4X53A

Structure of the class d beta-lactamase oxa-160 v130d in acyl-enzyme complex with aztreonam
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
245
structure length
243
Chain Sequence
MHISSQQHEKAIKSYFDEAQTQGVIIIKEGKNLSTYGNALARANKEYVPASTFKMLNALIGLENHKATTNEIFKWDGKKRTYPMWEKDMTLGEAMALSADPVYQELARRTGLELMQKEVKRVNFGNTNIGTQVDNFWGPLKITPVQEVNFADDLAHNRLPFKLETQEEVKKMLLIKEVNGSKIYAKSGWGMGVTSQVGWLTGWVEQANGKKIPFSLNLEMKEGMSGSIRNEITYKSLENLGII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Class D beta-lactamase OXA-160
publication title Structural Basis of Activity against Aztreonam and Extended Spectrum Cephalosporins for Two Carbapenem-Hydrolyzing Class D beta-Lactamases from Acinetobacter baumannii.
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Hydrolase
total genus 80
structure length 243
sequence length 245
ec nomenclature
pdb deposition date 2014-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4x53A00
5A92A 5JYPA 3CG5A 4R3JA 2BG1A 2HDRA 3PBNA 4PM9A 2XEPA 2EX9A 2XR0A 1NYYA 1PW8A 3N4IA 4PM8A 1K54A 3NBLA 4XXRA 3ZG0A 3PBRA 3WS5A 3OPLA 2DRWA 1QMFA 5E2HA 3AGDA 1AXBA 5HFOA 4QJGA 4NETA 3BECA 4FD8A 3S22A 1YM1A 3IXHA 3VOYA 1XXMA 4DDSA 4M3KA 1K38A 1BSGA 4OVDA 2Q9MA 4MBKA 3RXWA 1LL5A 4KZ9A 3UY6A 3O87A 2V2FF 5CHMA 3Q81A 4FH4A 1J9MA 5FI2A 3ZVWA 4PPRA 3UE1A 1IELA 5I94A 2RCXA 3ZG9B 4C6YA 5HARA 1H5XA 3IWIA 1M40A 5E43A 5GLBA 4UA6A 1S0WA 1KGEA 4E3LA 2DCFA 2V1ZA 3Q7VB 4FH2A 3IHBA 2XLNA 3GTCA 2HP9A 2XK1A 4DE0A 2P74A 3C5AA 4Y0UA 2Z2LB 4E3MA 1CEGA 2H5SA 3IH8A 3GMWA 1K25A 5EE8A 4MBHA 1LI0A 2Y2NA 3A3JA 5FDHA 2ZD8A 3UDXA 3C7UA 4X68A 5DF9A 1GHMA 4S2PA 1E25A 4S2IA 2XGNA 3UN7A 4EBPA 4KG2A 2X01A 3DTMA 1K57A 3Q07A 5F1FA 1MWTA 1I2WA 2XD1A 1ES5A 2J9OA 1W8YA 2WGIA 3HLDA 1XA7A 2HPBA 2EFXA 1PI4A 3VSKA 1BLPA 2B5RA 1QMEA 4S2NA 2XFSA 1OMEA 3BM6A 4KZAA 5FQMA 3SH7A 3RJUA 3ZG7B 2EX2A 1YLZA 4RA7A 3MZDA 2ZQAA 1SKFA 4B88A 1YLYA 2Y2PA 3TSGA 3MKEA 5HX9A 3UE0A 1N4OA 3G2YA 5EOEA 1BULA 2ZC4B 3P09A 3TOIA 2JCHA 5HW3A 5HL1A 4E6XA 4HBUA 5CXWA 1YMSA 3SS4A 4K0XA 2OLVA 1IEMA 1XPBA 4O7DA 2Y55A 1ESIA 3LY4A 4H8RA 3CZDA 4WZ4A 5FSRA 1PWCA 1YQSA 4EBLA 2P9VB 1E3UA 3BFEA 3HLCA 1GCEA 4BJPA 1KGFA 3OZHA 3A3FA 4EBNA 1Y54A 3VSLA 1KE0A 5J8XA 1E4DA 5EOOA 5F82A 2RL3A 3VP4A 1XX2A 1FR1A 1ZC2A 3HUOA 3ITBA 1TEMA 4OPQA 4KQRA 3W4OA 1SDNA 3ZCZA 3S4XA 4ZDXA 1ZG4A 4X53A 2ZM8A 4R1GA 4R3BA 2H0TA 3G32A 3IF6B 4Y0OA 3PAEA 4OPYA 5CTNA 5DVAA 3DW0A 4BENA 3M2KA 5EPHA 4HBTA 4BLMA 4BQMA 3ZFZA 1DJBA 4EUZA 4KZ3A 1JWZA 4P6BA 2V20A 1VM1A 1W79A 4WEKA 5E2EA 4EQIA 5M19A 3UE3A 4WMCD 1YLJA 2HP5A 3G4PA 1EI5A 2ZMAA 3OCNA 2ZQ7A 5FQKA 4P0MA 2Q9NA 2JBFA 1K6SA 4OKPA 3TG9A 2WAEA 3IF6C 2CC1A 1IYPA 4QHCA 2WUQA 4OOYA 1MXOA 3GRJA 1KE4A 2Y2KA 1ZG6A 2GDNA 1K55A 2ZC7A 4RYEA 1ALQA 1TDGA 3WS0A 4DE3A 3N8RA 1BUEA 4MBFA 4WYYA 3SH8A 3PBOA 4BL2A 3LY3A 2XFTA 4LV2A 3FKVA 5CEDA 1LHYA 4MEZA 4UAAA 5EVLA 1O07A 4IVKA 4DDYA 2R9WA 2J8YA 3M6HA 5TFQA 4S2MA 1FCNA 4NK3A 4U0XA 2G2UA 4F94A 3A3DA 5G18A 4R23A 1GHPA 1NY0A 5KMWA 4KENB 3V3SA 3IHAA 1LI9A 3VFHA 3DWZA 3ZVTA 1FCOA 4GZBA 2QZ6A 4JF5A 4KQOA 4CJNA 3HBRA 4HEFA 3WS1A 1WYBA 3M2JA 4OOMA 1SCWA 3EQUA 1BZAA 4KZBA 1TDLA 1PIOA 4BL3A 1XKZA 4IBRA 2WZXA 4QU3A 3G35A 2JE5A 3BLSA 3UPOA 2ZC5B 3IXBA 1RGZA 2OSUA 2XD5A 4PM5A 2FFFB 5GLDA 3M6BA 1K6RA 2G2WA 3E2LA 4LV0A 3BYDA 3PBQA 4KZ6A 3OCLA 2Y91A 2IWCA 3GV9A 4HESA 2H10A 4LCLA 4S2LA 1ZKJA 3N8SA 4WM9A 3UNWA 3PBSA 5AQBA 2J9PA 4K91A 4OQGA 4WBGA 2WKIA 4XUXA 5JYOA 4MLLA 3MFDA 1Q2PA 4Y7PA 1NJ4A 5A91A 5KSHA 5CRFA 4PM6A 4N9LA 3BFCA 4YFMA 2IWBA 1MY8A 5EVIB 1CI9A 4FCFA 2EFUA 2ZLYA 5CGXA 5DTSA 3FV7A 4E3NA 1ES2A 5E2GA 1HZOA 3A3IA 4JLFA 3V50A 2WGWA 4R0QA 3ZNYA 3UPNA 3ISGA 1MPLA 4X6TA 5EVID 4WMCA 4X69A 3MXRA 4KG5A 3OPRA 4E3JA 3IF6A 2OV5A 4N92A 3C7VA 2UWXA 1YLWA 3I7JA 4ZJ3A 4GOGA 1K56A 3BFDA 3O3VA 5CGSA 5EVIC 4L0LA 3Q7ZA 5E2FA 1PW1A 3WS4A 3BRMA 5GHXA 3SOIA 4LV1A 5GHYA 4FSFA 5KSCA 2ZQ9A 1O7EA 1VQQA 3UDFA 2Y2JA 1DJAA 1XGJA 2XQZA 1JTDA 4A5RA 4DRTA 3ZG8B 3V39A 4DE2A 2XF3A 4OPRA 3IQAA 4ID4A 3Q1FA 2PU4A 2C5WB 2JC7A 1K54C 1KGGA 3FYZA 4JF6A 4GDBA 5AQAA 3ZHHA 2EXAA 3IH9A 2FFYA 1RGYA 4RX3A 1HD8A 4ZJ2A 5CEBA 1EWZA 1YLPA 2R9XA 2WADA 4WELA 5HAQA 1ESUA 3HL9A 1L0GA 1YMXA 4X56A 1BLSA 2ZC6B 4U3TA 5EECA 4ZAMA 5FAQA 3W8KA 1MBLA 3GSGA 5GLCA 3V3RA 1YLTA 2Z2MB 4RVAA 3S1YA 3ZDJA 3ITAA 2HP6A 5A90A 3OC2A 1TVFA 2XDMA 2HDSA 4WEJA 2BLSA 5AQ7A 4KZ8A 1KDSA 5FAOA 3D4FA 3WWXA 1MWSA 1JVJA 1WYCA 1PZPA 1XP4A 2OLUA 3HUNA 3LEZA 3HLBA 2ZQDA 1CEFA 1ES3A 3EQVA 3IT9A 1BTLA 2ZC3B 3NIAA 5CGWA 4ZBEA 2J7VA 5IHVA 3PAGA 3LCEA 3NC8A 4GNUA 1L2SA 1L0DA 2VGKA 5F83A 3VP2A 3Q7VA 2WZZA 3BEBA 4QB8A 1NRFA 1N9BA 1PI5A 1RCJA 4DKIA 4PM7A 4EV4A 1BT5A 3GVBA 1L0EA 2H0YA 1XGIA 4N1XA 4E3KA 2QMIA 3IXDA 4QD4A 2Y2HA 1FCMA 1PYYA 3B3XA 3RXXA 3SS3A 4JF4A 2WKHA 4S2OA 1U60A 1ERQA 2A3UA 4EWFA 5FQJA 3ZNTA 4LCMA 2XH9A 3VP0A 3HUMA 4B4XA 4LV3A 1FQGA 4UA7A 4OH0A 5FAPA 1K57C 4OQIA 3HVFA 1G6AA 4OP8A 1ONHA 1SHVA 5F1GA 4BD0A 4N1HA 1IYQA 4DE1A 3O88A 2WAFA 3W4PA 2C6WB 1IKIA 3A3EA 1Q2QA 5M1AA 4S2NC 2QPNA 1GA0A 1WE4A 4JXGA 4S2JA 5A93A 1FSYA 1MKIA 5GL9A 3QHYA 3IXGA 3O86A 2Y2IA 3ZGAB 4X55A 3C4OA 3P98A 3LO7A 4KZ5A 3G34A 4B4ZA 4S2KA 4Z9QA 4ZJ1A 3VP1A 5GHZA 3FWLA 3UDIA 1NZOA 5TR7A 1E3UD 2WK0A 4QY6A 1JWPA 1CI8A 4JXSA 3GR2A 5CHUA 5CHJA 2EX6A 1FOFA 5BOHA 5FI6A 1W8QA 3SS5A 4DXCA 4GD8A 4KQQA 4Q8IA 3HLWA 4OP5A 4OQHA 3IF5A 4Y0TA 3E2KA 2X02A 1G68A 2P9VA 1EROA 2IWDA 1KVLA 2I72A 1NXYA 4R4RA 5TGFA 4OLDA 1FR6A 2PBYA 1KVMA 3DWKA 4GD6A 5U47A 3ZG5A 2EXBA 3CJMA 4IBXA 4QY5A 5CERA 1RP5A 1I2SA 4MNRA 4WZ5C 3N8LA 5L2FA 4JXWA 1Z6FA 1DJCA 3IWQA 4GB7A 3NI9A 1JTGA 3AGFA 2ZJ9A 1NYMA 2Y2OA 3VFFA 3JYIA 1IYSA 1NZUA 4KG6A 4DF6A 4RX2A 5M18A 3HREA 4JBFA 5FASA 2DNSA 1GA9A 2VGJA 2A49A 1JWVA 5FQ9A 5HAIA 2WKEA 4R4SA 3Q82A 1KDWA 1S6RA 1YT4A 3C4PA 4E3OA 3NCKA 1K55C 4KZ4A 4BD1A 4DXBA 5FA7A 3G31A 4CPKA 1M6KA 1BLCA 3UO9A 1HVBA 3QNCA 2ZQCA 3V5MA 3PBTA 3VP3A 5DTTA 3AGEA 4OOLA 2EX8A 3MXSA 4LENA 5FQQA 3PTEA 1LLBA 2Y59A 4JPMA 2ZM2A 1L0FA 4OPZA 5AQ9A 4UA9A 3W4QA 3SH9A 2ZQ8A 3QNBA 4JXVA 1KE3A 4E6WA 1ES4A 4GN2A 3BFGA 5DF7A 3UPPA 1IKGA 2PU2A 3NDEA 4OONA 1HTZA 4IEDA 3BLMA 2Y2LA 1H8YA 1PWGA 3FZCA 3MKFA 4OQ0A 3NDGA 1C3BA 3MBZA 3NY4A 3WS2A 4UHUA 3N7WA 4C75A 1MWUA 1CK3A 4ZTKA 3MZFA 3HLEA 1BLHA 1MWRA 5GLAA 1FSWA 2HDQA 3CMZA 3G30A 3N6IA 1PWDA 4GDNA 4K0WA 3HLGA 2Y2GA 1W5DA 5FQIA 4E3IA 2Y4AA 5D3OA 4JKTA 5KZHA 4YINA 1IYOA 4PMAA 4C3QA 5EUAA 1SDEA 4IVIA 2WGWB 5CTMA 2Y2QA 1DY6A 3HLFA 4P85A 2Y2MA 2ZM0A 1LL9A 1ONGA 2E8IA 3G2ZA 4OLGA 4WZ5A 2WGVA 1K4FA 4XUZA 4N9KA 4KZ7A 1W7FA 5DTKA 1H8ZA 2X71A 3FKWA 1GHIA 3BFFA 3OPPA 1ERMA 3OPHA 1K4EA 5FI7A 1PZOA 4D2OA 5EVIA 1K56D 2HDUA 3WRTA 3VMAA 4P87A 5DF8A 1XA1A 2WYXA 4GKUA 4U0TA 3GQZA 5CECA 3VOZA 3IWOA 5HAPA 3MZEA 1I5QA 5FATA 3WRZA
chains in the Genus database with same CATH superfamily
2OAP1 5JYPA 2M1CA 1NYYA 4PM8A 3NBLA 2DMWA 3PBRA 4FD8A 3S22A 1YM1A 3IXHA 3UB9A 4M3KA 1BSGA 4OVDA 3O87A 5CHMA 3ZVWA 4HIAA 2W3FA 2RCXA 3CPTB 3IWIA 5IT5A 4FTXA 1S0WA 2XLNA 2XK1A 4E3MA 3IH8A 5DKLA 2HF6A 1DRMA 4ARZA 2BASA 1GHMA 4RQ9A 4DN0A 3DTMA 3Q07A 5F1FA 1A0KA 1MWTA 2HPBA 1PI4A 2B5RA 4S2NA 2XFSA 5FQMA 4DJ3A 3EWKA 3MZDA 4B88A 2Y2PA 4O0PA 3TSGA 1SZVA 5HW3A 5HL1A 4HBUA 3UB7A 3JVUA 1YMSA 3SS4A 5CX7A 3CZDA 1YQSA 1E3UA 1S4SA 3HLCA 2O9AA 3E98A 2V8FA 1Y54A 3LFVA 3ZCZA 3S4XA 4X53A 3MFXA 3PR6A 4R1GA 2H0TA 5FEFA 3PAEA 2OWHA 4JGQA 3ZFZA 4EQIA 4Y13A 3G4PA 1F5MA 2ZMAA 4HQAA 2ZQ7A 4P0MA 2Q9NA 4OKPA 1IYPA 4OOYA 2GDNA 3T4OA 3N8RA 4MBFA 4WYYA 5MC7A 2XFTA 4LV2A 5CEDA 4UAAA 5G4YA 4DDYA 2J8YA 2V0WA 4U0XA 4F94A 5G18A 2QKPA 5KMWA 1EW0A 3ZVTA 1FCOA 4GZBA 2QZ6A 4HEFA 1OT9A 3WS1A 3CUEC 2JKTI 1SCWA 1TS6A 3S7QA 1T18A 4BL3A 1XKZA 3G6OA 4IBRA 5HDSA 2WZXA 4B93A 2FH5A 3BLSA 2ZC5B 3DTEA 3IXBA 2OSUA 3LEQA 1PFLA 3E2LA 4BWIA 2HJ9C 4CLCC 4KZ6A 2B18A 3BWLA 4F3LB 2WKIA 1LSVA 3MFDA 2W1TA 4PM6A 4YFMA 1VETA 5EVIB 1CI9A 1UWNX 2ZLYA 3PYPA 4Y2FA 2QJ7A 5E2GA 1HZOA 2E8JA 4R0QA 3UB5P 3ZNYA 1LL8A 3MQ0A 4X6TA 5EM1A 3KO6A 4WMCA 4KG5A 3T4LA 3UMEA 1VEUA 4N92A 3I7JA 4ZJ3A 3BFDA 5CGSA 1MZUA 4DJ2A 5E2FA 1PW1A 3BQ8A 1DJAA 1XGJA 4HP4A 4WUJA 3T1SA 3ZG8B 4HOIA 4DE2A 3IQAA 2JC7A 1K54C 3FYZA 4JF6A 3VE3A 2XROA 2EXAA 4UEYA 2K7SA 4Y3IA 2WADA 1ESUA 1L0GA 2M7UA 1YMXA 3W8KA 4ZAMA 5DFXA 3GSGA 5GLCA 1W63M 4RVAA 2XA7S 3T12B 2HP6A 4YWZA 4NKPA 2XDMA 5AQ7A 3D4FA 1MWSA 1JVJA 3H7WB 1PZPA 3IT9A 3JPUA 2J7VA 3CPTA 3IS2B 2VV7A 2NUPC 4CLCA 3MSHA 1MKMA 3MJQA 3SW1A 2V9AA 2P7JA 4EV4A 4PM7A 4PHTA 1L0EA 1XGIA 4N1XA 2VV8A 3B3XA 2WKHA 2V1BA 3KSIA 2WKQA 5FQJA 3B33A 3ZNTA 2XH9A 5LBRA 4LV3A 5FAPA 4OH0A 1K57C 4OQIA 1G6AA 4BD0A 4N1HA 4BMWA 2C6WB 2XSSA 5IU1A 2QPNA 1WE4A 4JXGA 1FSYA 1MKIA 3IXGA 3CWFA 1KOUA 3HJIA 3G34A 3BQAA 4CLCE 4L9FA 5TR7A 1E3UD 2O9CA 1JWPA 5FEGA 3V67A 2A24B 3GR2A 5CHUA 4IUKA 1OTIA 5CHJA 5FI6A 1W8QA 4KQQA 4OP5A 3E2KA 1X0OA 2IWDA 2OAQ1 5F6AA 1KVMA 1ZTUA 3LR3A 4Q0IA 3N8LA 1JTGA 3AGFA 3VFFA 2Y2OA 1IYSA 1NZUA 2VV6A 4MCWA 1JWVA 2WKEA 4R4SA 4MN7A 1UWPX 2Q0OA 4E3OA 3S7PA 4DXBA 3A0SA 3G31A 5C5KA 4CPKA 3MXSA 3PTEA 2Y59A 1ES4A 4R6LA 5J7EA 2PU2A 2JKRM 3FZCA 1NLZA 3NDGA 4HH3A 4UHUA 1MWUA 4NG2A 3CMZA 3G30A 3N6IA 4GDNA 4K0WA 3KYZA 3T4KA 1TF1A 4C3QA 1TS8A 2GZAA 2WGWB 5CTMA 2ZM0A 1ONGA 1SKOA 2E8IA 2VLGA 4XUZA 3DTKA 1H8ZA 3FKWA 1Z09A 3OPHA 5FI7A 4D2OA 5EVIA 3VMAA 4P87A 2EWVA 3MXQA 3BW6A 3GQZA 2L1MA 3MZEA 1I5QA 3VP0A 1FILA 3WRZA 3FPWA 4R3JA 3PBNA 2EX9A 2J3TD 3UB8A 1OTEA 2DRWA 1QMFA 4QJGA 3BECA 3PXPA 3F1PB 3VOYA 1XXMA 4DDSA 4EW7A 4KUKA 2Q9MA 4HY8A 2V2FF 5FI2A 4PPRA 1IELA 5I94A 5HARA 1H5XA 1M40A 5GLBA 4L9EA 2V1ZA 4FH2A 3IHBA 2HP9A 3LICA 4Y0UA 2PYRA 4YNRA 1LSXA 2YKHA 3HJKA 3LR0A 4MBHA 3T1QB 5FDHA 2ZD8A 5FL3A 3C7UA 3IS2A 3TE8A 4S2PA 1E25A 4EETB 3UN7A 1OJ5A 2XD1A 1ES5A 2J9OA 1W8YA 3RH8B 4MN5A 3VSKA 3LIDA 1BLPA 1QMEA 4Y17A 2PDRA 3BM6A 1OMEA 3DTIA 3RJUA 3EGXC 2ZQAA 1YLYA 5EOEA 1YSQA 3P09A 1H3QA 2JCHA 4E6XA 5I5LA 2WKRA 5CXWA 1LT0A 3R4KA 4HJ6A 3OBFA 1IEMA 2Y55A 3LY4A 3LI9A 4WZ4A 1PWCA 2YKFA 3BFEA 1GCEA 3LR5A 3OZHA 3VSLA 1GSXA 1KE0A 3L9KA 1VETB 3TRCA 2RL3A 1FR1A 3BJNA 1TEMA 4ZDXA 2A24A 2D02A 2ZM8A 4R3BA 4JGOA 3G32A 3A0VA 4Y0OA 1VEUB 3M2KA 4BQMA 4YOFA 1DJBA 5TBMB 4P6BA 2V20A 1VM1A 4WEKA 5M19A 2HP5A 5FQKA 3B42A 1MXOA 3GRJA 1ZG6A 4O01A 2HGVA 2ZC7A 1TDGA 4ZRRA 3SH8A 3PBOA 1LHYA 5EVLA 3TW8A 4BBVA 3GECA 3A3DA 3NECA 4WF0A 3V3SA 3MF0A 1LI9A 3DWZA 4JF5A 1D06A 3M2JA 4M4XA 2H28A 4CLCB 1BZAA 2K2NA 1TDLA 3NOTC 3SZTA 3T1XA 2PYPA 3S7NA 2Z6CA 4QU3A 3G35A 5EV0A 3NJAA 3E4QA 1ACFA 2FFFB 2G2WA 4Y15A 4LV0A 3BYDA 3OCLA 4JGPA 4GHIB 3UNWA 3PBSA 5AQBA 4WBGA 4XUXA 5JYOA 4MLLA 5CRFA 1S66L 1STZA 4FCFA 3FV7A 2PT7A 3EEAA 3A3IA 2WGWA 2QYBA 3ISGA 5EVID 4X69A 4E3JA 4DMZA 3IX3A 4R3AA 3O3VA 2Y8HA 3D9YA 5HZHA 2ZQ9A 1O7EA 2Y2JA 2XQZA 3LIEA 3Q1FA 4KUOA 3T4TA 1RGYA 4RX3A 4BBTA 2R9XA 3HL9A 4D60A 1BLSA 1FIKA 3V3RA 4XT2A 3CHWP 3ZDJA 1GSWA 1TVFA 3E4PA 3F1PA 1VHMA 2BLSA 5FAOA 1T1BA 5HL6A 3WWXA 1P9RA 1S1YA 3HUNA 1XP4A 5K5BA 2ZQDA 3EQVA 2HJEA 5CGWA 3F1OB 3H9WA 3IBRA 1AWIA 4GNUA 5F83A 1PI5A 4DKIA 3GVBA 5EVEA 1YPRA 2H0YA 2W0NA 2LB5A 4QD4A 4JF4A 1ERQA 2A3UA 5L07A 1FQGA 4UA7A 3R7WB 2W1RA 4DE1A 1H0MA 2JKTM 3P01A 5HD5A 3A3EA 1Q2QA 1GA0A 3UB6A 3QHYA 2Y2IA 3ZGAB 4AFIA 5IS1A 4NXEA 4S2KA 2AVXA 1XJ4A 2J3TC 3UDIA 4O8GA 4QY6A 1CI8A 4JXSA 2PAVP 1MC0A 3SS5A 4GD8A 1Y4OA 3EOIA 2JHEA 2FZ0A 4IUHA 4Q8IA 1SKOB 2X02A 1G68A 2NUTC 5HWVA 4PKYA 1NXYA 5EFWA 4R4RA 4GD6A 4QY5A 5L2FA 4JXWA 1DJCA 4GB7A 1V9ZA 2GNXA 2MJ6A 5L8MA 1NYMA 5DJUA 4IHQA 3FC7A 5TBMA 5A8BA 4JBFA 4EUVA 1GA9A 5FQ9A 1KDWA 1YT4A 4FOFA 3NCKA 1K55C 4BD1A 5FA7A 2I9VA 3V5MA 2ZQCA 3PBTA 3VP3A 5DTTA 4OOLA 3QP8A 5FQQA 4JPMA 5AQ9A 4UA9A 3BY9A 2ZQ8A 3QNBA 1ODVA 3MR0A 4GN2A 1G6OA 3UPPA 3CUEA 4I38A 1IKGA 4HNBA 5G4ZA 1C3BA 3N7WA 4C75A 4ESPA 5GLAA 1FSWA 5HPIA 3LYXA 3QP5A 4JKTA 1S67L 1SDEA 2QJ5A 2ZOHA 4GW9A 3HLFA 1S1ZA 4P85A 3IBJA 1ZHHB 4GHIA 4H6JA 2WGVA 2D01A 4N9KA 4KZ7A 2K31A 1K4EA 3OOVA 1PZOA 2Y79A 2VA0A 3WRTA 4HH2A 2PHYA 1XA1A 2EA9A 2KLIA 1Y28A 5A92A 1T19A 2XEPA 2XR0A 1PW8A 1D1JA 4XXRA 1K54A 3ZG0A 3OPLA 1T1AA 5HFOA 4NETA 1DP9A 1NWZA 4NXGA 1K38A 1G5UA 5DJTA 4MBKA 3RXWA 1LL5A 4KZ9A 3UY6A 4K08A 1J9MA 2VX8A 3UE1A 2V0UA 3ZG9B 4C6YA 1KGEA 1IFQA 4GS9B 4DE0A 2P74A 3MQOA 1CEGA 3T50A 2PR6A 3F1OA 3A3JA 3UDXA 5DF9A 3ICYA 2UV0E 2ZL1B 2J3WA 2XGNA 4EBPA 4KG2A 2X01A 1K57A 2GJ3A 2WGIA 2EFXA 3E4OA 1S4RA 4KZAA 3SH7A 5AJGA 2VEAA 1YLZA 4WL9A 1SKFA 3B47A 3R7WA 3RTYA 3MKEA 5HX9A 3G2YA 2ZC4B 3TOIA 4IJGA 1XFNA 3MS6A 1YAXA 4EERA 2OLVA 1XPBA 1H8MA 1ESIA 5FSRA 2P9VB 2VZWA 1F98A 5FDSA 3BY8A 2XA7M 1KGFA 3A3FA 5J8XA 5F82A 2ZBBA 3VP4A 1HLUP 1ZC2A 3ITBA 1SDNA 1P9WA 4OPYA 5EPHA 4HBTA 4EUZA 4KZ3A 5E2EA 1W79A 3UE3A 4WMCD 1YLJA 3OCNA 3KYQA 1K6SA 2WAEA 2HZ5A 3IF6C 2CC1A 2VK3A 1KE4A 2Y2KA 4ETXA 4RYEA 1ALQA 3WS0A 4DE3A 1BUEA 4BL2A 3LY3A 3FKVA 4I3AA 4XT2B 5TFQA 1FCNA 4NK3A 2G2UA 1NY0A 4KENB 4ETZA 3VOLA 4CJNA 3HBRA 1WYBA 2B95A 4OOMA 1XJ3A 1XJ2A 2JE5A 4CLCD 4MN6A 2IWCA 3GV9A 2H10A 4S2LA 1ZKJA 3N8SA 3NULA 2J9PA 4K91A 2ZMVA 2W3EA 1NJ4A 4Y7PA 5KSHA 4N9LA 3BFCA 2IWBA 1MY8A 4Q0HA 3EGDC 5DTSA 5CGXA 4E3NA 4G3KA 3V50A 5TJJA 3UPNA 1MPLA 3DAVA 1UGUA 3OPRA 3IF6A 3C7VA 2UWXA 5DKKA 4GOGA 1K56A 2W27A 4L0LA 1NLYA 1V9YA 4KQDA 2WKPA 3BRMA 5GHXA 1P0ZA 4HJ3A 4LV1A 4FSFA 5AVEA 5KSCA 3UDFA 1JTDA 4DRTA 2XF3A 4ID4A 2PU4A 5AQAA 3ZHHA 1KGGA 4GDBA 1DP8A 3IH9A 2FFYA 5KIZA 1HD8A 2PBDP 4QWOA 3C8CA 2ZC6B 4U3TA 1OTAA 2Z2MB 3S1YA 3ITAA 5A90A 3OC2A 4MDZA 4KZ8A 4LRZE 2JKGA 5DFYA 1WYCA 2OLUA 4L9GA 3A0RA 3HLBA 1CEFA 3QP6A 3NIAA 4ZBEA 3P7NA 5IHVA 1OPXA 3TJZC 2PR5A 1L2SA 2VGKA 2WZZA 3BEBA 4CQHA 4LGWA 4GS9A 1N9BA 3LR4A 1BT5A 2ZOIA 1VB6A 3IXDA 1FCMA 3K2NA 4X1MA 3LGOA 4S2OA 4LCMA 3HUMA 4B4XA 4HP9A 2OOLA 5HD3A 3HVFA 4OP8A 2ZL1A 3QP4A 1IYQA 4II7A 3O88A 3W4PA 1IKIA 5M1AA 1PRQA 4S2NC 4S2JA 5GL9A 3O86A 1CJFA 4X55A 4Q0JA 4Z9QA 4ZJ1A 3VP1A 3FWLA 1NZOA 4I3IA 4LRYC 2EX6A 3GDIA 1FOFA 4DXCA 3OLOA 2B02A 4OQHA 5EM0A 4H6JB 3IF5A 4UQIS 4Y0TA 2P9VA 2O99A 1KVLA 3NOUC 5TGFA 3MMHA 3DWKA 5U47A 1G28A 3ZG5A 2EXBA 4EESA 1I2SA 2QHKA 3UMDA 3IWQA 3LI8A 3NI9A 4GLQA 2PD8A 3JYIA 2QWSA 2VJWA 4I5SA 5M18A 4RX2A 5FASA 1NRJA 3E0YA 1S6RA 1GSVA 4KZ4A 4EEUA 2BTFP 1BLCA 3UO9A 1HVBA 2P04A 2EX8A 4LENA 2ZM2A 1L0FA 1TS0A 3S7OA 3W4QA 4NXBA 4JXVA 3QP2A 4E04A 3W2ZA 5F69A 4OONA 1HTZA 4HJ4A 3MKFA 3QP1A 3NY4A 3C2WA 4WN5A 1CK3A 4ZTKA 1MWRA 3DBAA 4LFUA 2HDQA 4PAUA 3HLGA 1W5DA 1W63Q 2Y4AA 4YINA 1IYOA 4PMAA 5EUAA 2Y2QA 1OTDA 2Y2MA 1K4FA 3CITA 1CF0A 1W7FA 5DTKA 2X71A 1GHIA 3BFFA 3OPPA 4LLOB 1K56D 3D72A 2WYXA 4R38A 4U0TA 1LSWA 1OJGA 3VOZA 3IWOA 1XFQA 4NXFA 2W3GA 1L3LA 3CG5A 2BG1A 2HDRA 4PM9A 3T1RA 3N4IA 4Z1WA 1JNUA 3EEHA 3WS5A 5E2HA 3AGDA 3LIBA 1AXBA 2J80A 1XJ6A 4GJ4A 3Q81A 4FH4A 4G3VA 1PNEA 4I39A 2INWA 5E43A 3HCYA 4UA6A 4E3LA 2DCFA 3Q7VB 5HSQA 3GTCA 3C5AA 2Z2LB 2H5SA 3GMWA 4UQIM 1K25A 5EE8A 4I3JA 2Z6DA 1LI0A 2V1AA 2Y2NA 4X68A 1IOUA 4S2IA 3H82A 4R70A 1CQAA 3JVVA 1I2WA 2CMNA 1D7EA 3HLDA 1XA7A 3ZG7B 2EX2A 4RA7A 3F1NA 2IA2A 1K0KA 3UE0A 1N4OA 1BULA 2ACGA 4B9OA 2PD7A 3MQQA 2ZMFA 2HV1A 5L10A 5J4EA 3LUQA 4K0XA 4O7DA 4H8RA 3VE4A 4EBLA 3C38A 4BJPA 4EBNA 1E4DA 5EOOA 1XX2A 3HUOA 2O0YA 4OPQA 3K3CA 4KQRA 3W4OA 4BBUA 1ZG4A 4Y5FA 4P6ZS 3IF6B 5CTNA 5DVAA 4BENA 3DW0A 4BLMA 5HPFA 2KX6A 3T4QA 1JWZA 1EI5A 3TG9A 2JBFA 4QHCA 2WUQA 1BYWA 4LPZA 1N9OA 1K55A 2W3HA 4LRXC 3LIAA 4MEZA 1O07A 3KSFA 3LIFA 4IVKA 2R9WA 3M6HA 4S2MA 3PHYA 3CAXA 4R23A 1GHPA 3IHAA 3VFHA 4KQOA 3KSHA 3EQUA 2M7VA 4EQ1A 1N9LA 2O9BA 4KZBA 1PIOA 2P08A 5L09A 3UPOA 1RGZA 2XD5A 4PM5A 2XRNA 1OTBA 3M6BA 5GLDA 1K6RA 3O5YA 3PBQA 2Y91A 4HESA 4LCLA 4WM9A 4G3WA 1DP6A 4OQGA 5A91A 2VKSA 1Q2PA 5HDCA 5HWTA 2KOIA 4HI4A 2EFUA 3ULFA 1ES2A 5F5YA 4JLFA 4MMNA 3MXRA 2OV5A 4HHDA 1YLWA 5EVIC 3D3OA 3Q7ZA 2LB9A 3WS4A 3SOIA 5GHYA 1VQQA 2V8CA 1OT6A 4A5RA 3CI6A 3V39A 4OPRA 2C5WB 3U4LP 5CEBA 4ZJ2A 1EWZA 1YLPA 4WELA 5HAQA 2W3DA 2PRFA 4X56A 5FAQA 2OWJA 5EECA 1MBLA 4ME4A 3KX0X 1YLTA 2GX5A 4QPRA 3ZQ5A 3KSGA 2HDSA 4WEJA 5F68A 1KDSA 1P97A 2L4RA 3LEZA 3L7HA 1ES3A 1BTLA 2ZC3B 3VV4A 4ARZB 3T4SA 3FG8A 3IX4A 3PAGA 3LCEA 2JKRI 3NC8A 1L0DA 4X1LA 2A2LA 3Q7VA 3VP2A 4QB8A 1NRFA 1RCJA 4WLAA 4P6ZM 2QMIA 4E3KA 3ZYTA 3RXXA 2Y2HA 1PYYA 3SS3A 3FPVA 1U60A 4EWFA 2VGLS 4F3LA 2L0WA 1WA9A 1ONHA 1SHVA 5F1GA 4GCZA 2WAFA 1J3WA 5A93A 1F9IA 3C4OA 3P98A 3LO7A 4KZ5A 4B4ZA 2R78A 5GHZA 2WK0A 3T4JA 5BOHA 3HLWA 3NOPC 1EROA 2EWWA 2I72A 4FUWA 4OLDA 1FR6A 2PBYA 4EXOA 5HDDA 3CJMA 4IBXA 5CERA 3UE6A 5J3WA 1RP5A 4MNRA 4WZ5C 1Z6FA 3U2AA 3C30A 2ZJ9A 2JN7A 3H7WA 4KG6A 4DF6A 3HREA 5HWWA 2DNSA 2VGJA 2A49A 5HAIA 3Q82A 4PKYG 3C4PA 4NEED 3NHQA 1M6KA 1YKDA 3QNCA 3AGEA 1LLBA 4OPZA 3SH9A 4JGRA 1KE3A 4E6WA 3BFGA 5DF7A 1N9NA 3NDEA 4IEDA 3BLMA 2Y2LA 1H8YA 1PWGA 2G7UA 4OQ0A 3MBZA 3WS2A 3MZFA 3CLOA 1BLHA 3HLEA 1YSPA 1PWDA 3K3DA 2Y2GA 1TD5A 2W1TB 5FQIA 4E3IA 5D3OA 4EU0A 5KZHA 3H82B 4X25A 2KDKA 1TS7A 4IVIA 1DY6A 3RFBA 1LL9A 5AVFA 3IX8A 3G2ZA 4OLGA 4WZ5A 2JKFA 4EEPA 3F1NB 1ERMA 3KYEA 2HDUA 1F2KA 5DF8A 4GKUA 5CECA 1T1CA 5HAPA 2VGLM 5FATA
chains in the Genus database with same CATH topology
5A92A 5JYPA 3CG5A 4R3JA 2BG1A 2HDRA 3PBNA 4PM9A 2XEPA 2EX9A 2XR0A 1NYYA 1PW8A 3N4IA 4PM8A 1K54A 3NBLA 4XXRA 3ZG0A 3PBRA 3WS5A 3OPLA 2DRWA 1QMFA 5E2HA 3AGDA 1AXBA 5HFOA 4QJGA 4NETA 3BECA 4FD8A 3S22A 1YM1A 3IXHA 3VOYA 1XXMA 4DDSA 4M3KA 1K38A 1BSGA 4OVDA 2Q9MA 4MBKA 3RXWA 1LL5A 4KZ9A 3UY6A 3O87A 2V2FF 5CHMA 3Q81A 4FH4A 1J9MA 5FI2A 3ZVWA 4PPRA 3UE1A 1IELA 5I94A 2RCXA 3ZG9B 4C6YA 5HARA 1H5XA 3IWIA 1M40A 5E43A 5GLBA 4UA6A 1S0WA 1KGEA 4E3LA 2DCFA 2V1ZA 3Q7VB 4FH2A 3IHBA 2XLNA 3GTCA 2HP9A 2XK1A 4DE0A 2P74A 3C5AA 4Y0UA 2Z2LB 4E3MA 1CEGA 2H5SA 3IH8A 3GMWA 1K25A 5EE8A 4MBHA 1LI0A 2Y2NA 3A3JA 5FDHA 2ZD8A 3UDXA 3C7UA 4X68A 5DF9A 1GHMA 4S2PA 1E25A 4S2IA 2XGNA 3UN7A 4EBPA 4KG2A 2X01A 3DTMA 1K57A 3Q07A 5F1FA 1MWTA 1I2WA 2XD1A 1ES5A 2J9OA 1W8YA 2WGIA 3HLDA 1XA7A 2HPBA 2EFXA 1PI4A 3VSKA 1BLPA 2B5RA 1QMEA 4S2NA 2XFSA 1OMEA 3BM6A 4KZAA 5FQMA 3SH7A 3RJUA 3ZG7B 2EX2A 1YLZA 4RA7A 3MZDA 2ZQAA 1SKFA 4B88A 1YLYA 2Y2PA 3TSGA 3MKEA 5HX9A 3UE0A 1N4OA 3G2YA 5EOEA 1BULA 2ZC4B 3P09A 3TOIA 2JCHA 5HW3A 5HL1A 4E6XA 4HBUA 5CXWA 1YMSA 3SS4A 4K0XA 2OLVA 1IEMA 1XPBA 4O7DA 2Y55A 1ESIA 3LY4A 4H8RA 3CZDA 4WZ4A 5FSRA 1PWCA 1YQSA 4EBLA 2P9VB 1E3UA 3BFEA 3HLCA 1GCEA 4BJPA 1KGFA 3OZHA 3A3FA 4EBNA 1Y54A 3VSLA 1KE0A 5J8XA 1E4DA 5EOOA 5F82A 2RL3A 3VP4A 1XX2A 1FR1A 1ZC2A 3HUOA 3ITBA 1TEMA 4OPQA 4KQRA 3W4OA 1SDNA 3ZCZA 3S4XA 4ZDXA 1ZG4A 4X53A 2ZM8A 4R1GA 4R3BA 2H0TA 3G32A 3IF6B 4Y0OA 3PAEA 4OPYA 5CTNA 5DVAA 3DW0A 4BENA 3M2KA 5EPHA 4HBTA 4BLMA 4BQMA 3ZFZA 1DJBA 4EUZA 4KZ3A 1JWZA 4P6BA 2V20A 1VM1A 1W79A 4WEKA 5E2EA 4EQIA 5M19A 3UE3A 4WMCD 1YLJA 2HP5A 3G4PA 1EI5A 2ZMAA 3OCNA 2ZQ7A 5FQKA 4P0MA 2Q9NA 2JBFA 1K6SA 4OKPA 3TG9A 2WAEA 3IF6C 2CC1A 1IYPA 4QHCA 2WUQA 4OOYA 1MXOA 3GRJA 1KE4A 2Y2KA 1ZG6A 2GDNA 1K55A 2ZC7A 4RYEA 1ALQA 1TDGA 3WS0A 4DE3A 3N8RA 1BUEA 4MBFA 4WYYA 3SH8A 3PBOA 4BL2A 3LY3A 2XFTA 4LV2A 3FKVA 5CEDA 1LHYA 4MEZA 4UAAA 5EVLA 1O07A 4IVKA 4DDYA 2R9WA 2J8YA 3M6HA 5TFQA 4S2MA 1FCNA 4NK3A 4U0XA 2G2UA 4F94A 3A3DA 5G18A 4R23A 1GHPA 1NY0A 5KMWA 4KENB 3V3SA 3IHAA 1LI9A 3VFHA 3DWZA 3ZVTA 1FCOA 4GZBA 2QZ6A 4JF5A 4KQOA 4CJNA 3HBRA 4HEFA 3WS1A 1WYBA 3M2JA 4OOMA 1SCWA 3EQUA 1BZAA 4KZBA 1TDLA 1PIOA 4BL3A 1XKZA 4IBRA 2WZXA 4QU3A 3G35A 2JE5A 3BLSA 3UPOA 2ZC5B 3IXBA 1RGZA 2OSUA 2XD5A 4PM5A 2FFFB 5GLDA 3M6BA 1K6RA 2G2WA 3E2LA 4LV0A 3BYDA 3PBQA 4KZ6A 3OCLA 2Y91A 2IWCA 3GV9A 4HESA 2H10A 4LCLA 4S2LA 1ZKJA 3N8SA 4WM9A 3UNWA 3PBSA 5AQBA 2J9PA 4K91A 4OQGA 4WBGA 2WKIA 4XUXA 5JYOA 4MLLA 3MFDA 1Q2PA 4Y7PA 1NJ4A 5A91A 5KSHA 5CRFA 4PM6A 4N9LA 3BFCA 4YFMA 2IWBA 1MY8A 5EVIB 1CI9A 4FCFA 2EFUA 2ZLYA 5CGXA 5DTSA 3FV7A 4E3NA 1ES2A 5E2GA 1HZOA 3A3IA 4JLFA 3V50A 2WGWA 4R0QA 3ZNYA 3UPNA 3ISGA 1MPLA 4X6TA 5EVID 4WMCA 4X69A 3MXRA 4KG5A 3OPRA 4E3JA 3IF6A 2OV5A 4N92A 3C7VA 2UWXA 1YLWA 3I7JA 4ZJ3A 4GOGA 1K56A 3BFDA 3O3VA 5CGSA 5EVIC 4L0LA 3Q7ZA 5E2FA 1PW1A 3WS4A 3BRMA 5GHXA 3SOIA 4LV1A 5GHYA 4FSFA 5KSCA 2ZQ9A 1O7EA 1VQQA 3UDFA 2Y2JA 1DJAA 1XGJA 2XQZA 1JTDA 4A5RA 4DRTA 3ZG8B 3V39A 4DE2A 2XF3A 4OPRA 3IQAA 4ID4A 3Q1FA 2PU4A 2C5WB 2JC7A 1K54C 1KGGA 3FYZA 4JF6A 4GDBA 5AQAA 3ZHHA 2EXAA 3IH9A 2FFYA 1RGYA 4RX3A 1HD8A 4ZJ2A 5CEBA 1EWZA 1YLPA 2R9XA 2WADA 4WELA 5HAQA 1ESUA 3HL9A 1L0GA 1YMXA 4X56A 1BLSA 2ZC6B 4U3TA 5EECA 4ZAMA 5FAQA 3W8KA 1MBLA 3GSGA 5GLCA 3V3RA 1YLTA 2Z2MB 4RVAA 3S1YA 3ZDJA 3ITAA 2HP6A 5A90A 3OC2A 1TVFA 2XDMA 2HDSA 4WEJA 2BLSA 5AQ7A 4KZ8A 1KDSA 5FAOA 3D4FA 3WWXA 1MWSA 1JVJA 1WYCA 1PZPA 1XP4A 2OLUA 3HUNA 3LEZA 3HLBA 2ZQDA 1CEFA 1ES3A 3EQVA 3IT9A 1BTLA 2ZC3B 3NIAA 5CGWA 4ZBEA 2J7VA 5IHVA 3PAGA 3LCEA 3NC8A 4GNUA 1L2SA 1L0DA 2VGKA 5F83A 3VP2A 3Q7VA 2WZZA 3BEBA 4QB8A 1NRFA 1N9BA 1PI5A 1RCJA 4DKIA 4PM7A 4EV4A 1BT5A 3GVBA 1L0EA 2H0YA 1XGIA 4N1XA 4E3KA 2QMIA 3IXDA 4QD4A 2Y2HA 1FCMA 1PYYA 3B3XA 3RXXA 3SS3A 4JF4A 2WKHA 4S2OA 1U60A 1ERQA 2A3UA 4EWFA 5FQJA 3ZNTA 4LCMA 2XH9A 3VP0A 3HUMA 4B4XA 4LV3A 1FQGA 4UA7A 4OH0A 5FAPA 1K57C 4OQIA 3HVFA 1G6AA 4OP8A 1ONHA 1SHVA 5F1GA 4BD0A 4N1HA 1IYQA 4DE1A 3O88A 2WAFA 3W4PA 2C6WB 1IKIA 3A3EA 1Q2QA 5M1AA 4S2NC 2QPNA 1GA0A 1WE4A 4JXGA 4S2JA 5A93A 1FSYA 1MKIA 5GL9A 3QHYA 3IXGA 3O86A 2Y2IA 3ZGAB 4X55A 3C4OA 3P98A 3LO7A 4KZ5A 3G34A 4B4ZA 4S2KA 4Z9QA 4ZJ1A 3VP1A 5GHZA 3FWLA 3UDIA 1NZOA 5TR7A 1E3UD 2WK0A 4QY6A 1JWPA 1CI8A 4JXSA 3GR2A 5CHUA 5CHJA 2EX6A 1FOFA 5BOHA 5FI6A 1W8QA 3SS5A 4DXCA 4GD8A 4KQQA 4Q8IA 3HLWA 4OP5A 4OQHA 3IF5A 4Y0TA 3E2KA 2X02A 1G68A 2P9VA 1EROA 2IWDA 1KVLA 2I72A 1NXYA 4R4RA 5TGFA 4OLDA 1FR6A 2PBYA 1KVMA 3DWKA 4GD6A 5U47A 3ZG5A 2EXBA 3CJMA 4IBXA 4QY5A 5CERA 1RP5A 1I2SA 4MNRA 4WZ5C 3N8LA 5L2FA 4JXWA 1Z6FA 1DJCA 3IWQA 4GB7A 3NI9A 1JTGA 3AGFA 2ZJ9A 1NYMA 2Y2OA 3VFFA 3JYIA 1IYSA 1NZUA 4KG6A 4DF6A 4RX2A 5M18A 3HREA 4JBFA 5FASA 2DNSA 1GA9A 2VGJA 2A49A 1JWVA 5FQ9A 5HAIA 2WKEA 4R4SA 3Q82A 1KDWA 1S6RA 1YT4A 3C4PA 4E3OA 3NCKA 1K55C 4KZ4A 4BD1A 4DXBA 5FA7A 3G31A 4CPKA 1M6KA 1BLCA 3UO9A 1HVBA 3QNCA 2ZQCA 3V5MA 3PBTA 3VP3A 5DTTA 3AGEA 4OOLA 2EX8A 3MXSA 4LENA 5FQQA 3PTEA 1LLBA 2Y59A 4JPMA 2ZM2A 1L0FA 4OPZA 5AQ9A 4UA9A 3W4QA 3SH9A 2ZQ8A 3QNBA 4JXVA 1KE3A 4E6WA 1ES4A 4GN2A 3BFGA 5DF7A 3UPPA 1IKGA 2PU2A 3NDEA 4OONA 1HTZA 4IEDA 3BLMA 2Y2LA 1H8YA 1PWGA 3FZCA 3MKFA 4OQ0A 3NDGA 1C3BA 3MBZA 3NY4A 3WS2A 4UHUA 3N7WA 4C75A 1MWUA 1CK3A 4ZTKA 3MZFA 3HLEA 1BLHA 1MWRA 5GLAA 1FSWA 2HDQA 3CMZA 3G30A 3N6IA 1PWDA 4GDNA 4K0WA 3HLGA 2Y2GA 1W5DA 5FQIA 4E3IA 2Y4AA 5D3OA 4JKTA 5KZHA 4YINA 1IYOA 4PMAA 4C3QA 5EUAA 1SDEA 4IVIA 2WGWB 5CTMA 2Y2QA 1DY6A 3HLFA 4P85A 2Y2MA 2ZM0A 1LL9A 1ONGA 2E8IA 3G2ZA 4OLGA 4WZ5A 2WGVA 1K4FA 4XUZA 4N9KA 4KZ7A 1W7FA 5DTKA 1H8ZA 2X71A 3FKWA 1GHIA 3BFFA 3OPPA 1ERMA 3OPHA 1K4EA 5FI7A 1PZOA 4D2OA 5EVIA 1K56D 2HDUA 3WRTA 3VMAA 4P87A 5DF8A 1XA1A 2WYXA 4GKUA 4U0TA 3GQZA 5CECA 3VOZA 3IWOA 5HAPA 3MZEA 1I5QA 5FATA 3WRZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A92 A;  5JYP A;  3CG5 A;  4R3J A;  2BG1 A;  2HDR A;  3PBN A;  4PM9 A;  2XEP A;  2EX9 A;  2XR0 A;  1NYY A;  1PW8 A;  3N4I A;  4PM8 A;  1K54 A;  3NBL A;  4XXR A;  3ZG0 A;  3PBR A;  3WS5 A;  3OPL A;  2DRW A;  1QMF A;  5E2H A;  3AGD A;  1AXB A;  5HFO A;  4QJG A;  4NET A;  3BEC A;  4FD8 A;  3S22 A;  1YM1 A;  3IXH A;  3VOY A;  1XXM A;  4DDS A;  4M3K A;  1K38 A;  1BSG A;  4OVD A;  2Q9M A;  4MBK A;  3RXW A;  1LL5 A;  4KZ9 A;  3UY6 A;  3O87 A;  2V2F F;  5CHM A;  3Q81 A;  4FH4 A;  1J9M A;  5FI2 A;  3ZVW A;  4PPR A;  3UE1 A;  1IEL A;  5I94 A;  2RCX A;  3ZG9 B;  4C6Y A;  5HAR A;  1H5X A;  3IWI A;  1M40 A;  5E43 A;  5GLB A;  4UA6 A;  1S0W A;  1KGE A;  4E3L A;  2DCF A;  2V1Z A;  3Q7V B;  4FH2 A;  3IHB A;  2XLN A;  3GTC A;  2HP9 A;  2XK1 A;  4DE0 A;  2P74 A;  3C5A A;  4Y0U A;  2Z2L B;  4E3M A;  1CEG A;  2H5S A;  3IH8 A;  3GMW A;  1K25 A;  5EE8 A;  4MBH A;  1LI0 A;  2Y2N A;  3A3J A;  5FDH A;  2ZD8 A;  3UDX A;  3C7U A;  4X68 A;  5DF9 A;  1GHM A;  4S2P A;  1E25 A;  4S2I A;  2XGN A;  3UN7 A;  4EBP A;  4KG2 A;  2X01 A;  3DTM A;  1K57 A;  3Q07 A;  5F1F A;  1MWT A;  1I2W A;  2XD1 A;  1ES5 A;  2J9O A;  1W8Y A;  2WGI A;  3HLD A;  1XA7 A;  2HPB A;  2EFX A;  1PI4 A;  3VSK A;  1BLP A;  2B5R A;  1QME A;  4S2N A;  2XFS A;  1OME A;  3BM6 A;  4KZA A;  5FQM A;  3SH7 A;  3RJU A;  3ZG7 B;  2EX2 A;  1YLZ A;  4RA7 A;  3MZD A;  2ZQA A;  1SKF A;  4B88 A;  1YLY A;  2Y2P A;  3TSG A;  3MKE A;  5HX9 A;  3UE0 A;  1N4O A;  3G2Y A;  5EOE A;  1BUL A;  2ZC4 B;  3P09 A;  3TOI A;  2JCH A;  5HW3 A;  5HL1 A;  4E6X A;  4HBU A;  5CXW A;  1YMS A;  3SS4 A;  4K0X A;  2OLV A;  1IEM A;  1XPB A;  4O7D A;  2Y55 A;  1ESI A;  3LY4 A;  4H8R A;  3CZD A;  4WZ4 A;  5FSR A;  1PWC A;  1YQS A;  4EBL A;  2P9V B;  1E3U A;  3BFE A;  3HLC A;  1GCE A;  4BJP A;  1KGF A;  3OZH A;  3A3F A;  4EBN A;  1Y54 A;  3VSL A;  1KE0 A;  5J8X A;  1E4D A;  5EOO A;  5F82 A;  2RL3 A;  3VP4 A;  1XX2 A;  1FR1 A;  1ZC2 A;  3HUO A;  3ITB A;  1TEM A;  4OPQ A;  4KQR A;  3W4O A;  1SDN A;  3ZCZ A;  3S4X A;  4ZDX A;  1ZG4 A;  4X53 A;  2ZM8 A;  4R1G A;  4R3B A;  2H0T A;  3G32 A;  3IF6 B;  4Y0O A;  3PAE A;  4OPY A;  5CTN A;  5DVA A;  3DW0 A;  4BEN A;  3M2K A;  5EPH A;  4HBT A;  4BLM A;  4BQM A;  3ZFZ A;  1DJB A;  4EUZ A;  4KZ3 A;  1JWZ A;  4P6B A;  2V20 A;  1VM1 A;  1W79 A;  4WEK A;  5E2E A;  4EQI A;  5M19 A;  3UE3 A;  4WMC D;  1YLJ A;  2HP5 A;  3G4P A;  1EI5 A;  2ZMA A;  3OCN A;  2ZQ7 A;  5FQK A;  4P0M A;  2Q9N A;  2JBF A;  1K6S A;  4OKP A;  3TG9 A;  2WAE A;  3IF6 C;  2CC1 A;  1IYP A;  4QHC A;  2WUQ A;  4OOY A;  1MXO A;  3GRJ A;  1KE4 A;  2Y2K A;  1ZG6 A;  2GDN A;  1K55 A;  2ZC7 A;  4RYE A;  1ALQ A;  1TDG A;  3WS0 A;  4DE3 A;  3N8R A;  1BUE A;  4MBF A;  4WYY A;  3SH8 A;  3PBO A;  4BL2 A;  3LY3 A;  2XFT A;  4LV2 A;  3FKV A;  5CED A;  1LHY A;  4MEZ A;  4UAA A;  5EVL A;  1O07 A;  4IVK A;  4DDY A;  2R9W A;  2J8Y A;  3M6H A;  5TFQ A;  4S2M A;  1FCN A;  4NK3 A;  4U0X A;  2G2U A;  4F94 A;  3A3D A;  5G18 A;  4R23 A;  1GHP A;  1NY0 A;  5KMW A;  4KEN B;  3V3S A;  3IHA A;  1LI9 A;  3VFH A;  3DWZ A;  3ZVT A;  1FCO A;  4GZB A;  2QZ6 A;  4JF5 A;  4KQO A;  4CJN A;  3HBR A;  4HEF A;  3WS1 A;  1WYB A;  3M2J A;  4OOM A;  1SCW A;  3EQU A;  1BZA A;  4KZB A;  1TDL A;  1PIO A;  4BL3 A;  1XKZ A;  4IBR A;  2WZX A;  4QU3 A;  3G35 A;  2JE5 A;  3BLS A;  3UPO A;  2ZC5 B;  3IXB A;  1RGZ A;  2OSU A;  2XD5 A;  4PM5 A;  2FFF B;  5GLD A;  3M6B A;  1K6R A;  2G2W A;  3E2L A;  4LV0 A;  3BYD A;  3PBQ A;  4KZ6 A;  3OCL A;  2Y91 A;  2IWC A;  3GV9 A;  4HES A;  2H10 A;  4LCL A;  4S2L A;  1ZKJ A;  3N8S A;  4WM9 A;  3UNW A;  3PBS A;  5AQB A;  2J9P A;  4K91 A;  4OQG A;  4WBG A;  2WKI A;  4XUX A;  5JYO A;  4MLL A;  3MFD A;  1Q2P A;  4Y7P A;  1NJ4 A;  5A91 A;  5KSH A;  5CRF A;  4PM6 A;  4N9L A;  3BFC A;  4YFM A;  2IWB A;  1MY8 A;  5EVI B;  1CI9 A;  4FCF A;  2EFU A;  2ZLY A;  5CGX A;  5DTS A;  3FV7 A;  4E3N A;  1ES2 A;  5E2G A;  1HZO A;  3A3I A;  4JLF A;  3V50 A;  2WGW A;  4R0Q A;  3ZNY A;  3UPN A;  3ISG A;  1MPL A;  4X6T A;  5EVI D;  4WMC A;  4X69 A;  3MXR A;  4KG5 A;  3OPR A;  4E3J A;  3IF6 A;  2OV5 A;  4N92 A;  3C7V A;  2UWX A;  1YLW A;  3I7J A;  4ZJ3 A;  4GOG A;  1K56 A;  3BFD A;  3O3V A;  5CGS A;  5EVI C;  4L0L A;  3Q7Z A;  5E2F A;  1PW1 A;  3WS4 A;  3BRM A;  5GHX A;  3SOI A;  4LV1 A;  5GHY A;  4FSF A;  5KSC A;  2ZQ9 A;  1O7E A;  1VQQ A;  3UDF A;  2Y2J A;  1DJA A;  1XGJ A;  2XQZ A;  1JTD A;  4A5R A;  4DRT A;  3ZG8 B;  3V39 A;  4DE2 A;  2XF3 A;  4OPR A;  3IQA A;  4ID4 A;  3Q1F A;  2PU4 A;  2C5W B;  2JC7 A;  1K54 C;  1KGG A;  3FYZ A;  4JF6 A;  4GDB A;  5AQA A;  3ZHH A;  2EXA A;  3IH9 A;  2FFY A;  1RGY A;  4RX3 A;  1HD8 A;  4ZJ2 A;  5CEB A;  1EWZ A;  1YLP A;  2R9X A;  2WAD A;  4WEL A;  5HAQ A;  1ESU A;  3HL9 A;  1L0G A;  1YMX A;  4X56 A;  1BLS A;  2ZC6 B;  4U3T A;  5EEC A;  4ZAM A;  5FAQ A;  3W8K A;  1MBL A;  3GSG A;  5GLC A;  3V3R A;  1YLT A;  2Z2M B;  4RVA A;  3S1Y A;  3ZDJ A;  3ITA A;  2HP6 A;  5A90 A;  3OC2 A;  1TVF A;  2XDM A;  2HDS A;  4WEJ A;  2BLS A;  5AQ7 A;  4KZ8 A;  1KDS A;  5FAO A;  3D4F A;  3WWX A;  1MWS A;  1JVJ A;  1WYC A;  1PZP A;  1XP4 A;  2OLU A;  3HUN A;  3LEZ A;  3HLB A;  2ZQD A;  1CEF A;  1ES3 A;  3EQV A;  3IT9 A;  1BTL A;  2ZC3 B;  3NIA A;  5CGW A;  4ZBE A;  2J7V A;  5IHV A;  3PAG A;  3LCE A;  3NC8 A;  4GNU A;  1L2S A;  1L0D A;  2VGK A;  5F83 A;  3VP2 A;  3Q7V A;  2WZZ A;  3BEB A;  4QB8 A;  1NRF A;  1N9B A;  1PI5 A;  1RCJ A;  4DKI A;  4PM7 A;  4EV4 A;  1BT5 A;  3GVB A;  1L0E A;  2H0Y A;  1XGI A;  4N1X A;  4E3K A;  2QMI A;  3IXD A;  4QD4 A;  2Y2H A;  1FCM A;  1PYY A;  3B3X A;  3RXX A;  3SS3 A;  4JF4 A;  2WKH A;  4S2O A;  1U60 A;  1ERQ A;  2A3U A;  4EWF A;  5FQJ A;  3ZNT A;  4LCM A;  2XH9 A;  3VP0 A;  3HUM A;  4B4X A;  4LV3 A;  1FQG A;  4UA7 A;  4OH0 A;  5FAP A;  1K57 C;  4OQI A;  3HVF A;  1G6A A;  4OP8 A;  1ONH A;  1SHV A;  5F1G A;  4BD0 A;  4N1H A;  1IYQ A;  4DE1 A;  3O88 A;  2WAF A;  3W4P A;  2C6W B;  1IKI A;  3A3E A;  1Q2Q A;  5M1A A;  4S2N C;  2QPN A;  1GA0 A;  1WE4 A;  4JXG A;  4S2J A;  5A93 A;  1FSY A;  1MKI A;  5GL9 A;  3QHY A;  3IXG A;  3O86 A;  2Y2I A;  3ZGA B;  4X55 A;  3C4O A;  3P98 A;  3LO7 A;  4KZ5 A;  3G34 A;  4B4Z A;  4S2K A;  4Z9Q A;  4ZJ1 A;  3VP1 A;  5GHZ A;  3FWL A;  3UDI A;  1NZO A;  5TR7 A;  1E3U D;  2WK0 A;  4QY6 A;  1JWP A;  1CI8 A;  4JXS A;  3GR2 A;  5CHU A;  5CHJ A;  2EX6 A;  1FOF A;  5BOH A;  5FI6 A;  1W8Q A;  3SS5 A;  4DXC A;  4GD8 A;  4KQQ A;  4Q8I A;  3HLW A;  4OP5 A;  4OQH A;  3IF5 A;  4Y0T A;  3E2K A;  2X02 A;  1G68 A;  2P9V A;  1ERO A;  2IWD A;  1KVL A;  2I72 A;  1NXY A;  4R4R A;  5TGF A;  4OLD A;  1FR6 A;  2PBY A;  1KVM A;  3DWK A;  4GD6 A;  5U47 A;  3ZG5 A;  2EXB A;  3CJM A;  4IBX A;  4QY5 A;  5CER A;  1RP5 A;  1I2S A;  4MNR A;  4WZ5 C;  3N8L A;  5L2F A;  4JXW A;  1Z6F A;  1DJC A;  3IWQ A;  4GB7 A;  3NI9 A;  1JTG A;  3AGF A;  2ZJ9 A;  1NYM A;  2Y2O A;  3VFF A;  3JYI A;  1IYS A;  1NZU A;  4KG6 A;  4DF6 A;  4RX2 A;  5M18 A;  3HRE A;  4JBF A;  5FAS A;  2DNS A;  1GA9 A;  2VGJ A;  2A49 A;  1JWV A;  5FQ9 A;  5HAI A;  2WKE A;  4R4S A;  3Q82 A;  1KDW A;  1S6R A;  1YT4 A;  3C4P A;  4E3O A;  3NCK A;  1K55 C;  4KZ4 A;  4BD1 A;  4DXB A;  5FA7 A;  3G31 A;  4CPK A;  1M6K A;  1BLC A;  3UO9 A;  1HVB A;  3QNC A;  2ZQC A;  3V5M A;  3PBT A;  3VP3 A;  5DTT A;  3AGE A;  4OOL A;  2EX8 A;  3MXS A;  4LEN A;  5FQQ A;  3PTE A;  1LLB A;  2Y59 A;  4JPM A;  2ZM2 A;  1L0F A;  4OPZ A;  5AQ9 A;  4UA9 A;  3W4Q A;  3SH9 A;  2ZQ8 A;  3QNB A;  4JXV A;  1KE3 A;  4E6W A;  1ES4 A;  4GN2 A;  3BFG A;  5DF7 A;  3UPP A;  1IKG A;  2PU2 A;  3NDE A;  4OON A;  1HTZ A;  4IED A;  3BLM A;  2Y2L A;  1H8Y A;  1PWG A;  3FZC A;  3MKF A;  4OQ0 A;  3NDG A;  1C3B A;  3MBZ A;  3NY4 A;  3WS2 A;  4UHU A;  3N7W A;  4C75 A;  1MWU A;  1CK3 A;  4ZTK A;  3MZF A;  3HLE A;  1BLH A;  1MWR A;  5GLA A;  1FSW A;  2HDQ A;  3CMZ A;  3G30 A;  3N6I A;  1PWD A;  4GDN A;  4K0W A;  3HLG A;  2Y2G A;  1W5D A;  5FQI A;  4E3I A;  2Y4A A;  5D3O A;  4JKT A;  5KZH A;  4YIN A;  1IYO A;  4PMA A;  4C3Q A;  5EUA A;  1SDE A;  4IVI A;  2WGW B;  5CTM A;  2Y2Q A;  1DY6 A;  3HLF A;  4P85 A;  2Y2M A;  2ZM0 A;  1LL9 A;  1ONG A;  2E8I A;  3G2Z A;  4OLG A;  4WZ5 A;  2WGV A;  1K4F A;  4XUZ A;  4N9K A;  4KZ7 A;  1W7F A;  5DTK A;  1H8Z A;  2X71 A;  3FKW A;  1GHI A;  3BFF A;  3OPP A;  1ERM A;  3OPH A;  1K4E A;  5FI7 A;  1PZO A;  4D2O A;  5EVI A;  1K56 D;  2HDU A;  3WRT A;  3VMA A;  4P87 A;  5DF8 A;  1XA1 A;  2WYX A;  4GKU A;  4U0T A;  3GQZ A;  5CEC A;  3VOZ A;  3IWO A;  5HAP A;  3MZE A;  1I5Q A;  5FAT A;  3WRZ A; 
#chains in the Genus database with same CATH topology
 2OAP 1;  5JYP A;  2M1C A;  1NYY A;  4PM8 A;  3NBL A;  2DMW A;  3PBR A;  4FD8 A;  3S22 A;  1YM1 A;  3IXH A;  3UB9 A;  4M3K A;  1BSG A;  4OVD A;  3O87 A;  5CHM A;  3ZVW A;  4HIA A;  2W3F A;  2RCX A;  3CPT B;  3IWI A;  5IT5 A;  4FTX A;  1S0W A;  2XLN A;  2XK1 A;  4E3M A;  3IH8 A;  5DKL A;  2HF6 A;  1DRM A;  4ARZ A;  2BAS A;  1GHM A;  4RQ9 A;  4DN0 A;  3DTM A;  3Q07 A;  5F1F A;  1A0K A;  1MWT A;  2HPB A;  1PI4 A;  2B5R A;  4S2N A;  2XFS A;  5FQM A;  4DJ3 A;  3EWK A;  3MZD A;  4B88 A;  2Y2P A;  4O0P A;  3TSG A;  1SZV A;  5HW3 A;  5HL1 A;  4HBU A;  3UB7 A;  3JVU A;  1YMS A;  3SS4 A;  5CX7 A;  3CZD A;  1YQS A;  1E3U A;  1S4S A;  3HLC A;  2O9A A;  3E98 A;  2V8F A;  1Y54 A;  3LFV A;  3ZCZ A;  3S4X A;  4X53 A;  3MFX A;  3PR6 A;  4R1G A;  2H0T A;  5FEF A;  3PAE A;  2OWH A;  4JGQ A;  3ZFZ A;  4EQI A;  4Y13 A;  3G4P A;  1F5M A;  2ZMA A;  4HQA A;  2ZQ7 A;  4P0M A;  2Q9N A;  4OKP A;  1IYP A;  4OOY A;  2GDN A;  3T4O A;  3N8R A;  4MBF A;  4WYY A;  5MC7 A;  2XFT A;  4LV2 A;  5CED A;  4UAA A;  5G4Y A;  4DDY A;  2J8Y A;  2V0W A;  4U0X A;  4F94 A;  5G18 A;  2QKP A;  5KMW A;  1EW0 A;  3ZVT A;  1FCO A;  4GZB A;  2QZ6 A;  4HEF A;  1OT9 A;  3WS1 A;  3CUE C;  2JKT I;  1SCW A;  1TS6 A;  3S7Q A;  1T18 A;  4BL3 A;  1XKZ A;  3G6O A;  4IBR A;  5HDS A;  2WZX A;  4B93 A;  2FH5 A;  3BLS A;  2ZC5 B;  3DTE A;  3IXB A;  2OSU A;  3LEQ A;  1PFL A;  3E2L A;  4BWI A;  2HJ9 C;  4CLC C;  4KZ6 A;  2B18 A;  3BWL A;  4F3L B;  2WKI A;  1LSV A;  3MFD A;  2W1T A;  4PM6 A;  4YFM A;  1VET A;  5EVI B;  1CI9 A;  1UWN X;  2ZLY A;  3PYP A;  4Y2F A;  2QJ7 A;  5E2G A;  1HZO A;  2E8J A;  4R0Q A;  3UB5 P;  3ZNY A;  1LL8 A;  3MQ0 A;  4X6T A;  5EM1 A;  3KO6 A;  4WMC A;  4KG5 A;  3T4L A;  3UME A;  1VEU A;  4N92 A;  3I7J A;  4ZJ3 A;  3BFD A;  5CGS A;  1MZU A;  4DJ2 A;  5E2F A;  1PW1 A;  3BQ8 A;  1DJA A;  1XGJ A;  4HP4 A;  4WUJ A;  3T1S A;  3ZG8 B;  4HOI A;  4DE2 A;  3IQA A;  2JC7 A;  1K54 C;  3FYZ A;  4JF6 A;  3VE3 A;  2XRO A;  2EXA A;  4UEY A;  2K7S A;  4Y3I A;  2WAD A;  1ESU A;  1L0G A;  2M7U A;  1YMX A;  3W8K A;  4ZAM A;  5DFX A;  3GSG A;  5GLC A;  1W63 M;  4RVA A;  2XA7 S;  3T12 B;  2HP6 A;  4YWZ A;  4NKP A;  2XDM A;  5AQ7 A;  3D4F A;  1MWS A;  1JVJ A;  3H7W B;  1PZP A;  3IT9 A;  3JPU A;  2J7V A;  3CPT A;  3IS2 B;  2VV7 A;  2NUP C;  4CLC A;  3MSH A;  1MKM A;  3MJQ A;  3SW1 A;  2V9A A;  2P7J A;  4EV4 A;  4PM7 A;  4PHT A;  1L0E A;  1XGI A;  4N1X A;  2VV8 A;  3B3X A;  2WKH A;  2V1B A;  3KSI A;  2WKQ A;  5FQJ A;  3B33 A;  3ZNT A;  2XH9 A;  5LBR A;  4LV3 A;  5FAP A;  4OH0 A;  1K57 C;  4OQI A;  1G6A A;  4BD0 A;  4N1H A;  4BMW A;  2C6W B;  2XSS A;  5IU1 A;  2QPN A;  1WE4 A;  4JXG A;  1FSY A;  1MKI A;  3IXG A;  3CWF A;  1KOU A;  3HJI A;  3G34 A;  3BQA A;  4CLC E;  4L9F A;  5TR7 A;  1E3U D;  2O9C A;  1JWP A;  5FEG A;  3V67 A;  2A24 B;  3GR2 A;  5CHU A;  4IUK A;  1OTI A;  5CHJ A;  5FI6 A;  1W8Q A;  4KQQ A;  4OP5 A;  3E2K A;  1X0O A;  2IWD A;  2OAQ 1;  5F6A A;  1KVM A;  1ZTU A;  3LR3 A;  4Q0I A;  3N8L A;  1JTG A;  3AGF A;  3VFF A;  2Y2O A;  1IYS A;  1NZU A;  2VV6 A;  4MCW A;  1JWV A;  2WKE A;  4R4S A;  4MN7 A;  1UWP X;  2Q0O A;  4E3O A;  3S7P A;  4DXB A;  3A0S A;  3G31 A;  5C5K A;  4CPK A;  3MXS A;  3PTE A;  2Y59 A;  1ES4 A;  4R6L A;  5J7E A;  2PU2 A;  2JKR M;  3FZC A;  1NLZ A;  3NDG A;  4HH3 A;  4UHU A;  1MWU A;  4NG2 A;  3CMZ A;  3G30 A;  3N6I A;  4GDN A;  4K0W A;  3KYZ A;  3T4K A;  1TF1 A;  4C3Q A;  1TS8 A;  2GZA A;  2WGW B;  5CTM A;  2ZM0 A;  1ONG A;  1SKO A;  2E8I A;  2VLG A;  4XUZ A;  3DTK A;  1H8Z A;  3FKW A;  1Z09 A;  3OPH A;  5FI7 A;  4D2O A;  5EVI A;  3VMA A;  4P87 A;  2EWV A;  3MXQ A;  3BW6 A;  3GQZ A;  2L1M A;  3MZE A;  1I5Q A;  3VP0 A;  1FIL A;  3WRZ A;  3FPW A;  4R3J A;  3PBN A;  2EX9 A;  2J3T D;  3UB8 A;  1OTE A;  2DRW A;  1QMF A;  4QJG A;  3BEC A;  3PXP A;  3F1P B;  3VOY A;  1XXM A;  4DDS A;  4EW7 A;  4KUK A;  2Q9M A;  4HY8 A;  2V2F F;  5FI2 A;  4PPR A;  1IEL A;  5I94 A;  5HAR A;  1H5X A;  1M40 A;  5GLB A;  4L9E A;  2V1Z A;  4FH2 A;  3IHB A;  2HP9 A;  3LIC A;  4Y0U A;  2PYR A;  4YNR A;  1LSX A;  2YKH A;  3HJK A;  3LR0 A;  4MBH A;  3T1Q B;  5FDH A;  2ZD8 A;  5FL3 A;  3C7U A;  3IS2 A;  3TE8 A;  4S2P A;  1E25 A;  4EET B;  3UN7 A;  1OJ5 A;  2XD1 A;  1ES5 A;  2J9O A;  1W8Y A;  3RH8 B;  4MN5 A;  3VSK A;  3LID A;  1BLP A;  1QME A;  4Y17 A;  2PDR A;  3BM6 A;  1OME A;  3DTI A;  3RJU A;  3EGX C;  2ZQA A;  1YLY A;  5EOE A;  1YSQ A;  3P09 A;  1H3Q A;  2JCH A;  4E6X A;  5I5L A;  2WKR A;  5CXW A;  1LT0 A;  3R4K A;  4HJ6 A;  3OBF A;  1IEM A;  2Y55 A;  3LY4 A;  3LI9 A;  4WZ4 A;  1PWC A;  2YKF A;  3BFE A;  1GCE A;  3LR5 A;  3OZH A;  3VSL A;  1GSX A;  1KE0 A;  3L9K A;  1VET B;  3TRC A;  2RL3 A;  1FR1 A;  3BJN A;  1TEM A;  4ZDX A;  2A24 A;  2D02 A;  2ZM8 A;  4R3B A;  4JGO A;  3G32 A;  3A0V A;  4Y0O A;  1VEU B;  3M2K A;  4BQM A;  4YOF A;  1DJB A;  5TBM B;  4P6B A;  2V20 A;  1VM1 A;  4WEK A;  5M19 A;  2HP5 A;  5FQK A;  3B42 A;  1MXO A;  3GRJ A;  1ZG6 A;  4O01 A;  2HGV A;  2ZC7 A;  1TDG A;  4ZRR A;  3SH8 A;  3PBO A;  1LHY A;  5EVL A;  3TW8 A;  4BBV A;  3GEC A;  3A3D A;  3NEC A;  4WF0 A;  3V3S A;  3MF0 A;  1LI9 A;  3DWZ A;  4JF5 A;  1D06 A;  3M2J A;  4M4X A;  2H28 A;  4CLC B;  1BZA A;  2K2N A;  1TDL A;  3NOT C;  3SZT A;  3T1X A;  2PYP A;  3S7N A;  2Z6C A;  4QU3 A;  3G35 A;  5EV0 A;  3NJA A;  3E4Q A;  1ACF A;  2FFF B;  2G2W A;  4Y15 A;  4LV0 A;  3BYD A;  3OCL A;  4JGP A;  4GHI B;  3UNW A;  3PBS A;  5AQB A;  4WBG A;  4XUX A;  5JYO A;  4MLL A;  5CRF A;  1S66 L;  1STZ A;  4FCF A;  3FV7 A;  2PT7 A;  3EEA A;  3A3I A;  2WGW A;  2QYB A;  3ISG A;  5EVI D;  4X69 A;  4E3J A;  4DMZ A;  3IX3 A;  4R3A A;  3O3V A;  2Y8H A;  3D9Y A;  5HZH A;  2ZQ9 A;  1O7E A;  2Y2J A;  2XQZ A;  3LIE A;  3Q1F A;  4KUO A;  3T4T A;  1RGY A;  4RX3 A;  4BBT A;  2R9X A;  3HL9 A;  4D60 A;  1BLS A;  1FIK A;  3V3R A;  4XT2 A;  3CHW P;  3ZDJ A;  1GSW A;  1TVF A;  3E4P A;  3F1P A;  1VHM A;  2BLS A;  5FAO A;  1T1B A;  5HL6 A;  3WWX A;  1P9R A;  1S1Y A;  3HUN A;  1XP4 A;  5K5B A;  2ZQD A;  3EQV A;  2HJE A;  5CGW A;  3F1O B;  3H9W A;  3IBR A;  1AWI A;  4GNU A;  5F83 A;  1PI5 A;  4DKI A;  3GVB A;  5EVE A;  1YPR A;  2H0Y A;  2W0N A;  2LB5 A;  4QD4 A;  4JF4 A;  1ERQ A;  2A3U A;  5L07 A;  1FQG A;  4UA7 A;  3R7W B;  2W1R A;  4DE1 A;  1H0M A;  2JKT M;  3P01 A;  5HD5 A;  3A3E A;  1Q2Q A;  1GA0 A;  3UB6 A;  3QHY A;  2Y2I A;  3ZGA B;  4AFI A;  5IS1 A;  4NXE A;  4S2K A;  2AVX A;  1XJ4 A;  2J3T C;  3UDI A;  4O8G A;  4QY6 A;  1CI8 A;  4JXS A;  2PAV P;  1MC0 A;  3SS5 A;  4GD8 A;  1Y4O A;  3EOI A;  2JHE A;  2FZ0 A;  4IUH A;  4Q8I A;  1SKO B;  2X02 A;  1G68 A;  2NUT C;  5HWV A;  4PKY A;  1NXY A;  5EFW A;  4R4R A;  4GD6 A;  4QY5 A;  5L2F A;  4JXW A;  1DJC A;  4GB7 A;  1V9Z A;  2GNX A;  2MJ6 A;  5L8M A;  1NYM A;  5DJU A;  4IHQ A;  3FC7 A;  5TBM A;  5A8B A;  4JBF A;  4EUV A;  1GA9 A;  5FQ9 A;  1KDW A;  1YT4 A;  4FOF A;  3NCK A;  1K55 C;  4BD1 A;  5FA7 A;  2I9V A;  3V5M A;  2ZQC A;  3PBT A;  3VP3 A;  5DTT A;  4OOL A;  3QP8 A;  5FQQ A;  4JPM A;  5AQ9 A;  4UA9 A;  3BY9 A;  2ZQ8 A;  3QNB A;  1ODV A;  3MR0 A;  4GN2 A;  1G6O A;  3UPP A;  3CUE A;  4I38 A;  1IKG A;  4HNB A;  5G4Z A;  1C3B A;  3N7W A;  4C75 A;  4ESP A;  5GLA A;  1FSW A;  5HPI A;  3LYX A;  3QP5 A;  4JKT A;  1S67 L;  1SDE A;  2QJ5 A;  2ZOH A;  4GW9 A;  3HLF A;  1S1Z A;  4P85 A;  3IBJ A;  1ZHH B;  4GHI A;  4H6J A;  2WGV A;  2D01 A;  4N9K A;  4KZ7 A;  2K31 A;  1K4E A;  3OOV A;  1PZO A;  2Y79 A;  2VA0 A;  3WRT A;  4HH2 A;  2PHY A;  1XA1 A;  2EA9 A;  2KLI A;  1Y28 A;  5A92 A;  1T19 A;  2XEP A;  2XR0 A;  1PW8 A;  1D1J A;  4XXR A;  1K54 A;  3ZG0 A;  3OPL A;  1T1A A;  5HFO A;  4NET A;  1DP9 A;  1NWZ A;  4NXG A;  1K38 A;  1G5U A;  5DJT A;  4MBK A;  3RXW A;  1LL5 A;  4KZ9 A;  3UY6 A;  4K08 A;  1J9M A;  2VX8 A;  3UE1 A;  2V0U A;  3ZG9 B;  4C6Y A;  1KGE A;  1IFQ A;  4GS9 B;  4DE0 A;  2P74 A;  3MQO A;  1CEG A;  3T50 A;  2PR6 A;  3F1O A;  3A3J A;  3UDX A;  5DF9 A;  3ICY A;  2UV0 E;  2ZL1 B;  2J3W A;  2XGN A;  4EBP A;  4KG2 A;  2X01 A;  1K57 A;  2GJ3 A;  2WGI A;  2EFX A;  3E4O A;  1S4R A;  4KZA A;  3SH7 A;  5AJG A;  2VEA A;  1YLZ A;  4WL9 A;  1SKF A;  3B47 A;  3R7W A;  3RTY A;  3MKE A;  5HX9 A;  3G2Y A;  2ZC4 B;  3TOI A;  4IJG A;  1XFN A;  3MS6 A;  1YAX A;  4EER A;  2OLV A;  1XPB A;  1H8M A;  1ESI A;  5FSR A;  2P9V B;  2VZW A;  1F98 A;  5FDS A;  3BY8 A;  2XA7 M;  1KGF A;  3A3F A;  5J8X A;  5F82 A;  2ZBB A;  3VP4 A;  1HLU P;  1ZC2 A;  3ITB A;  1SDN A;  1P9W A;  4OPY A;  5EPH A;  4HBT A;  4EUZ A;  4KZ3 A;  5E2E A;  1W79 A;  3UE3 A;  4WMC D;  1YLJ A;  3OCN A;  3KYQ A;  1K6S A;  2WAE A;  2HZ5 A;  3IF6 C;  2CC1 A;  2VK3 A;  1KE4 A;  2Y2K A;  4ETX A;  4RYE A;  1ALQ A;  3WS0 A;  4DE3 A;  1BUE A;  4BL2 A;  3LY3 A;  3FKV A;  4I3A A;  4XT2 B;  5TFQ A;  1FCN A;  4NK3 A;  2G2U A;  1NY0 A;  4KEN B;  4ETZ A;  3VOL A;  4CJN A;  3HBR A;  1WYB A;  2B95 A;  4OOM A;  1XJ3 A;  1XJ2 A;  2JE5 A;  4CLC D;  4MN6 A;  2IWC A;  3GV9 A;  2H10 A;  4S2L A;  1ZKJ A;  3N8S A;  3NUL A;  2J9P A;  4K91 A;  2ZMV A;  2W3E A;  1NJ4 A;  4Y7P A;  5KSH A;  4N9L A;  3BFC A;  2IWB A;  1MY8 A;  4Q0H A;  3EGD C;  5DTS A;  5CGX A;  4E3N A;  4G3K A;  3V50 A;  5TJJ A;  3UPN A;  1MPL A;  3DAV A;  1UGU A;  3OPR A;  3IF6 A;  3C7V A;  2UWX A;  5DKK A;  4GOG A;  1K56 A;  2W27 A;  4L0L A;  1NLY A;  1V9Y A;  4KQD A;  2WKP A;  3BRM A;  5GHX A;  1P0Z A;  4HJ3 A;  4LV1 A;  4FSF A;  5AVE A;  5KSC A;  3UDF A;  1JTD A;  4DRT A;  2XF3 A;  4ID4 A;  2PU4 A;  5AQA A;  3ZHH A;  1KGG A;  4GDB A;  1DP8 A;  3IH9 A;  2FFY A;  5KIZ A;  1HD8 A;  2PBD P;  4QWO A;  3C8C A;  2ZC6 B;  4U3T A;  1OTA A;  2Z2M B;  3S1Y A;  3ITA A;  5A90 A;  3OC2 A;  4MDZ A;  4KZ8 A;  4LRZ E;  2JKG A;  5DFY A;  1WYC A;  2OLU A;  4L9G A;  3A0R A;  3HLB A;  1CEF A;  3QP6 A;  3NIA A;  4ZBE A;  3P7N A;  5IHV A;  1OPX A;  3TJZ C;  2PR5 A;  1L2S A;  2VGK A;  2WZZ A;  3BEB A;  4CQH A;  4LGW A;  4GS9 A;  1N9B A;  3LR4 A;  1BT5 A;  2ZOI A;  1VB6 A;  3IXD A;  1FCM A;  3K2N A;  4X1M A;  3LGO A;  4S2O A;  4LCM A;  3HUM A;  4B4X A;  4HP9 A;  2OOL A;  5HD3 A;  3HVF A;  4OP8 A;  2ZL1 A;  3QP4 A;  1IYQ A;  4II7 A;  3O88 A;  3W4P A;  1IKI A;  5M1A A;  1PRQ A;  4S2N C;  4S2J A;  5GL9 A;  3O86 A;  1CJF A;  4X55 A;  4Q0J A;  4Z9Q A;  4ZJ1 A;  3VP1 A;  3FWL A;  1NZO A;  4I3I A;  4LRY C;  2EX6 A;  3GDI A;  1FOF A;  4DXC A;  3OLO A;  2B02 A;  4OQH A;  5EM0 A;  4H6J B;  3IF5 A;  4UQI S;  4Y0T A;  2P9V A;  2O99 A;  1KVL A;  3NOU C;  5TGF A;  3MMH A;  3DWK A;  5U47 A;  1G28 A;  3ZG5 A;  2EXB A;  4EES A;  1I2S A;  2QHK A;  3UMD A;  3IWQ A;  3LI8 A;  3NI9 A;  4GLQ A;  2PD8 A;  3JYI A;  2QWS A;  2VJW A;  4I5S A;  5M18 A;  4RX2 A;  5FAS A;  1NRJ A;  3E0Y A;  1S6R A;  1GSV A;  4KZ4 A;  4EEU A;  2BTF P;  1BLC A;  3UO9 A;  1HVB A;  2P04 A;  2EX8 A;  4LEN A;  2ZM2 A;  1L0F A;  1TS0 A;  3S7O A;  3W4Q A;  4NXB A;  4JXV A;  3QP2 A;  4E04 A;  3W2Z A;  5F69 A;  4OON A;  1HTZ A;  4HJ4 A;  3MKF A;  3QP1 A;  3NY4 A;  3C2W A;  4WN5 A;  1CK3 A;  4ZTK A;  1MWR A;  3DBA A;  4LFU A;  2HDQ A;  4PAU A;  3HLG A;  1W5D A;  1W63 Q;  2Y4A A;  4YIN A;  1IYO A;  4PMA A;  5EUA A;  2Y2Q A;  1OTD A;  2Y2M A;  1K4F A;  3CIT A;  1CF0 A;  1W7F A;  5DTK A;  2X71 A;  1GHI A;  3BFF A;  3OPP A;  4LLO B;  1K56 D;  3D72 A;  2WYX A;  4R38 A;  4U0T A;  1LSW A;  1OJG A;  3VOZ A;  3IWO A;  1XFQ A;  4NXF A;  2W3G A;  1L3L A;  3CG5 A;  2BG1 A;  2HDR A;  4PM9 A;  3T1R A;  3N4I A;  4Z1W A;  1JNU A;  3EEH A;  3WS5 A;  5E2H A;  3AGD A;  3LIB A;  1AXB A;  2J80 A;  1XJ6 A;  4GJ4 A;  3Q81 A;  4FH4 A;  4G3V A;  1PNE A;  4I39 A;  2INW A;  5E43 A;  3HCY A;  4UA6 A;  4E3L A;  2DCF A;  3Q7V B;  5HSQ A;  3GTC A;  3C5A A;  2Z2L B;  2H5S A;  3GMW A;  4UQI M;  1K25 A;  5EE8 A;  4I3J A;  2Z6D A;  1LI0 A;  2V1A A;  2Y2N A;  4X68 A;  1IOU A;  4S2I A;  3H82 A;  4R70 A;  1CQA A;  3JVV A;  1I2W A;  2CMN A;  1D7E A;  3HLD A;  1XA7 A;  3ZG7 B;  2EX2 A;  4RA7 A;  3F1N A;  2IA2 A;  1K0K A;  3UE0 A;  1N4O A;  1BUL A;  2ACG A;  4B9O A;  2PD7 A;  3MQQ A;  2ZMF A;  2HV1 A;  5L10 A;  5J4E A;  3LUQ A;  4K0X A;  4O7D A;  4H8R A;  3VE4 A;  4EBL A;  3C38 A;  4BJP A;  4EBN A;  1E4D A;  5EOO A;  1XX2 A;  3HUO A;  2O0Y A;  4OPQ A;  3K3C A;  4KQR A;  3W4O A;  4BBU A;  1ZG4 A;  4Y5F A;  4P6Z S;  3IF6 B;  5CTN A;  5DVA A;  4BEN A;  3DW0 A;  4BLM A;  5HPF A;  2KX6 A;  3T4Q A;  1JWZ A;  1EI5 A;  3TG9 A;  2JBF A;  4QHC A;  2WUQ A;  1BYW A;  4LPZ A;  1N9O A;  1K55 A;  2W3H A;  4LRX C;  3LIA A;  4MEZ A;  1O07 A;  3KSF A;  3LIF A;  4IVK A;  2R9W A;  3M6H A;  4S2M A;  3PHY A;  3CAX A;  4R23 A;  1GHP A;  3IHA A;  3VFH A;  4KQO A;  3KSH A;  3EQU A;  2M7V A;  4EQ1 A;  1N9L A;  2O9B A;  4KZB A;  1PIO A;  2P08 A;  5L09 A;  3UPO A;  1RGZ A;  2XD5 A;  4PM5 A;  2XRN A;  1OTB A;  3M6B A;  5GLD A;  1K6R A;  3O5Y A;  3PBQ A;  2Y91 A;  4HES A;  4LCL A;  4WM9 A;  4G3W A;  1DP6 A;  4OQG A;  5A91 A;  2VKS A;  1Q2P A;  5HDC A;  5HWT A;  2KOI A;  4HI4 A;  2EFU A;  3ULF A;  1ES2 A;  5F5Y A;  4JLF A;  4MMN A;  3MXR A;  2OV5 A;  4HHD A;  1YLW A;  5EVI C;  3D3O A;  3Q7Z A;  2LB9 A;  3WS4 A;  3SOI A;  5GHY A;  1VQQ A;  2V8C A;  1OT6 A;  4A5R A;  3CI6 A;  3V39 A;  4OPR A;  2C5W B;  3U4L P;  5CEB A;  4ZJ2 A;  1EWZ A;  1YLP A;  4WEL A;  5HAQ A;  2W3D A;  2PRF A;  4X56 A;  5FAQ A;  2OWJ A;  5EEC A;  1MBL A;  4ME4 A;  3KX0 X;  1YLT A;  2GX5 A;  4QPR A;  3ZQ5 A;  3KSG A;  2HDS A;  4WEJ A;  5F68 A;  1KDS A;  1P97 A;  2L4R A;  3LEZ A;  3L7H A;  1ES3 A;  1BTL A;  2ZC3 B;  3VV4 A;  4ARZ B;  3T4S A;  3FG8 A;  3IX4 A;  3PAG A;  3LCE A;  2JKR I;  3NC8 A;  1L0D A;  4X1L A;  2A2L A;  3Q7V A;  3VP2 A;  4QB8 A;  1NRF A;  1RCJ A;  4WLA A;  4P6Z M;  2QMI A;  4E3K A;  3ZYT A;  3RXX A;  2Y2H A;  1PYY A;  3SS3 A;  3FPV A;  1U60 A;  4EWF A;  2VGL S;  4F3L A;  2L0W A;  1WA9 A;  1ONH A;  1SHV A;  5F1G A;  4GCZ A;  2WAF A;  1J3W A;  5A93 A;  1F9I A;  3C4O A;  3P98 A;  3LO7 A;  4KZ5 A;  4B4Z A;  2R78 A;  5GHZ A;  2WK0 A;  3T4J A;  5BOH A;  3HLW A;  3NOP C;  1ERO A;  2EWW A;  2I72 A;  4FUW A;  4OLD A;  1FR6 A;  2PBY A;  4EXO A;  5HDD A;  3CJM A;  4IBX A;  5CER A;  3UE6 A;  5J3W A;  1RP5 A;  4MNR A;  4WZ5 C;  1Z6F A;  3U2A A;  3C30 A;  2ZJ9 A;  2JN7 A;  3H7W A;  4KG6 A;  4DF6 A;  3HRE A;  5HWW A;  2DNS A;  2VGJ A;  2A49 A;  5HAI A;  3Q82 A;  4PKY G;  3C4P A;  4NEE D;  3NHQ A;  1M6K A;  1YKD A;  3QNC A;  3AGE A;  1LLB A;  4OPZ A;  3SH9 A;  4JGR A;  1KE3 A;  4E6W A;  3BFG A;  5DF7 A;  1N9N A;  3NDE A;  4IED A;  3BLM A;  2Y2L A;  1H8Y A;  1PWG A;  2G7U A;  4OQ0 A;  3MBZ A;  3WS2 A;  3MZF A;  3CLO A;  1BLH A;  3HLE A;  1YSP A;  1PWD A;  3K3D A;  2Y2G A;  1TD5 A;  2W1T B;  5FQI A;  4E3I A;  5D3O A;  4EU0 A;  5KZH A;  3H82 B;  4X25 A;  2KDK A;  1TS7 A;  4IVI A;  1DY6 A;  3RFB A;  1LL9 A;  5AVF A;  3IX8 A;  3G2Z A;  4OLG A;  4WZ5 A;  2JKF A;  4EEP A;  3F1N B;  1ERM A;  3KYE A;  2HDU A;  1F2K A;  5DF8 A;  4GKU A;  5CEC A;  1T1C A;  5HAP A;  2VGL M;  5FAT A; 
#chains in the Genus database with same CATH homology
 5A92 A;  5JYP A;  3CG5 A;  4R3J A;  2BG1 A;  2HDR A;  3PBN A;  4PM9 A;  2XEP A;  2EX9 A;  2XR0 A;  1NYY A;  1PW8 A;  3N4I A;  4PM8 A;  1K54 A;  3NBL A;  4XXR A;  3ZG0 A;  3PBR A;  3WS5 A;  3OPL A;  2DRW A;  1QMF A;  5E2H A;  3AGD A;  1AXB A;  5HFO A;  4QJG A;  4NET A;  3BEC A;  4FD8 A;  3S22 A;  1YM1 A;  3IXH A;  3VOY A;  1XXM A;  4DDS A;  4M3K A;  1K38 A;  1BSG A;  4OVD A;  2Q9M A;  4MBK A;  3RXW A;  1LL5 A;  4KZ9 A;  3UY6 A;  3O87 A;  2V2F F;  5CHM A;  3Q81 A;  4FH4 A;  1J9M A;  5FI2 A;  3ZVW A;  4PPR A;  3UE1 A;  1IEL A;  5I94 A;  2RCX A;  3ZG9 B;  4C6Y A;  5HAR A;  1H5X A;  3IWI A;  1M40 A;  5E43 A;  5GLB A;  4UA6 A;  1S0W A;  1KGE A;  4E3L A;  2DCF A;  2V1Z A;  3Q7V B;  4FH2 A;  3IHB A;  2XLN A;  3GTC A;  2HP9 A;  2XK1 A;  4DE0 A;  2P74 A;  3C5A A;  4Y0U A;  2Z2L B;  4E3M A;  1CEG A;  2H5S A;  3IH8 A;  3GMW A;  1K25 A;  5EE8 A;  4MBH A;  1LI0 A;  2Y2N A;  3A3J A;  5FDH A;  2ZD8 A;  3UDX A;  3C7U A;  4X68 A;  5DF9 A;  1GHM A;  4S2P A;  1E25 A;  4S2I A;  2XGN A;  3UN7 A;  4EBP A;  4KG2 A;  2X01 A;  3DTM A;  1K57 A;  3Q07 A;  5F1F A;  1MWT A;  1I2W A;  2XD1 A;  1ES5 A;  2J9O A;  1W8Y A;  2WGI A;  3HLD A;  1XA7 A;  2HPB A;  2EFX A;  1PI4 A;  3VSK A;  1BLP A;  2B5R A;  1QME A;  4S2N A;  2XFS A;  1OME A;  3BM6 A;  4KZA A;  5FQM A;  3SH7 A;  3RJU A;  3ZG7 B;  2EX2 A;  1YLZ A;  4RA7 A;  3MZD A;  2ZQA A;  1SKF A;  4B88 A;  1YLY A;  2Y2P A;  3TSG A;  3MKE A;  5HX9 A;  3UE0 A;  1N4O A;  3G2Y A;  5EOE A;  1BUL A;  2ZC4 B;  3P09 A;  3TOI A;  2JCH A;  5HW3 A;  5HL1 A;  4E6X A;  4HBU A;  5CXW A;  1YMS A;  3SS4 A;  4K0X A;  2OLV A;  1IEM A;  1XPB A;  4O7D A;  2Y55 A;  1ESI A;  3LY4 A;  4H8R A;  3CZD A;  4WZ4 A;  5FSR A;  1PWC A;  1YQS A;  4EBL A;  2P9V B;  1E3U A;  3BFE A;  3HLC A;  1GCE A;  4BJP A;  1KGF A;  3OZH A;  3A3F A;  4EBN A;  1Y54 A;  3VSL A;  1KE0 A;  5J8X A;  1E4D A;  5EOO A;  5F82 A;  2RL3 A;  3VP4 A;  1XX2 A;  1FR1 A;  1ZC2 A;  3HUO A;  3ITB A;  1TEM A;  4OPQ A;  4KQR A;  3W4O A;  1SDN A;  3ZCZ A;  3S4X A;  4ZDX A;  1ZG4 A;  4X53 A;  2ZM8 A;  4R1G A;  4R3B A;  2H0T A;  3G32 A;  3IF6 B;  4Y0O A;  3PAE A;  4OPY A;  5CTN A;  5DVA A;  3DW0 A;  4BEN A;  3M2K A;  5EPH A;  4HBT A;  4BLM A;  4BQM A;  3ZFZ A;  1DJB A;  4EUZ A;  4KZ3 A;  1JWZ A;  4P6B A;  2V20 A;  1VM1 A;  1W79 A;  4WEK A;  5E2E A;  4EQI A;  5M19 A;  3UE3 A;  4WMC D;  1YLJ A;  2HP5 A;  3G4P A;  1EI5 A;  2ZMA A;  3OCN A;  2ZQ7 A;  5FQK A;  4P0M A;  2Q9N A;  2JBF A;  1K6S A;  4OKP A;  3TG9 A;  2WAE A;  3IF6 C;  2CC1 A;  1IYP A;  4QHC A;  2WUQ A;  4OOY A;  1MXO A;  3GRJ A;  1KE4 A;  2Y2K A;  1ZG6 A;  2GDN A;  1K55 A;  2ZC7 A;  4RYE A;  1ALQ A;  1TDG A;  3WS0 A;  4DE3 A;  3N8R A;  1BUE A;  4MBF A;  4WYY A;  3SH8 A;  3PBO A;  4BL2 A;  3LY3 A;  2XFT A;  4LV2 A;  3FKV A;  5CED A;  1LHY A;  4MEZ A;  4UAA A;  5EVL A;  1O07 A;  4IVK A;  4DDY A;  2R9W A;  2J8Y A;  3M6H A;  5TFQ A;  4S2M A;  1FCN A;  4NK3 A;  4U0X A;  2G2U A;  4F94 A;  3A3D A;  5G18 A;  4R23 A;  1GHP A;  1NY0 A;  5KMW A;  4KEN B;  3V3S A;  3IHA A;  1LI9 A;  3VFH A;  3DWZ A;  3ZVT A;  1FCO A;  4GZB A;  2QZ6 A;  4JF5 A;  4KQO A;  4CJN A;  3HBR A;  4HEF A;  3WS1 A;  1WYB A;  3M2J A;  4OOM A;  1SCW A;  3EQU A;  1BZA A;  4KZB A;  1TDL A;  1PIO A;  4BL3 A;  1XKZ A;  4IBR A;  2WZX A;  4QU3 A;  3G35 A;  2JE5 A;  3BLS A;  3UPO A;  2ZC5 B;  3IXB A;  1RGZ A;  2OSU A;  2XD5 A;  4PM5 A;  2FFF B;  5GLD A;  3M6B A;  1K6R A;  2G2W A;  3E2L A;  4LV0 A;  3BYD A;  3PBQ A;  4KZ6 A;  3OCL A;  2Y91 A;  2IWC A;  3GV9 A;  4HES A;  2H10 A;  4LCL A;  4S2L A;  1ZKJ A;  3N8S A;  4WM9 A;  3UNW A;  3PBS A;  5AQB A;  2J9P A;  4K91 A;  4OQG A;  4WBG A;  2WKI A;  4XUX A;  5JYO A;  4MLL A;  3MFD A;  1Q2P A;  4Y7P A;  1NJ4 A;  5A91 A;  5KSH A;  5CRF A;  4PM6 A;  4N9L A;  3BFC A;  4YFM A;  2IWB A;  1MY8 A;  5EVI B;  1CI9 A;  4FCF A;  2EFU A;  2ZLY A;  5CGX A;  5DTS A;  3FV7 A;  4E3N A;  1ES2 A;  5E2G A;  1HZO A;  3A3I A;  4JLF A;  3V50 A;  2WGW A;  4R0Q A;  3ZNY A;  3UPN A;  3ISG A;  1MPL A;  4X6T A;  5EVI D;  4WMC A;  4X69 A;  3MXR A;  4KG5 A;  3OPR A;  4E3J A;  3IF6 A;  2OV5 A;  4N92 A;  3C7V A;  2UWX A;  1YLW A;  3I7J A;  4ZJ3 A;  4GOG A;  1K56 A;  3BFD A;  3O3V A;  5CGS A;  5EVI C;  4L0L A;  3Q7Z A;  5E2F A;  1PW1 A;  3WS4 A;  3BRM A;  5GHX A;  3SOI A;  4LV1 A;  5GHY A;  4FSF A;  5KSC A;  2ZQ9 A;  1O7E A;  1VQQ A;  3UDF A;  2Y2J A;  1DJA A;  1XGJ A;  2XQZ A;  1JTD A;  4A5R A;  4DRT A;  3ZG8 B;  3V39 A;  4DE2 A;  2XF3 A;  4OPR A;  3IQA A;  4ID4 A;  3Q1F A;  2PU4 A;  2C5W B;  2JC7 A;  1K54 C;  1KGG A;  3FYZ A;  4JF6 A;  4GDB A;  5AQA A;  3ZHH A;  2EXA A;  3IH9 A;  2FFY A;  1RGY A;  4RX3 A;  1HD8 A;  4ZJ2 A;  5CEB A;  1EWZ A;  1YLP A;  2R9X A;  2WAD A;  4WEL A;  5HAQ A;  1ESU A;  3HL9 A;  1L0G A;  1YMX A;  4X56 A;  1BLS A;  2ZC6 B;  4U3T A;  5EEC A;  4ZAM A;  5FAQ A;  3W8K A;  1MBL A;  3GSG A;  5GLC A;  3V3R A;  1YLT A;  2Z2M B;  4RVA A;  3S1Y A;  3ZDJ A;  3ITA A;  2HP6 A;  5A90 A;  3OC2 A;  1TVF A;  2XDM A;  2HDS A;  4WEJ A;  2BLS A;  5AQ7 A;  4KZ8 A;  1KDS A;  5FAO A;  3D4F A;  3WWX A;  1MWS A;  1JVJ A;  1WYC A;  1PZP A;  1XP4 A;  2OLU A;  3HUN A;  3LEZ A;  3HLB A;  2ZQD A;  1CEF A;  1ES3 A;  3EQV A;  3IT9 A;  1BTL A;  2ZC3 B;  3NIA A;  5CGW A;  4ZBE A;  2J7V A;  5IHV A;  3PAG A;  3LCE A;  3NC8 A;  4GNU A;  1L2S A;  1L0D A;  2VGK A;  5F83 A;  3VP2 A;  3Q7V A;  2WZZ A;  3BEB A;  4QB8 A;  1NRF A;  1N9B A;  1PI5 A;  1RCJ A;  4DKI A;  4PM7 A;  4EV4 A;  1BT5 A;  3GVB A;  1L0E A;  2H0Y A;  1XGI A;  4N1X A;  4E3K A;  2QMI A;  3IXD A;  4QD4 A;  2Y2H A;  1FCM A;  1PYY A;  3B3X A;  3RXX A;  3SS3 A;  4JF4 A;  2WKH A;  4S2O A;  1U60 A;  1ERQ A;  2A3U A;  4EWF A;  5FQJ A;  3ZNT A;  4LCM A;  2XH9 A;  3VP0 A;  3HUM A;  4B4X A;  4LV3 A;  1FQG A;  4UA7 A;  4OH0 A;  5FAP A;  1K57 C;  4OQI A;  3HVF A;  1G6A A;  4OP8 A;  1ONH A;  1SHV A;  5F1G A;  4BD0 A;  4N1H A;  1IYQ A;  4DE1 A;  3O88 A;  2WAF A;  3W4P A;  2C6W B;  1IKI A;  3A3E A;  1Q2Q A;  5M1A A;  4S2N C;  2QPN A;  1GA0 A;  1WE4 A;  4JXG A;  4S2J A;  5A93 A;  1FSY A;  1MKI A;  5GL9 A;  3QHY A;  3IXG A;  3O86 A;  2Y2I A;  3ZGA B;  4X55 A;  3C4O A;  3P98 A;  3LO7 A;  4KZ5 A;  3G34 A;  4B4Z A;  4S2K A;  4Z9Q A;  4ZJ1 A;  3VP1 A;  5GHZ A;  3FWL A;  3UDI A;  1NZO A;  5TR7 A;  1E3U D;  2WK0 A;  4QY6 A;  1JWP A;  1CI8 A;  4JXS A;  3GR2 A;  5CHU A;  5CHJ A;  2EX6 A;  1FOF A;  5BOH A;  5FI6 A;  1W8Q A;  3SS5 A;  4DXC A;  4GD8 A;  4KQQ A;  4Q8I A;  3HLW A;  4OP5 A;  4OQH A;  3IF5 A;  4Y0T A;  3E2K A;  2X02 A;  1G68 A;  2P9V A;  1ERO A;  2IWD A;  1KVL A;  2I72 A;  1NXY A;  4R4R A;  5TGF A;  4OLD A;  1FR6 A;  2PBY A;  1KVM A;  3DWK A;  4GD6 A;  5U47 A;  3ZG5 A;  2EXB A;  3CJM A;  4IBX A;  4QY5 A;  5CER A;  1RP5 A;  1I2S A;  4MNR A;  4WZ5 C;  3N8L A;  5L2F A;  4JXW A;  1Z6F A;  1DJC A;  3IWQ A;  4GB7 A;  3NI9 A;  1JTG A;  3AGF A;  2ZJ9 A;  1NYM A;  2Y2O A;  3VFF A;  3JYI A;  1IYS A;  1NZU A;  4KG6 A;  4DF6 A;  4RX2 A;  5M18 A;  3HRE A;  4JBF A;  5FAS A;  2DNS A;  1GA9 A;  2VGJ A;  2A49 A;  1JWV A;  5FQ9 A;  5HAI A;  2WKE A;  4R4S A;  3Q82 A;  1KDW A;  1S6R A;  1YT4 A;  3C4P A;  4E3O A;  3NCK A;  1K55 C;  4KZ4 A;  4BD1 A;  4DXB A;  5FA7 A;  3G31 A;  4CPK A;  1M6K A;  1BLC A;  3UO9 A;  1HVB A;  3QNC A;  2ZQC A;  3V5M A;  3PBT A;  3VP3 A;  5DTT A;  3AGE A;  4OOL A;  2EX8 A;  3MXS A;  4LEN A;  5FQQ A;  3PTE A;  1LLB A;  2Y59 A;  4JPM A;  2ZM2 A;  1L0F A;  4OPZ A;  5AQ9 A;  4UA9 A;  3W4Q A;  3SH9 A;  2ZQ8 A;  3QNB A;  4JXV A;  1KE3 A;  4E6W A;  1ES4 A;  4GN2 A;  3BFG A;  5DF7 A;  3UPP A;  1IKG A;  2PU2 A;  3NDE A;  4OON A;  1HTZ A;  4IED A;  3BLM A;  2Y2L A;  1H8Y A;  1PWG A;  3FZC A;  3MKF A;  4OQ0 A;  3NDG A;  1C3B A;  3MBZ A;  3NY4 A;  3WS2 A;  4UHU A;  3N7W A;  4C75 A;  1MWU A;  1CK3 A;  4ZTK A;  3MZF A;  3HLE A;  1BLH A;  1MWR A;  5GLA A;  1FSW A;  2HDQ A;  3CMZ A;  3G30 A;  3N6I A;  1PWD A;  4GDN A;  4K0W A;  3HLG A;  2Y2G A;  1W5D A;  5FQI A;  4E3I A;  2Y4A A;  5D3O A;  4JKT A;  5KZH A;  4YIN A;  1IYO A;  4PMA A;  4C3Q A;  5EUA A;  1SDE A;  4IVI A;  2WGW B;  5CTM A;  2Y2Q A;  1DY6 A;  3HLF A;  4P85 A;  2Y2M A;  2ZM0 A;  1LL9 A;  1ONG A;  2E8I A;  3G2Z A;  4OLG A;  4WZ5 A;  2WGV A;  1K4F A;  4XUZ A;  4N9K A;  4KZ7 A;  1W7F A;  5DTK A;  1H8Z A;  2X71 A;  3FKW A;  1GHI A;  3BFF A;  3OPP A;  1ERM A;  3OPH A;  1K4E A;  5FI7 A;  1PZO A;  4D2O A;  5EVI A;  1K56 D;  2HDU A;  3WRT A;  3VMA A;  4P87 A;  5DF8 A;  1XA1 A;  2WYX A;  4GKU A;  4U0T A;  3GQZ A;  5CEC A;  3VOZ A;  3IWO A;  5HAP A;  3MZE A;  1I5Q A;  5FAT A;  3WRZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...