3NDG A;  3F1N A;  3QP4 A;  3UE1 A;  3A0R A;  4BL3 A;  4BLM A;  2Q9M A;  4Y13 A;  4NEE D;  1L0D A;  1OPX A;  4JF4 A;  4YOF A;  4HOI A;  2B02 A;  5J3W A;  1LL9 A;  4ZAM A;  2JCH A;  4WMC D;  1VEU B;  1YLY A;  1K54 C;  1S6R A;  1CI8 A;  5F68 A;  3BFC A;  4KG5 A;  4HJ6 A;  4E3O A;  1YAX A;  4CPK A;  3PAE A;  2J7V A;  2XEP A;  4OLD A;  3OC2 A;  3NCK A;  1PWC A;  4LLO B;  4WEL A;  3TG9 A;  2W1R A;  2C6W B;  2ZQA A;  3MR0 A;  3G6O A;  4EUV A;  1OTE A;  2Y79 A;  4I3A A;  5FI7 A;  2M7V A;  2P74 A;  3G31 A;  2ZD8 A;  3Q81 A;  1FCN A;  2P04 A;  1KVL A;  4I38 A;  1JTD A;  4JGR A;  1ODV A;  3LIA A;  2QKP A;  2XF3 A;  1NRJ A;  5CRF A;  4B88 A;  4PMA A;  3OPH A;  1MWU A;  4WUJ A;  3OCL A;  1AWI A;  2QHK A;  3NJA A;  1K0K A;  1V9Z A;  4P85 A;  2W3F A;  4QB8 A;  4K08 A;  4GHI B;  1WA9 A;  3Q7V B;  1EW0 A;  3IX8 A;  5HX9 A;  4K91 A;  2PAV P;  1ERQ A;  3SH8 A;  2VV6 A;  3MFD A;  3G34 A;  1ERO A;  4ETZ A;  3GTC A;  1IYP A;  3IF6 B;  1K56 D;  1CI9 A;  2WAF A;  2FZ0 A;  3IF6 C;  5FDH A;  3DBA A;  1OT6 A;  4NET A;  4CLC E;  3F1P A;  4IVI A;  3CWF A;  4HI4 A;  5KIZ A;  4ZRR A;  5FA7 A;  2P7J A;  5AQB A;  4Q0H A;  5HD5 A;  3OPL A;  3TOI A;  5KMW A;  2V8C A;  3VMA A;  4LCM A;  2EXB A;  1JWZ A;  1VM1 A;  5FQQ A;  3T50 A;  5TFQ A;  2B18 A;  3OBF A;  1ES4 A;  1KGF A;  4GDN A;  3CG5 A;  2OLV A;  1PYY A;  1L0F A;  1RGZ A;  4OPZ A;  1K4E A;  4B4X A;  3IX3 A;  4Y7P A;  3WS2 A;  3MQO A;  4YIN A;  3IF6 A;  4JF6 A;  3G2Y A;  1Y54 A;  3Q1F A;  5DJU A;  3CIT A;  4YWZ A;  2Y2H A;  3DTE A;  2Y2N A;  3ZYT A;  2A24 A;  4KUO A;  1GSV A;  2XA7 M;  4GDB A;  5AQ9 A;  3LI9 A;  4JGP A;  3KO6 A;  3JYI A;  3LI8 A;  4O7D A;  3VE3 A;  4DDS A;  1YM1 A;  2VK3 A;  1K54 A;  5TJJ A;  4L9E A;  2JN7 A;  2GX5 A;  2O9A A;  3C5A A;  4LFU A;  3CAX A;  1L0E A;  4DE0 A;  3VFF A;  5CHM A;  1OME A;  1PNE A;  4QWO A;  2ZQC A;  1G5U A;  3KYE A;  4FOF A;  4N1H A;  2VKS A;  4P6B A;  3LIB A;  4R38 A;  3MF0 A;  4CJN A;  3LEZ A;  5A8B A;  1BLC A;  2XR0 A;  4HJ3 A;  5FQ9 A;  1BLS A;  3UN7 A;  3V5M A;  3ZDJ A;  2W3G A;  4LV1 A;  1F9I A;  3MXS A;  4P0M A;  3LR4 A;  4GD6 A;  5A90 A;  4HBT A;  2EFX A;  3MFX A;  4EES A;  1FSW A;  2PR5 A;  2Y8H A;  4G3W A;  5EM1 A;  3ZGA B;  4GCZ A;  4JF5 A;  3GR2 A;  4U3T A;  3MMH A;  4EXO A;  1GA0 A;  1YSQ A;  2VGJ A;  3BFE A;  1LL8 A;  4GS9 A;  1DRM A;  3NEC A;  2JKG A;  2ZC7 A;  4WMC A;  4X1L A;  1L0G A;  1M6K A;  3CHW P;  4XUX A;  3KX0 X;  4II7 A;  4B4Z A;  4E3K A;  1SKO A;  1T19 A;  2J3T D;  1PIO A;  4XT2 B;  3RH8 B;  5HAQ A;  4QY6 A;  4O8G A;  3UPP A;  2WAD A;  3NOT C;  3DTI A;  2J9P A;  2JE5 A;  4IED A;  3GV9 A;  4KZ4 A;  1MKM A;  3QHY A;  2EX8 A;  3MKF A;  3N8L A;  2B5R A;  4QD4 A;  1FR6 A;  3E0Y A;  5F69 A;  4NXB A;  1MBL A;  4P6Z M;  4LRY C;  3FYZ A;  4Y5F A;  3P98 A;  2O0Y A;  2J8Y A;  2QWS A;  5HFO A;  3N4I A;  3VP0 A;  5HSQ A;  1ONH A;  3T12 B;  2Y2I A;  1ZHH B;  3HUM A;  3A0S A;  2WKE A;  4DN0 A;  3UDF A;  3GRJ A;  4GZB A;  4S2N C;  3K2N A;  3PBT A;  5FQI A;  4BD1 A;  1DJC A;  2XQZ A;  2CC1 A;  1X0O A;  3WS5 A;  4S2P A;  4IBR A;  2IWD A;  3N8R A;  1EWZ A;  3IT9 A;  2V20 A;  4GLQ A;  4QHC A;  3T1R A;  1H0M A;  4FD8 A;  1P9W A;  4PAU A;  3UE0 A;  2L0W A;  2PU2 A;  4I3J A;  2PRF A;  2ZC4 B;  3HJI A;  2G2W A;  3Q07 A;  1NYM A;  3UDX A;  4EEU A;  2H0Y A;  2VEA A;  3O3V A;  2HDS A;  3CLO A;  5F5Y A;  1QMF A;  2J3W A;  3LEQ A;  3BQ8 A;  2C5W B;  2VGK A;  2ZMV A;  1KOU A;  2DMW A;  4S2N A;  3ZCZ A;  4JGO A;  3H7W A;  1YLZ A;  2UV0 E;  4GS9 B;  3HCY A;  2VLG A;  5FQM A;  3P01 A;  3UPO A;  3PBN A;  2Y2Q A;  3B47 A;  1PW8 A;  3SZT A;  4EER A;  2MJ6 A;  1VHM A;  3TSG A;  3SH9 A;  3M2K A;  2ZC6 B;  5EPH A;  1ZG4 A;  5J7E A;  2K7S A;  1TF1 A;  4NKP A;  1FQG A;  3VFH A;  2PD7 A;  2OAP 1;  2Y2G A;  3IX4 A;  4G3V A;  2W3E A;  2WKH A;  3IXH A;  1UWP X;  3WS1 A;  2PD8 A;  3ZVT A;  5KSC A;  5G18 A;  3E4Q A;  3S7P A;  3A3D A;  4IJG A;  4ZJ3 A;  1NLY A;  1KDW A;  3PTE A;  3FZC A;  4NK3 A;  3CUE A;  4DE1 A;  2X71 A;  5E2H A;  2PYR A;  3CPT B;  3AGE A;  1PZO A;  2ZL1 A;  3U2A A;  5TGF A;  3VOY A;  4F3L A;  4S2I A;  3T4L A;  5IT5 A;  4OPR A;  1FIK A;  4GKU A;  1XP4 A;  4ARZ A;  5MC7 A;  3D3O A;  3UE6 A;  4C75 A;  2KOI A;  3HLB A;  5DKK A;  3G32 A;  5FAP A;  4X53 A;  1DP9 A;  2GJ3 A;  1YQS A;  3BY9 A;  4L0L A;  1J9M A;  1H3Q A;  2BG1 A;  3T1X A;  3UO9 A;  4RYE A;  2L1M A;  4U0X A;  3DTM A;  3RTY A;  2OOL A;  3BYD A;  5E2F A;  4BWI A;  1PRQ A;  2L4R A;  5TBM B;  4PKY A;  2HF6 A;  4S2L A;  1BUE A;  4OOL A;  5CEB A;  3N6I A;  3ITB A;  2D02 A;  4ZDX A;  1E3U A;  3ZNT A;  1S1Z A;  5FEG A;  2G7U A;  3MBZ A;  2W27 A;  2OV5 A;  1DJB A;  4KQR A;  5HPF A;  1GSX A;  4MBK A;  2HDU A;  3SH7 A;  5KSH A;  5HWT A;  3PBS A;  3VE4 A;  4WF0 A;  1ES5 A;  3HUO A;  4GJ4 A;  1S4R A;  3QP5 A;  4HJ4 A;  2Y2J A;  2A24 B;  1DP6 A;  3IWI A;  1IKG A;  1K56 A;  3RJU A;  2R9X A;  5EOO A;  4HHD A;  3NOP C;  3ZQ5 A;  5HPI A;  3MZE A;  3R4K A;  3ZG0 A;  4X69 A;  2ZBB A;  4DKI A;  5CTM A;  4IUK A;  4LRX C;  3OLO A;  2ZQ7 A;  5DF9 A;  3O86 A;  2Y2O A;  5IU1 A;  2WGI A;  1G28 A;  4X25 A;  4E04 A;  3O87 A;  1Z6F A;  2V2F F;  5F82 A;  3IXD A;  5IHV A;  2Y55 A;  3A3I A;  4R3B A;  4UHU A;  1TDL A;  3BFD A;  3ZHH A;  4LV3 A;  2WKI A;  2Y2P A;  4E3N A;  4BL2 A;  3W8K A;  1W63 M;  1ESU A;  1VQQ A;  5HAI A;  3CJM A;  3BJN A;  4WLA A;  4X55 A;  3QNC A;  1F98 A;  3SS5 A;  3TRC A;  4EU0 A;  3BFF A;  4ME4 A;  4S2O A;  4OQG A;  3IS2 B;  3BWL A;  2YKH A;  1TEM A;  3UB7 A;  4F3L B;  1C3B A;  5CER A;  4UAA A;  4MN5 A;  4GN2 A;  3B42 A;  3WS0 A;  3HLE A;  1E4D A;  1VB6 A;  3GEC A;  3H9W A;  2Y2M A;  2Q0O A;  1ACF A;  1BTL A;  3CUE C;  2Y4A A;  4HES A;  5DTS A;  1LSV A;  1SDN A;  1I2S A;  2GNX A;  1XJ4 A;  4ZJ2 A;  4WZ4 A;  1IEM A;  3OOV A;  2EX6 A;  3H7W B;  5AQA A;  1H8Y A;  3P7N A;  3GMW A;  3GQZ A;  4Y0U A;  2WGW B;  5DFY A;  3UB5 P;  3ULF A;  3G2Z A;  4R6L A;  4R70 A;  5CHU A;  3LFV A;  1K6R A;  2ZQ9 A;  3MQQ A;  4EEP A;  4EUZ A;  4YFM A;  1DY6 A;  3PR6 A;  4QU3 A;  4RX3 A;  1LL5 A;  3K3D A;  3UME A;  4DJ2 A;  3A3E A;  2Z2M B;  2ZM2 A;  1CEF A;  3VSK A;  4OP8 A;  4BQM A;  3F1O B;  1TS0 A;  2Z2L B;  4JBF A;  3D4F A;  1YLP A;  2QJ7 A;  1Q2P A;  5DJT A;  1O07 A;  4UQI S;  2NUT C;  4Y0O A;  1N9B A;  3H82 B;  1MWS A;  3BW6 A;  2RCX A;  5I5L A;  1XA7 A;  4KG2 A;  3NC8 A;  4H8R A;  5HL6 A;  2W3H A;  3TJZ C;  1M40 A;  1H8M A;  3T4S A;  5FQK A;  4KZ7 A;  1MWT A;  4KZA A;  3HLC A;  4OOY A;  3NOU C;  1CJF A;  4D2O A;  3RXW A;  2KDK A;  3DAV A;  5EOE A;  4MEZ A;  4DJ3 A;  1N9O A;  3UNW A;  5GL9 A;  5HAP A;  3VOL A;  4JGQ A;  4BBV A;  5AVF A;  4I39 A;  1JWP A;  1OJG A;  3WWX A;  1IKI A;  1TS6 A;  3GSG A;  3EGX C;  1MWR A;  4P6Z S;  1LHY A;  3MS6 A;  5DF7 A;  4PM9 A;  2GDN A;  4HBU A;  3BQA A;  1MY8 A;  1MXO A;  4PM5 A;  2DCF A;  3W4O A;  4RA7 A;  4R4R A;  5HWW A;  4S2J A;  1D06 A;  3RXX A;  2ZMF A;  1Y4O A;  1LI0 A;  1EI5 A;  2JKT M;  4LGW A;  3VV4 A;  3S7Q A;  3V3R A;  1OT9 A;  4EV4 A;  1BUL A;  1WYB A;  3U4L P;  3ZG5 A;  2VJW A;  3LGO A;  4N92 A;  4EQ1 A;  4M4X A;  1F2K A;  3O5Y A;  3WS4 A;  1ONG A;  3QP8 A;  3EGD C;  4JXV A;  4X1M A;  3BEB A;  1PFL A;  4MLL A;  1XA1 A;  2V0W A;  4Z1W A;  1GHP A;  3S1Y A;  3UDI A;  2OWJ A;  3A3J A;  5FL3 A;  1N4O A;  2VV7 A;  3NBL A;  3G35 A;  2Z6D A;  1YSP A;  5CEC A;  3FV7 A;  4HP4 A;  1S4S A;  2AVX A;  2XFS A;  1HLU P;  1TS8 A;  3T1S A;  5L07 A;  3IQA A;  4KZ5 A;  3DWZ A;  4OVD A;  2ZQ8 A;  4ZBE A;  2D01 A;  4DRT A;  3PBR A;  4MBF A;  5CGW A;  5FQJ A;  3C30 A;  1XKZ A;  4DF6 A;  4OPY A;  2PBD P;  2XH9 A;  4U0T A;  2PDR A;  2XDM A;  2QMI A;  2QJ5 A;  2INW A;  4XUZ A;  5GLB A;  3WRZ A;  3HRE A;  3IXB A;  3IBJ A;  5M1A A;  4S2M A;  4OPQ A;  3EWK A;  2Y91 A;  3LUQ A;  1GCE A;  3VP1 A;  1SDE A;  4UA6 A;  4IHQ A;  4H6J A;  4JXW A;  4GNU A;  1QME A;  1GHI A;  4XXR A;  3IWO A;  4B9O A;  1XPB A;  3B33 A;  4HH3 A;  3UY6 A;  1D7E A;  3WRT A;  4LEN A;  2IA2 A;  5EVI B;  3NDE A;  2W1T B;  3M6B A;  2OWH A;  2LB5 A;  3DWK A;  1AXB A;  4ETX A;  2PU4 A;  4EET B;  3FKW A;  5EUA A;  5IS1 A;  5A92 A;  3S4X A;  4QPR A;  1BSG A;  1JVJ A;  3BLM A;  3HUN A;  1BYW A;  3HLD A;  4NXF A;  5L09 A;  1NZO A;  4MCW A;  2O9C A;  2KLI A;  3T4T A;  1K55 A;  4E3M A;  2WAE A;  4DDY A;  2XFT A;  4JLF A;  4QJG A;  3OPP A;  1F5M A;  5TBM A;  3BM6 A;  4O01 A;  2VGL M;  2JKT I;  3R7W A;  5HZH A;  5CED A;  5L2F A;  4MMN A;  3HJK A;  3A3F A;  1ZTU A;  4C3Q A;  1YMS A;  1NJ4 A;  2J9O A;  3PBO A;  2HDR A;  2X02 A;  3CZD A;  5CXW A;  3E4P A;  1NRF A;  1W63 Q;  1S1Y A;  4P87 A;  1FCO A;  2J3T C;  4CLC D;  1FR1 A;  2XA7 S;  2WKP A;  3OPR A;  2OSU A;  1YT4 A;  4N1X A;  3MZF A;  4GHI A;  4D60 A;  3QP1 A;  1K57 C;  5GHX A;  4FH4 A;  1Z09 A;  3VP2 A;  4KZ3 A;  2Y2L A;  4ID4 A;  1IYO A;  2I72 A;  2O9B A;  1KGG A;  4MDZ A;  1JTG A;  4A5R A;  4DE3 A;  3PAG A;  2YKF A;  4OKP A;  3MQ0 A;  3UB8 A;  1TD5 A;  4G3K A;  1HD8 A;  3F1P B;  3HLG A;  2ZOH A;  3FPW A;  1G68 A;  2W1T A;  4NG2 A;  3NUL A;  5M18 A;  4YNR A;  2HP5 A;  1OTD A;  3W2Z A;  3MSH A;  2GZA A;  2ZM0 A;  3HL9 A;  2HGV A;  3RFB A;  4QY5 A;  3C7V A;  3L9K A;  5EM0 A;  2PR6 A;  4PHT A;  1STZ A;  2JKR I;  1NYY A;  4WN5 A;  2EA9 A;  1K57 A;  5JYO A;  2DRW A;  4RX2 A;  3K3C A;  1W8Q A;  1NXY A;  2EFU A;  1N9N A;  1N9L A;  4WYY A;  4L9F A;  2V1B A;  1FSY A;  5AVE A;  3OZH A;  5GHY A;  3W4Q A;  2VGL S;  2OAQ 1;  5FI2 A;  3UPN A;  5FI6 A;  1PW1 A;  1RCJ A;  3JPU A;  2P08 A;  5FDS A;  1L2S A;  4AFI A;  1ALQ A;  1PI5 A;  4PM7 A;  2BLS A;  4MN7 A;  2KX6 A;  5EVE A;  1PZP A;  4OH0 A;  5EEC A;  1YMX A;  3LIE A;  4GD8 A;  3PBQ A;  3V50 A;  3JVV A;  4DE2 A;  2WZZ A;  4H6J B;  4NXG A;  4WEJ A;  3IS2 A;  5AQ7 A;  1Y28 A;  5HDC A;  1KE3 A;  1HVB A;  3D72 A;  1BLP A;  3NIA A;  2DNS A;  1GSW A;  4OP5 A;  1MC0 A;  2NUP C;  5GLD A;  3BRM A;  3FPV A;  3MZD A;  1D1J A;  1JNU A;  1NLZ A;  2K2N A;  3T4K A;  2K31 A;  4JPM A;  3IXG A;  3C4O A;  5I94 A;  2XD1 A;  4EBP A;  3PXP A;  4DXC A;  4N9L A;  2EWW A;  3LY4 A;  4UQI M;  2WGV A;  4E6W A;  4KUK A;  1KVM A;  1HTZ A;  3LR3 A;  2LB9 A;  4OQI A;  3HLF A;  1T18 A;  1WE4 A;  1XX2 A;  3C38 A;  4PKY G;  2WYX A;  4KG6 A;  3T4Q A;  5GLA A;  1XGJ A;  4IVK A;  4HH2 A;  4KQQ A;  4PPR A;  1K55 C;  2PYP A;  5DFX A;  3S22 A;  4Y0T A;  4BEN A;  4FCF A;  5DTT A;  2V1Z A;  3BFG A;  4R23 A;  2V8F A;  3IH8 A;  5GLC A;  1ESI A;  4OQ0 A;  3SS4 A;  4OQH A;  3IH9 A;  3VP4 A;  1Q2Q A;  1XXM A;  4NXE A;  1IEL A;  4FUW A;  2EX2 A;  3LO7 A;  3V39 A;  2FFF B;  4OON A;  3C7U A;  3W4P A;  5HL1 A;  4HY8 A; 
#chains in the Genus database with same CATH homology
 1IKI A;  3GVB A;  1GHM A;  4S2P A;  4IBR A;  2ZC3 B;  5E43 A;  2IWD A;  3M2J A;  3N8R A;  1EWZ A;  3GSG A;  5E2G A;  1MWR A;  4UA9 A;  2QPN A;  3IT9 A;  2V20 A;  4QHC A;  1LHY A;  4FD8 A;  1YLT A;  5DF7 A;  5JYP A;  2HP6 A;  3UE0 A;  1FOF A;  2GDN A;  2PU2 A;  3FWL A;  3HVF A;  2ZC4 B;  4HBU A;  4PM9 A;  5CGS A;  1FCM A;  4UA7 A;  5F83 A;  3ZVW A;  5FAS A;  2PBY A;  2G2W A;  1MY8 A;  3Q07 A;  1MXO A;  1NYM A;  4JXG A;  3G30 A;  3UDX A;  4PM5 A;  2DCF A;  3W4O A;  2H0Y A;  2FFY A;  1NZU A;  1RGY A;  3O3V A;  4RA7 A;  2WUQ A;  2HP9 A;  2HDS A;  2Y2K A;  3LCE A;  1ES2 A;  4R4R A;  3V3S A;  4KZ6 A;  2R9W A;  2UWX A;  2WZX A;  3IHA A;  1KDS A;  1BLH A;  1BZA A;  1QMF A;  2Q9N A;  3AGD A;  4KQO A;  4S2J A;  3VSL A;  3LY3 A;  3RXX A;  5KZH A;  5U47 A;  3FKV A;  2C5W B;  1RP5 A;  2VGK A;  3WS5 A;  1LI0 A;  4S2N A;  1EI5 A;  5EVI C;  1K6S A;  3ZCZ A;  3IF5 A;  3V3R A;  4EV4 A;  1K38 A;  4KEN B;  1YLZ A;  2P9V B;  1BUL A;  1WYB A;  4Q8I A;  4R3J A;  5FSR A;  4PM6 A;  3ZG5 A;  4HEF A;  1LI9 A;  1PWG A;  5FQM A;  4N92 A;  4OLG A;  4GOG A;  1YLW A;  4R4S A;  4LCL A;  3E2L A;  3NDG A;  3UE1 A;  4BL3 A;  4BLM A;  3WS4 A;  2Q9M A;  3UPO A;  1ONG A;  3PBN A;  4JXS A;  4Z9Q A;  4K0X A;  2Y2Q A;  4JXV A;  4E3J A;  3HBR A;  3BEB A;  4MLL A;  1PW8 A;  3AGF A;  1L0D A;  4JF4 A;  3TSG A;  3SH9 A;  3M2K A;  2ZC6 B;  1XA1 A;  1ZC2 A;  1LL9 A;  2WGW A;  5EPH A;  4ZAM A;  2JCH A;  4WMC D;  1GHP A;  1ES3 A;  3ZFZ A;  3S1Y A;  1ZG4 A;  1YLY A;  3UDI A;  1K54 C;  1S6R A;  1FQG A;  3A3J A;  3VFH A;  1N4O A;  1CI8 A;  3NBL A;  3G35 A;  5CEC A;  3BFC A;  3FV7 A;  2Y2G A;  4KG5 A;  1IYQ A;  2X01 A;  4PM8 A;  4K0W A;  2XFS A;  2WKH A;  3IXH A;  3DW0 A;  3NY4 A;  5DVA A;  3WS1 A;  5HW3 A;  1K4F A;  3ZVT A;  5KSC A;  5G18 A;  4E3O A;  4CPK A;  3SOI A;  3PAE A;  2J7V A;  3IQA A;  2XEP A;  4KZ5 A;  4OLD A;  3DWZ A;  3A3D A;  3OC2 A;  1SHV A;  3NCK A;  4OVD A;  1PWC A;  2ZQ8 A;  1SCW A;  4ZBE A;  4WEL A;  4ZJ3 A;  1KDW A;  3TG9 A;  4DRT A;  3PBR A;  3PTE A;  2C6W B;  3Q7Z A;  3FZC A;  4NK3 A;  4MBF A;  5CGW A;  2ZQA A;  5FQJ A;  4DE1 A;  2X71 A;  5E2H A;  1SKF A;  1XKZ A;  4DF6 A;  4OPY A;  2XH9 A;  4LV2 A;  4U0T A;  3ITA A;  3QNB A;  1JWV A;  5FI7 A;  1W5D A;  2XDM A;  2P74 A;  3AGE A;  1PZO A;  2QMI A;  4XUZ A;  5GLB A;  3WRZ A;  3HRE A;  3G31 A;  2ZD8 A;  3IXB A;  1ZKJ A;  5M1A A;  5TGF A;  3Q81 A;  1FCN A;  3VOY A;  5A93 A;  4S2M A;  4OPQ A;  2Y91 A;  1GCE A;  3I7J A;  3VP1 A;  1G6A A;  4IBX A;  4S2I A;  1KVL A;  1SDE A;  4UA6 A;  1JTD A;  4OPR A;  1O7E A;  4GKU A;  1MPL A;  4WBG A;  4JXW A;  1XP4 A;  1QME A;  4GNU A;  2A49 A;  4MNR A;  4C75 A;  1GHI A;  3HLB A;  4XXR A;  3G32 A;  5FAP A;  4X53 A;  3WWX A;  3IWO A;  2XF3 A;  4WEK A;  1XPB A;  1YQS A;  4N9K A;  5CRF A;  4B88 A;  4RVA A;  4L0L A;  3UY6 A;  1J9M A;  4PMA A;  4EBL A;  3WRT A;  3OPH A;  5FAO A;  4LEN A;  1MWU A;  2BG1 A;  3OCL A;  5EVI B;  3NDE A;  2IWB A;  3UO9 A;  4RYE A;  4U0X A;  3VP3 A;  1PI4 A;  3M6B A;  3DWK A;  4P85 A;  1AXB A;  5EVL A;  5CGX A;  3DTM A;  2PU4 A;  3BYD A;  5E2F A;  4QB8 A;  4BD0 A;  3FKW A;  5EUA A;  5A92 A;  3S4X A;  1BSG A;  3Q7V B;  1JVJ A;  4WM9 A;  5HX9 A;  4S2L A;  4K91 A;  1BUE A;  4OOL A;  2XK1 A;  2H10 A;  3BLM A;  3Q82 A;  1ERQ A;  1HZO A;  3SH8 A;  5CEB A;  3HUN A;  3N6I A;  3ZG8 B;  3ITB A;  3HLD A;  1KE0 A;  4ZDX A;  3MFD A;  1E3U A;  1GA9 A;  3G34 A;  3ZNT A;  1NZO A;  1ERO A;  1H5X A;  4ZTK A;  3GTC A;  2XD5 A;  1CEG A;  1IYP A;  1K55 A;  3IF6 B;  1K56 D;  1CI9 A;  4E3M A;  5D3O A;  2WAF A;  2WAE A;  3MBZ A;  2ZMA A;  4FH2 A;  3IF6 C;  2XFT A;  2OV5 A;  4DDY A;  4JLF A;  5J8X A;  5HAR A;  5FDH A;  4DXB A;  1DJB A;  3VP2 A;  4KQR A;  4QJG A;  3OPP A;  4MBK A;  1I2W A;  3IWQ A;  3OCN A;  4NET A;  2HDU A;  3BM6 A;  4IVI A;  3SH7 A;  5KSH A;  1WYC A;  3ZG9 B;  4EBN A;  5FAQ A;  3PBS A;  5CED A;  1ES5 A;  3HUO A;  5GHZ A;  5FA7 A;  5AQB A;  3TOI A;  3OPL A;  5L2F A;  3A3F A;  3ZG7 B;  4C3Q A;  1YMS A;  1NJ4 A;  5KMW A;  2J9O A;  3PBO A;  2Y2J A;  3VMA A;  4LCM A;  2HDR A;  2EXB A;  1JWZ A;  1VM1 A;  1IKG A;  1K56 A;  3IWI A;  2X02 A;  5FQQ A;  5TFQ A;  4KZ9 A;  4S2K A;  3MKE A;  3CZD A;  5CXW A;  1LLB A;  1ES4 A;  2R9X A;  3RJU A;  1NRF A;  5EOO A;  1KGF A;  4GDN A;  3CG5 A;  3MZE A;  4P87 A;  3ZG0 A;  1FCO A;  2OLV A;  2RL3 A;  5FAT A;  1FR1 A;  4X69 A;  3C4P A;  1PYY A;  1L0F A;  1RGZ A;  3MXR A;  2H0T A;  3OPR A;  4DKI A;  4OPZ A;  5CTM A;  3P09 A;  2OSU A;  1YT4 A;  1K4E A;  4N1X A;  3MZF A;  4B4X A;  1K57 C;  1K25 A;  4Y7P A;  5GHX A;  4ZJ1 A;  2ZQ7 A;  3WS2 A;  4FH4 A;  4EQI A;  4YIN A;  3IF6 A;  4KZ3 A;  2Y2L A;  4ID4 A;  5DF9 A;  1IYO A;  2Y2O A;  3O86 A;  4JF6 A;  3CMZ A;  4E3I A;  2EXA A;  3G2Y A;  2I72 A;  1Y54 A;  3Q1F A;  1E3U D;  2WGI A;  3ISG A;  5EVI A;  2Y2H A;  1KGG A;  1JTG A;  4A5R A;  2Y2N A;  3O87 A;  3EQV A;  4DE3 A;  1Z6F A;  2V2F F;  5F82 A;  3IXD A;  5IHV A;  5A91 A;  3PAG A;  4OKP A;  3Q7V A;  4GDB A;  3SS3 A;  5TR7 A;  2G2U A;  5AQ9 A;  3NI9 A;  2Y55 A;  1U60 A;  3A3I A;  4R3B A;  2QZ6 A;  4UHU A;  3ZNY A;  1HD8 A;  4MBH A;  1IYS A;  1TDL A;  3BFD A;  3ZHH A;  4BJP A;  1ERM A;  4LV3 A;  2WKI A;  3HLG A;  1W8Y A;  1G68 A;  3JYI A;  2Y2P A;  5DF8 A;  4E3N A;  5M18 A;  4BL2 A;  3W8K A;  2ZJ9 A;  4O7D A;  2HP5 A;  1I5Q A;  1ESU A;  1VQQ A;  2OLU A;  5HAI A;  4DDS A;  2ZM0 A;  3HL9 A;  1YM1 A;  5CTN A;  3CJM A;  4F94 A;  4QY5 A;  4X55 A;  1K54 A;  3C7V A;  1ZG6 A;  4E3L A;  2WK0 A;  3QNC A;  1NYY A;  2XLN A;  3SS5 A;  3N7W A;  4KZB A;  1K57 A;  1S0W A;  3C5A A;  5JYO A;  2DRW A;  4X56 A;  3M6H A;  1YLJ A;  3BFF A;  4RX2 A;  4S2O A;  4OQG A;  1L0E A;  4DE0 A;  1W8Q A;  1NXY A;  2EFU A;  3VFF A;  1NY0 A;  5CHM A;  4WYY A;  1OME A;  4WZ5 C;  4C6Y A;  1TDG A;  1FSY A;  1TEM A;  3OZH A;  3BLS A;  2ZQC A;  2ZQD A;  5GHY A;  3W4Q A;  1C3B A;  5CER A;  4UAA A;  5FI2 A;  4GN2 A;  5BOH A;  3UPN A;  3WS0 A;  3HLE A;  4N1H A;  5FI6 A;  1E4D A;  1PW1 A;  4P6B A;  2ZLY A;  5E2E A;  1RCJ A;  4CJN A;  3LEZ A;  1BLC A;  2Y2M A;  1L2S A;  1BTL A;  5DTS A;  2Y4A A;  1ALQ A;  2ZC5 B;  4HES A;  1PI5 A;  4PM7 A;  1SDN A;  2BLS A;  1I2S A;  1XGI A;  3G4P A;  4X6T A;  4ZJ2 A;  2XGN A;  2XR0 A;  4WZ4 A;  1IEM A;  1PWD A;  2EX6 A;  5AQA A;  5FQ9 A;  1BLS A;  3UN7 A;  1PZP A;  3V5M A;  1H8Y A;  4OH0 A;  5EE8 A;  5EEC A;  2JC7 A;  3N8S A;  1YMX A;  3ZDJ A;  4GD8 A;  4LV1 A;  3PBQ A;  3V50 A;  1W7F A;  1H8Z A;  2HDQ A;  3MXS A;  4P0M A;  4DE2 A;  3GMW A;  4GD6 A;  2WZZ A;  3GQZ A;  4WEJ A;  4GB7 A;  2WGW B;  4Y0U A;  4HBT A;  5AQ7 A;  5A90 A;  1KE3 A;  1HVB A;  3G2Z A;  1BLP A;  3NIA A;  2EFX A;  2Y59 A;  2DNS A;  5CHU A;  5EVI D;  1FSW A;  4OP5 A;  3VOZ A;  1TVF A;  3EQU A;  5GLD A;  4R0Q A;  3E2K A;  3BRM A;  4WZ5 A;  3ZGA B;  2IWC A;  5F1F A;  1K6R A;  2ZQ9 A;  3MZD A;  4EUZ A;  4JF5 A;  1CK3 A;  4YFM A;  1DY6 A;  3GR2 A;  4U3T A;  4QU3 A;  1KGE A;  4RX3 A;  1GA0 A;  4E6X A;  1LL5 A;  4JPM A;  3IXG A;  2VGJ A;  3BFE A;  3C4O A;  3A3E A;  3B3X A;  2Z2M B;  5I94 A;  2ZM2 A;  2XD1 A;  4EBP A;  1KE4 A;  2ZC7 A;  4X68 A;  4WMC A;  4DXC A;  2JBF A;  2P9V A;  4N9L A;  1CEF A;  3VSK A;  1L0G A;  4JKT A;  1M6K A;  4OP8 A;  3LY4 A;  4XUX A;  4BQM A;  2WGV A;  4B4Z A;  4E3K A;  4E6W A;  1KVM A;  1HTZ A;  1MKI A;  2Z2L B;  4JBF A;  1PIO A;  3D4F A;  5HAQ A;  1YLP A;  4QY6 A;  4OQI A;  3HLF A;  1Q2P A;  1O07 A;  5F1G A;  3UPP A;  1WE4 A;  1XX2 A;  2WAD A;  4EWF A;  3IHB A;  4Y0O A;  3UE3 A;  2J9P A;  2JE5 A;  2WYX A;  3GV9 A;  4IED A;  4KG6 A;  1N9B A;  4KZ4 A;  4FSF A;  1DJA A;  1MWS A;  3QHY A;  2EX8 A;  5GLA A;  2RCX A;  3MKF A;  3N8L A;  2B5R A;  3O88 A;  4QD4 A;  1FR6 A;  1XGJ A;  4IVK A;  1XA7 A;  4KG2 A;  5CHJ A;  3NC8 A;  1MBL A;  4KQQ A;  4H8R A;  3FYZ A;  4PPR A;  1K55 C;  3P98 A;  3S22 A;  4Y0T A;  4BEN A;  4FCF A;  2H5S A;  5DTT A;  2V1Z A;  1M40 A;  3BFG A;  4R23 A;  2J8Y A;  1BT5 A;  5HFO A;  5FQK A;  3IH8 A;  1MWT A;  3N4I A;  4KZ7 A;  4KZA A;  3VP0 A;  1ONH A;  4OOM A;  5GLC A;  1ESI A;  2Y2I A;  3HLC A;  4OOY A;  3HUM A;  2WKE A;  4OQ0 A;  5M19 A;  3UDF A;  2E8I A;  3GRJ A;  4GZB A;  4OQH A;  4S2N C;  1W79 A;  3PBT A;  3RXW A;  3SS4 A;  4D2O A;  4M3K A;  5FQI A;  3IH9 A;  3VP4 A;  5DTK A;  1DJC A;  2A3U A;  3BEC A;  4KZ8 A;  1Q2Q A;  4BD1 A;  2ZM8 A;  5EOE A;  2EX9 A;  4MEZ A;  1XXM A;  1IEL A;  4LV0 A;  3UNW A;  2EX2 A;  3LO7 A;  3HLW A;  5GL9 A;  3V39 A;  2FFF B;  5HAP A;  4OON A;  3C7U A;  2XQZ A;  1E25 A;  3W4P A;  4R1G A;  1JWP A;  5HL1 A;  2HPB A;  2CC1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...