4X53A

Structure of the class d beta-lactamase oxa-160 v130d in acyl-enzyme complex with aztreonam
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
245
structure length
243
Chain Sequence
MHISSQQHEKAIKSYFDEAQTQGVIIIKEGKNLSTYGNALARANKEYVPASTFKMLNALIGLENHKATTNEIFKWDGKKRTYPMWEKDMTLGEAMALSADPVYQELARRTGLELMQKEVKRVNFGNTNIGTQVDNFWGPLKITPVQEVNFADDLAHNRLPFKLETQEEVKKMLLIKEVNGSKIYAKSGWGMGVTSQVGWLTGWVEQANGKKIPFSLNLEMKEGMSGSIRNEITYKSLENLGII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Class D beta-lactamase OXA-160
publication title Structural Basis of Activity against Aztreonam and Extended Spectrum Cephalosporins for Two Carbapenem-Hydrolyzing Class D beta-Lactamases from Acinetobacter baumannii.
pubmed doi rcsb
source organism Acinetobacter baumannii
total genus 80
structure length 243
sequence length 245
ec nomenclature
pdb deposition date 2014-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4x53A00
3HL9A 2XLNA 3VOZA 1SCWA 1W8YA 1FCNA 3FWLA 1K6SA 4GN2A 4IVKA 3GVBA 1NYMA 4B4XA 2JBFA 4KQOA 3VSLA 4WEKA 4N92A 1FCOA 2VGJA 2EFUA 2WUQA 1KDSA 1GA9A 2H0YA 3UDXA 1XX2A 3A3IA 3P09A 2ZC5B 3VFFA 4WEJA 4IEDA 3TSGA 3DWZA 3PBQA 2BLSA 5FAQA 4DE2A 1YMSA 1DY6A 3VP2A 3MXRA 1KE4A 1RCJA 3N8SA 3NDGA 1TDLA 1Z6FA 1XA1A 5DF7A 2ZC6B 2HDUA 1E3UD 1FR1A 3IH9A 2DRWA 4OLGA 4PMAA 4U3TA 3IHBA 4ZJ3A 2EX2A 4S2IA 2OV5A 3VP0A 1EROA 2WGWA 3A3EA 3WRTA 1YT4A 2Y55A 4QD4A 3UDFA 1XP4A 4QHCA 1N4OA 4MBHA 4DE0A 4LV0A 1MWSA 4RVAA 4F94A 4U0XA 4LV3A 2Y2HA 4ZBEA 5BOHA 5IHVA 5CHJA 3UPNA 3SH8A 5DTTA 2WZZA 3SS3A 3IXGA 1FR6A 1YM1A 1IEMA 2Z2MB 3Q81A 3Q1FA 3ZFZA 2BG1A 3A3FA 2Y2KA 1ES2A 5DF8A 4OQIA 4JKTA 4S2PA 3VFHA 3QHYA 4S2JA 1Q2PA 2XFSA 3Q7VA 3G4PA 1IYSA 2DCFA 2Y2OA 4PM8A 2ZJ9A 3MXSA 3AGFA 2QPNA 2EX6A 1MWUA 2J7VA 5FQIA 4WM9A 2HDQA 5KZHA 3UE1A 2J9OA 5CXWA 5JYOA 3ZHHA 5HAIA 2ZQ7A 3Q7ZA 2ZC3B 3C7UA 3G35A 3UO9A 4R23A 3ZCZA 2OLVA 2PU4A 2VGKA 3HLWA 4HESA 5F83A 2XK1A 2WGVA 3UDIA 2ZQDA 4P6BA 2WGIA 1ONGA 1PW1A 1NYYA 1KE0A 3UN7A 1SKFA 3M6BA 4Y0OA 5FQMA 3FKVA 2DNSA 2H10A 3VMAA 1AXBA 3D4FA 4NETA 1JWPA 1ZKJA 4O7DA 5FDHA 3BEBA 2QZ6A 1L0GA 2X71A 1BT5A 4DF6A 1YQSA 1M40A 1IKGA 1RP5A 4N1HA 1FCMA 5KSCA 3PTEA 1G6AA 2WADA 5E2GA 4S2NC 5EVIB 1KVMA 3VSKA 5D3OA 3UNWA 2EXBA 5EPHA 2Y91A 5HX9A 3ZG8B 1EI5A 4WZ4A 1BLSA 4S2LA 3IH8A 1YLTA 3A3JA 4XUZA 1NZOA 5EVIC 1C3BA 3CG5A 3MFDA 5FI6A 5FAOA 3HLGA 4X68A 3V3RA 3CZDA 3GRJA 4OQGA 3M2KA 4CPKA 1H8YA 3BFEA 5EE8A 3S4XA 1XKZA 1ERQA 1DJBA 4GDBA 4L0LA 3UE3A 2P9VB 3BECA 3GQZA 4BJPA 5GLAA 4RX3A 1N9BA 3HREA 3PBSA 2H0TA 3V5MA 3IXBA 4KZBA 1MKIA 1BUEA 3OCLA 3NCKA 1J9MA 2ZC7A 3C4OA 1L2SA 2EX9A 2V20A 5CGSA 5E2EA 5AQAA 5GLCA 3SS4A 4S2OA 4YINA 3W8KA 4LV2A 1YLWA 2V2FF 3RXXA 1ES5A 1DJAA 1LI0A 4QY5A 3ZNTA 1HD8A 4GNUA 4KG5A 3HLFA 5KMWA 4HEFA 1GHPA 3HLDA 1U60A 2Q9NA 4U0TA 4X55A 4KZ7A 1K38A 3IF6A 1PYYA 4RX2A 5FSRA 5CGXA 4FH2A 5A92A 3HVFA 5GLDA 2XR0A 2GDNA 3BFCA 3WS1A 4BD0A 3BYDA 1EWZA 1PZOA 4ZAMA 2ZQCA 1W5DA 4PM7A 5CHUA 4A5RA 5FQJA 4BD1A 5EECA 1KGFA 4OPRA 1H5XA 4QU3A 5A90A 3BFGA 4DE3A 5JYPA 3C5AA 4JXVA 1I2SA 4EQIA 4EBLA 1ZC2A 1H8ZA 3RJUA 3DWKA 2I72A 3N6IA 4DRTA 3WS4A 3Q82A 3N4IA 2A3UA 3FZCA 5CHMA 1XGIA 3MZFA 2PU2A 2XF3A 4WBGA 1LL5A 4N9LA 5DF9A 5A91A 1ES3A 2H5SA 3ZG7B 4C75A 3OPLA 2XGNA 2EX8A 2XQZA 3JYIA 3NIAA 4FSFA 3EQUA 3E2LA 3S22A 4QY6A 1K54A 2WAEA 4LCLA 1RGZA 2HDRA 3MZEA 2Y2MA 2X01A 3M6HA 1PWGA 3MZDA 4FH4A 4K0WA 3ISGA 5E43A 1QMEA 3ZDJA 1WE4A 1JVJA 1E4DA 1K56D 4UHUA 1IYOA 4MNRA 2WGWB 1XPBA 2ZM2A 2WZXA 4WYYA 4GZBA 2R9WA 1L0DA 3V39A 5FQQA 1VQQA 2WKHA 1JTGA 1NZUA 5HAPA 4C6YA 1DJCA 1IYQA 1KE3A 1MBLA 1XXMA 1CEGA 1HZOA 4JXSA 4DDYA 1K56A 3WS2A 3E2KA 2HP6A 1NRFA 3BFFA 1K57C 5GHYA 1JTDA 2HP5A 5DTKA 4RA7A 3BLSA 4JLFA 3IHAA 4H8RA 4WZ5A 3UY6A 4GD8A 2EXAA 3G32A 4OH0A 1GA0A 4X69A 3MBZA 3OPHA 4GDNA 1K6RA 3CMZA 4OONA 5HL1A 2G2WA 3NDEA 3DTMA 1CI8A 3Q07A 2Y2JA 5EVID 2IWCA 4HBTA 5EOOA 4R4SA 3VP4A 4S2NA 2ZD8A 3O86A 3HLCA 3IXHA 5FAPA 1MXOA 3LEZA 2XFTA 1PI5A 5FI2A 1VM1A 2Y2QA 1JWZA 5EOEA 1XA7A 1FSYA 4R0QA 3ZGAB 1BZAA 3W4OA 3OZHA 4S2KA 4OQHA 1L0FA 4P87A 1MWTA 5EVIA 3A3DA 3IT9A 2XEPA 4XXRA 1KDWA 1K55C 2B5RA 3V50A 4ZDXA 4ID4A 4JBFA 1GHMA 1YLZA 4S2MA 5TGFA 2XH9A 3O87A 1ESUA 1BLHA 4JF6A 3V3SA 4N1XA 4OQ0A 5E2FA 5FQKA 4FD8A 4OP8A 1S0WA 1BLPA 3WS5A 1O07A 1S6RA 2Y2NA 4ZTKA 3ZG0A 3OPPA 3IF5A 4B4ZA 1NY0A 1FQGA 2G2UA 1LI9A 2XDMA 3I7JA 4GKUA 4E3KA 5HFOA 1Y54A 2P9VA 3HUMA 3IWOA 2RCXA 4R3JA 4KENB 3BFDA 1SHVA 4BQMA 4EBPA 3GV9A 5KSHA 1MPLA 3ITAA 3RXWA 4UA7A 4KZ4A 2IWBA 2WYXA 3IWQA 4OOLA 5U47A 2R9XA 1ALQA 4KG2A 1HTZA 2CC1A 4EUZA 1GHIA 2Y2PA 5GHZA 5AQBA 2OSUA 1I5QA 2JCHA 1YLPA 1MWRA 4WELA 4E6WA 4HBUA 2IWDA 2J8YA 3WWXA 1YLYA 4ZJ2A 3NC8A 3DW0A 2HDSA 3OC2A 3PAGA 4M3KA 4GB7A 3TG9A 3WS0A 5FA7A 4X6TA 4KQQA 1HVBA 4OP5A 5CRFA 1K25A 4ZJ1A 3ZVTA 2WK0A 5F1FA 4LENA 1E25A 3HBRA 1BSGA 1NJ4A 1PWCA 5HW3A 1W7FA 4P0MA 4E3LA 1IYPA 1ES4A 2J9PA 4UA6A 4PM5A 5CECA 1G68A 4Y0TA 1SDNA 3HUNA 2ZQ9A 2WAFA 1K4EA 5HARA 4JPMA 2EFXA 4PPRA 1Q2QA 1M6KA 4LCMA 4OLDA 3O3VA 5CTNA 1NXYA 1KGEA 4JF5A 3IF6B 3LO7A 3P98A 2PBYA 2UWXA 3NI9A 5F82A 4DKIA 1LLBA 2Y2IA 3G34A 4MLLA 3SH9A 4BLMA 3SS5A 1PZPA 4PM9A 4E3MA 4KZAA 4KZ3A 3BLMA 2WKIA 2WKEA 3N8RA 5HAQA 5M19A 3IF6C 3LCEA 3IWIA 1WYCA 3SOIA 4DXCA 4NK3A 5FI7A 3ZVWA 3M2JA 3G30A 1XGJA 3C4PA 5CERA 4UA9A 3C7VA 2A49A 5GL9A 4JXWA 4BENA 5J8XA 1K57A 5TFQA 1FSWA 4BL2A 4YFMA 4E3JA 2ZM8A 3PAEA 4QJGA 3FV7A 2P74A 3PBRA 1IKIA 3PBTA 4Y7PA 1E3UA 2ZQ8A 3ITBA 3QNBA 4XUXA 3TOIA 4E3NA 4KZ5A 1W79A 4PM6A 4DXBA 1GCEA 3G2ZA 4WMCD 3AGDA 4R4RA 3Q7VB 5AQ9A 4IBXA 3W4PA 1K54C 4E6XA 3LY4A 3LY3A 5FASA 4B88A 3G2YA 3OCNA 3AGEA 2Y2GA 4KG6A 1KGGA 2FFYA 4P85A 5A93A 1LHYA 3N7WA 4KZ8A 1W8QA 5E2HA 2HPBA 4EV4A 1PIOA 3HLEA 1PI4A 2RL3A 4R1GA 4WMCA 4IBRA 4UAAA 3UE0A 5DTSA 1IELA 2C6WB 4GD6A 4MEZA 5DVAA 2Y59A 3MKEA 2JE5A 1ERMA 4K0XA 4C3QA 1MY8A 4Q8IA 5L2FA 4OPQA 1K55A 2OLUA 4OPZA 3B3XA 4LV1A 1TVFA 1KVLA 4Y0UA 5I94A 5M18A 3ZG9B 3ZG5A 3GSGA 1OMEA 2ZC4B 4OPYA 3PBNA 2FFFB 2Y2LA 5G18A 4WZ5C 1LL9A 3PBOA 3NY4A 5GLBA 3FYZA 1PWDA 4OOMA 3BRMA 1BTLA 3HLBA 1I2WA 4QB8A 5TR7A 4X56A 1JWVA 2ZM0A 4OVDA 3FKWA 1FOFA 3S1YA 3O88A 2Z2LB 4DE1A 3VP3A 2E8IA 4OOYA 4E3IA 4IVIA 4OKPA 1ONHA 5CGWA 3GMWA 1TEMA 4JXGA 3BM6A 4MBFA 5CTMA 3N8LA 4KZ9A 3IXDA 1TDGA 4FCFA 4RYEA 3W4QA 3GR2A 5AQ7A 4GOGA 1PW8A 5F1GA 3WRZA 2ZQAA 1SDEA 1ESIA 3EQVA 1CI9A 3NBLA 3OPRA 3ZNYA 4D2OA 4K91A 2ZLYA 2XD5A 4KQRA 5M1AA 1O7EA 4JF4A 1K4FA 1RGYA 2C5WB 1BULA 4DDSA 1CEFA 1WYBA 2ZMAA 4R3BA 3GTCA 3VP1A 2Y4AA 4Z9QA 2V1ZA 2XD1A 4N9KA 3UPPA 4CJNA 5CEBA 2X02A 5GHXA 5CEDA 5FQ9A 2QMIA 3CJMA 3HUOA 1CK3A 1ZG6A 4E3OA 1BLCA 4MBKA 5EVLA 1L0EA 5FATA 1YMXA 5EUAA 2Q9MA 4EBNA 4BL3A 3MKFA 4X53A 3SH7A 1ZG4A 1YLJA 1QMFA 3QNCA 2HP9A 3IQAA 4EWFA 3UPOA 4KZ6A 2JC7A 3G31A 3VOYA
chains in the Genus database with same CATH superfamily
4KUKA 4ETZA 2UV0E 3GVBA 4B4XA 1OTIA 3OBFA 4KQOA 3VSLA 4WEKA 4N92A 3TE8A 2M1CA 3UDXA 2EFUA 2WUQA 1KDSA 2ZC5B 3VE3A 3DWZA 5FAQA 1LL8A 3UB6A 3VP2A 1KE4A 2BTFP 3N8SA 1TDLA 2HDUA 3IH9A 3W2ZA 3C38A 1EROA 3WRTA 1YT4A 2Y55A 4QD4A 2LB9A 1N4OA 4LV0A 5IS1A 4LV3A 1SKOB 5BOHA 4DMZA 1FR6A 1LSVA 1S67L 3Q1FA 3A3FA 1ES2A 5HD5A 4OQIA 4S2JA 2YKHA 2XFSA 3G4PA 3NOUC 2ZJ9A 1WA9A 2EX6A 1MWUA 1D7EA 5JYOA 3ZHHA 2ZQ7A 2ZC3B 2GNXA 3BY9A 4F3LB 3BQ8A 1OT6A 4YOFA 5G4ZA 5FQMA 3FKVA 2H10A 4GS9A 3IX8A 1ZKJA 2J80A 3K3CA 4N1HA 3PTEA 3L9KA 3TRCA 1XJ3A 4S2NC 1K0KA 2Y91A 3MQ0A 5DKKA 3IH8A 1YLTA 2XROA 1NZOA 1C3BA 2O0YA 3HLGA 3CZDA 4R70A 2KX6A 4L9EA 2V0UA 4HP9A 3BECA 3MFXA 2PD7A 4RX3A 4NXGA 3PBSA 2H0TA 4O0PA 4KZBA 3OCLA 3NCKA 3B33A 4YINA 2V9AA 1YLWA 4GNUA 1H3QA 3HLFA 3HLDA 2PR5A 1JNUA 1K38A 4NEED 4RX2A 5CGXA 3HVFA 5GLDA 1T1AA 4O01A 2J3TC 4BD0A 2ZQCA 3LYXA 4A5RA 5FQJA 2OAP1 5EECA 3LIEA 3BFGA 1I2SA 3LR3A 4EQIA 1ZC2A 2ZMVA 1F98A 4DRTA 5HL6A 5TBMA 1NLZA 3MZFA 3ZG7B 3OPLA 2XGNA 3NIAA 4LRYC 2BASA 3CI6A 2HDRA 3MZEA 4CQHA 2Y2MA 2PT7A 1HLUP 3ISGA 3ZDJA 1E4DA 2INWA 3K3DA 4I3JA 4EERA 2HZ5A 2VZWA 2ZM2A 3D3OA 3P7NA 5FQQA 2WKHA 1DJCA 1CEGA 4JXSA 1K56A 4Q0IA 3BFFA 2HP5A 2V8CA 3U4LP 4JLFA 4H8RA 4WZ5A 3UY6A 2EXAA 5F68A 3LI9A 4F3LA 4X69A 3MBZA 1OTEA 3MS6A 4GDNA 3VE4A 3L7HA 3MQQA 5F6AA 1K6RA 3RTYA 2G2WA 3Q07A 4HBTA 3VP4A 4S2NA 5J7EA 3HLCA 1MXOA 2P08A 3LEZA 2EWVA 3W4OA 1L0FA 4EW7A 3A3DA 4XXRA 3V50A 4S2MA 1FIKA 4NXEA 5TGFA 2PYRA 1BLHA 4JF6A 4N1XA 1J3WA 5E2FA 5FQKA 4HH2A 1S0WA 1O07A 4ZTKA 1NY0A 2G2UA 5HFOA 3IWOA 4BQMA 5KSHA 4WLAA 5C5KA 2R9XA 1ALQA 4KG2A 1GHIA 1I5QA 1YLPA 4WELA 4E6WA 4ZJ2A 3DTIA 3OC2A 4X25A 5FA7A 4KQQA 4OP5A 5CRFA 2KDKA 4II7A 5HW3A 1NJ4A 4PM5A 1ES4A 4UA6A 1G68A 1SDNA 3HUNA 2ZQ9A 5EFWA 2V0WA 1S4RA 2QKPA 3P98A 2PBYA 5F82A 3KYZA 3G34A 1SZVA 4BLMA 4HNBA 1DP6A 3KO6A 3BLMA 5HAQA 5M19A 3LCEA 2VV7A 3SOIA 4XT2B 3C4PA 3T1SA 1DRMA 5TFQA 4QJGA 5HWWA 3PBRA 2ZQ8A 1W79A 4PM6A 1YSQA 3G2ZA 3Q7VB 5AQ9A 3W4PA 2W1TA 5FASA 1S66L 3AGEA 1KGGA 2FFYA 5EM1A 4UEYA 5A93A 4KZ8A 3T50A 4EV4A 2WKQA 4IBRA 4UAAA 5DTSA 4MN7A 1IELA 1AWIA 3S7OA 2JE5A 1ERMA 4Q8IA 4NG2A 4LV1A 2KLIA 3ZG5A 3GSGA 2A24B 3KX0X 2FFFB 5G18A 3PBOA 3NY4A 3LR5A 4G3WA 3HLBA 2GJ3A 1JWVA 1FOFA 3MJQA 3LI8A 4PAUA 4E3IA 3RFBA 3UMEA 4JXGA 2QWSA 4MBFA 5F1GA 1SDEA 3OPRA 5A8BA 2XD5A 2QJ5A 1RGYA 2EA9A 1BULA 2ZMAA 3CPTB 4NXFA 1UWNX 3T4SA 2NUTC 2XD1A 1VEUB 2QMIA 5FQ9A 4GJ4A 1BLCA 3KSGA 1P9WA 2HP9A 5KIZA 3VOLA 3G31A 2XLNA 3VOZA 1GSVA 3FWLA 4IVKA 1NYMA 2JBFA 3DAVA 1ODVA 4MN5A 3CHWP 1FCOA 1IOUA 2H0YA 1XX2A 3P09A 4LGWA 4WEJA 3TSGA 4DE2A 2JKRI 1YMSA 4EUVA 1RCJA 3EEHA 1Z6FA 1XA1A 5DF7A 2QYBA 3IHBA 4ZJ3A 3LICA 5IU1A 2WGWA 3CAXA 3UDFA 4R3AA 4DE0A 4RVAA 2Z6DA 1G28A 2Y2HA 4ZBEA 5IHVA 1XJ6A 5DTTA 2WZZA 4HJ6A 2Y8HA 2Z2MB 1S4SA 2W3DA 3Q7VA 1IYSA 2Y2OA 2PYPA 3MXSA 1NWZA 2J7VA 5FQIA 3UE1A 5HAIA 2VJWA 3MF0A 1VB6A 3BJNA 1PNEA 2FZ0A 3UO9A 2PU4A 2VGKA 3HLWA 2VLGA 5F83A 3F1OB 3UMDA 2A24A 1ONGA 4Y0OA 3M6BA 4CLCB 3D4FA 1JWPA 4O7DA 3BEBA 1T1CA 1BT5A 3BY8A 4DF6A 1M40A 1RP5A 3NOTC 4ARZB 5KSCA 4CLCC 5EVIB 1NRJA 1KVMA 3VSKA 3UNWA 2EXBA 1OT9A 5EPHA 1GSXA 2XRNA 4S2LA 3T4TA 3T4LA 5EVIC 5FAOA 4X68A 3GECA 3MSHA 4L0LA 3LR4A 4PHTA 1VEUA 4BJPA 4ME4A 5GLAA 1N9BA 3HREA 3V5MA 3BQAA 2ZC7A 1L2SA 2EX9A 2V20A 5HDDA 5GLCA 2VX8A 4LV2A 2HV1A 4I38A 4GW9A 5L07A 1ES5A 4Y15A 3ZNTA 4KG5A 5KMWA 1U60A 4U0TA 4KZ7A 5TJJA 5FSRA 5A92A 4FH2A 5EM0A 2XR0A 4Q0JA 2B95A 4ZAMA 1W5DA 5JYPA 4JXVA 1H8ZA 3DWKA 3N6IA 3UB9A 3C30A 2H5SA 4C75A 3JYIA 4QY6A 1K54A 4LCLA 2D01A 1QMEA 2PD8A 1WE4A 1K56D 1G5UA 1IYOA 4MNRA 5DFYA 1XPBA 1L0DA 1VQQA 1NZUA 1IYQA 1HZOA 4DDYA 3E2KA 2HP6A 1K57C 1JTDA 5DTKA 3BLSA 3D9YA 3IHAA 3NJAA 4LRXC 5AJGA 3G32A 4OH0A 5EVEA 3PR6A 2VKSA 3F1OA 5HSQA 1YAXA 1F5MA 3NULA 2P7JA 3RH8B 3NDEA 4EXOA 2Y2JA 4CLCA 3O86A 2WKPA 3IXHA 1CQAA 2XFTA 5HD3A 1PI5A 4HJ4A 1JWZA 4R0QA 3C8CA 1PFLA 3OZHA 1UWPX 3LIDA 1MWTA 5EVIA 3IT9A 2XEPA 4ZRRA 1GHMA 4E04A 3A0RA 4OQ0A 3SW1A 4OP8A 1BLPA 3WS5A 3IF5A 3S7NA 4GKUA 1Y54A 3HUMA 2RCXA 4Q0HA 4MN6A 1MPLA 3RXWA 2HF6A 4KZ4A 2WYXA 1HTZA 2CC1A 5GHZA 5AQBA 5L09A 2JCHA 2L0WA 2J8YA 5DJUA 3NC8A 3DW0A 1KOUA 3TG9A 3WS0A 4X6TA 1HVBA 5F1FA 1K25A 5F5YA 2WK0A 2WKRA 1E25A 5HPFA 4P0MA 4E3LA 1STZA 2WAFA 1K4EA 2NUPC 3LGOA 4LCMA 4OLDA 3O3VA 4GHIB 3IF6B 3LO7A 2UWXA 3NI9A 1LLBA 4MLLA 5I5LA 3SS5A 1Z09A 4PM9A 1SKOA 3N8RA 2V8FA 3IF6C 3OLOA 4DXCA 4NK3A 3ZVWA 3M2JA 5FL3A 2VGLS 3G6OA 1TS6A 4PKYG 2EWWA 4UA9A 3E0YA 3H9WA 5GL9A 2YKFA 2HGVA 5J8XA 1K57A 4YFMA 1N9NA 2FH5A 1IKIA 3ITBA 3TOIA 1T1BA 3F1NB 3NOPC 3LY4A 3LY3A 3G2YA 2Y2GA 4Y17A 4KG6A 4P85A 2HPBA 3HLEA 1PI4A 4K08A 3QP4A 2C6WB 4GD6A 3MKEA 4OPZA 5M18A 1TVFA 5FEFA 1OMEA 4PKYA 3BWLA 5HDCA 3FYZA 4OOMA 3BRMA 1BTLA 4QB8A 5TR7A 4OVDA 3FKWA 3S1YA 1YSPA 4DE1A 3NHQA 5CGWA 3JVUA 5CTMA 4KZ9A 2VGLM 3NBLA 2ZLYA 1O7EA 1K4FA 1CJFA 1CEFA 4DJ3A 4R3BA 3VP1A 3T1RA 4N9KA 3UPPA 4HHDA 1LSXA 2PBDP 1EW0A 4R6LA 1X0OA 4E3OA 3E4OA 3O5YA 5EVLA 1YLJA 1QMFA 3IQAA 4EWFA 4KZ6A 2M7UA 2JC7A 3MQOA 3HL9A 4HY8A 3B47A 1W8YA 1FCNA 4GN2A 4GHIA 4UQIS 2O9BA 3HJKA 2VGJA 1L3LA 3A3IA 3VFFA 4IEDA 5L8MA 3DBAA 3MXRA 4LPZA 2ZC6B 4PMAA 1E3UD 1FR1A 4OLGA 2DRWA 3T4OA 2EX2A 2OWJA 3VP0A 1IFQA 4BBVA 2W3EA 4DN0A 4QHCA 1MWSA 4F94A 3UPNA 3IS2B 1YM1A 3F1NA 3ZFZA 2BG1A 2Y2KA 5DF8A 1D06A 3LIFA 4Z1WA 4R38A 4HJ3A 2DCFA 4QPRA 3AGFA 2QPNA 2OWHA 5CX7A 2QJ7A 4WM9A 2J9OA 1N9LA 2ZL1B 3R7WB 3C7UA 2G7UA 3ZCZA 2OLVA 4HESA 2XK1A 3H7WB 5L10A 3UDIA 2ZQDA 1ZTUA 2WGIA 1PW1A 3UN7A 4WN5A 5IT5A 4UQIM 2K31A 4NETA 4LFUA 4X1MA 1L0GA 2X71A 4FUWA 1TS7A 1IKGA 4G3VA 2CMNA 1G6AA 5E2GA 4NXBA 1NLYA 3LUQA 2M7VA 2O9AA 4WZ4A 1F2KA 1BLSA 3LEQA 3A3JA 4I39A 1YPRA 3CG5A 5FI6A 2JN7A 3V3RA 3QP6A 3GRJA 4CPKA 5EE8A 3S4XA 1OPXA 1XKZA 2E8JA 4GDBA 3UE3A 3GDIA 2P9VB 3GQZA 4I3IA 3EGXC 3IXBA 4IHQA 4BBUA 1J9MA 3C4OA 2MJ6A 5CGSA 5AQAA 1H0MA 3CLOA 3W8KA 4B9OA 2V2FF 3RXXA 3DTKA 3QP1A 3LFVA 4HEFA 3FG8A 4X55A 1PYYA 3UE6A 1OTBA 2GDNA 3T4KA 4IUHA 1EWZA 1PZOA 1T18A 4PM7A 5CHUA 4BD1A 1KGFA 4OPRA 3DTEA 1H5XA 4QU3A 5A90A 4YWZA 3C5AA 4XT2A 4BWIA 4I3AA 3Q82A 3N4IA 2A3UA 1ZHHB 5CHMA 2XF3A 1LL5A 4N9LA 2XA7S 5A91A 2PR6A 2EX8A 2XQZA 3QP2A 3EQUA 3E2LA 1RGZA 1UGUA 3LR0A 3JPUA 1PWGA 3MZDA 5E43A 1JVJA 4RQ9A 4I5SA 4WUJA 3ZQ5A 2WZXA 4WYYA 4GZBA 2R9WA 3V39A 1JTGA 5HAPA 4C6YA 1P9RA 1XXMA 1KE3A 3WS2A 5GHYA 2ZL1A 4RA7A 2L1MA 3FPVA 2KOIA 4CLCD 2IA2A 2ZOIA 3H7WA 4ETXA 2W27A 3CMZA 5HL1A 3DTMA 1CI8A 5EVID 4R4SA 3T4QA 5FI2A 5EV0A 4EEPA 2Y2QA 5EOEA 5MC7A 1P0ZA 4S2KA 4P87A 1MZUA 1KDWA 1YLZA 2XA7M 2XH9A 3V3SA 2PDRA 4MDZA 3OOVA 3CPTA 1S6RA 3OPPA 3T4JA 1LI9A 2XDMA 3I7JA 2P9VA 5DJTA 1SHVA 3ZYTA 3GV9A 3ITAA 4UA7A 2OOLA 2IWBA 3HCYA 4H6JB 4OOLA 2Y2PA 4YNRA 4Y13A 5HPIA 2VV8A 1MWRA 4HBUA 3ULFA 1YLYA 2VEAA 2HDSA 3PAGA 4LENA 3HBRA 1BSGA 3K2NA 1W7FA 1IYPA 3ICYA 4Y0TA 2D02A 4PPRA 3UB5P 1Q2QA 5CTNA 1NXYA 4JF5A 3SZTA 2DMWA 1OTAA 3NECA 4E3MA 4KZAA 4Y5FA 3IBRA 4HIAA 5FI7A 4B93A 5CERA 3QP8A 5TBMB 4HH3A 3C7VA 4BENA 1XFQA 4GLQA 2ACGA 2ZM8A 3PAEA 4IUKA 2P74A 3PBTA 3QNBA 4XUXA 1S1YA 4E3NA 2H28A 1GCEA 4P6ZS 5J4EA 3LIBA 4R4RA 4IBXA 2OAQ1 4JGQA 5AVFA 3N7WA 1PIOA 2RL3A 4R1GA 4WMCA 3UE0A 4KUOA 2Y59A 4K0XA 2OLUA 4ARZA 3B3XA 1KVLA 3ZG9B 5HZHA 3PBNA 4WZ5C 1LL9A 3V67A 1I2WA 3PYPA 4X56A 2ZM0A 2Z2LB 4Y3IA 2E8IA 2W3HA 3BM6A 3N8LA 1TS0A 3IXDA 4RYEA 3E98A 3W4QA 4GOGA 2ZQAA 3EQVA 1CI9A 2W0NA 3ZNYA 4D2OA 4K91A 5M1AA 2J3TD 4DDSA 4H6JA 3GTCA 2Y4AA 2V1ZA 3IX4A 2X02A 3EWKA 4P6ZM 3CJMA 1XFNA 3HUOA 3PXPA 1ZG6A 4MBKA 1L0EA 4NKPA 2PAVP 5FATA 1V9YA 1YMXA 4L9FA 4KQDA 4BL3A 3SH7A 1ZG4A 4ESPA 3UPOA 2ZOHA 2VK3A 2JKFA 3VOYA 1SCWA 4JGPA 1K6SA 3QP5A 2QHKA 4WL9A 2ZMFA 1GA9A 3PHYA 4BMWA 1LT0A 4BBTA 3PBQA 2BLSA 1DY6A 3MR0A 2JKRM 3NDGA 5G4YA 2JHEA 4U3TA 3FC7A 3H82B 4S2IA 2OV5A 4EU0A 3KSIA 3A3EA 1XP4A 4AFIA 4MBHA 2PHYA 3KSHA 4U0XA 5FDSA 2W3GA 5CHJA 3SH8A 1FILA 3SS3A 3IXGA 1IEMA 3Q81A 1D1JA 2PRFA 4LLOB 4JKTA 4S2PA 3VFHA 3QHYA 1Q2PA 1F9IA 4PM8A 1DP9A 2GZAA 3A0VA 2HDQA 5KZHA 2K7SA 5CXWA 3Q7ZA 4HP4A 3G35A 3IX3A 4R23A 4EETB 3P01A 2W1TB 4QWOA 2WGVA 4P6BA 2Q0OA 5AVEA 1NYYA 1KE0A 1SKFA 2DNSA 3D72A 3VMAA 1AXBA 5FDHA 2QZ6A 2JKTI 1YQSA 4WF0A 3CITA 1FCMA 2WADA 1OTDA 5D3OA 2B18A 5HX9A 3LIAA 1CF0A 3ZG8B 1EI5A 4IJGA 4D60A 4XUZA 3T12B 3MFDA 4OQGA 3M2KA 3T1QB 1H8YA 3BFEA 1ERQA 1DJBA 5DKLA 1TF1A 3MXQA 1MKIA 1BUEA 5E2EA 2HJ9C 3F1PB 3SS4A 3R4KA 2A2LA 3B42A 4S2OA 4EEUA 1DJAA 1LI0A 4QY5A 1OJGA 2V1BA 1HD8A 1DP8A 1GHPA 2Q9NA 3EGDC 5LBRA 3IF6A 3HJIA 3BFCA 3WS1A 2L4RA 3EEAA 2O99A 3BYDA 1N9OA 4DE3A 3FPWA 4MMNA 4EBLA 1VETB 2LB5A 3RJUA 2I72A 3WS4A 3H82A 3FZCA 1XGIA 2PU2A 1GSWA 4WBGA 5DF9A 3UB7A 1ES3A 1MC0A 4FSFA 1H8MA 3S22A 4GCZA 2WAEA 4HI4A 4LRZE 2GX5A 1MKMA 2X01A 3M6HA 4FH4A 4K0WA 4DJ2A 4UHUA 2K2NA 2WGWB 3A0SA 2AVXA 3C2WA 3T1XA 1MBLA 1NRFA 1A0KA 4GD8A 1GA0A 4JGOA 3S7PA 3OPHA 2XSSA 4EESA 1OJ5A 3VV4A 3CWFA 4OONA 4JGRA 3CUEC 2IWCA 5EOOA 2ZD8A 5FAPA 4MCWA 2HJEA 5HWTA 1VM1A 1XA7A 1FSYA 3ZGAB 1BZAA 4OQHA 1S1ZA 1K55C 2B5RA 4ZDXA 4ID4A 4JBFA 3MMHA 3O87A 1ESUA 4EQ1A 4FD8A 2Y2NA 3ZG0A 4B4ZA 1FQGA 5DFXA 4G3KA 4E3KA 2W1RA 4FTXA 4R3JA 4KENB 3BFDA 4EBPA 1TD5A 3U2AA 3BW6A 5K5BA 3IWQA 5U47A 2V1AA 4EUZA 4CLCE 2OSUA 3F1PA 4Y2FA 2I9VA 4M4XA 2IWDA 3WWXA 4L9GA 4M3KA 4GB7A 3E4QA 3KYQA 4ZJ1A 3ZVTA 1PWCA 2J9PA 1XJ4A 5CECA 5HARA 5F69A 4FOFA 2EFXA 4JPMA 1M6KA 3E4PA 1KGEA 1VETA 4DKIA 3TJZC 2Y2IA 3SH9A 1PZPA 3JVVA 4KZ3A 2WKIA 2WKEA 1ACFA 3IWIA 1V9ZA 1WYCA 3IS2A 1BYWA 1LSWA 5HDSA 3G30A 1XGJA 3S7QA 2A49A 4JXWA 1FSWA 4BL2A 4E3JA 3FV7A 2ZBBA 1VHMA 4Y7PA 1T19A 1E3UA 1TS8A 2JKGA 4KZ5A 4DXBA 3KSFA 3R7WA 1XJ2A 4WMCD 3AGDA 1K54C 4E6XA 3UB8A 3CUEA 4B88A 3OCNA 4X1LA 2VA0A 2R78A 1LHYA 1PRQA 1YKDA 1W8QA 5E2HA 4MEZA 5DVAA 4C3QA 1W63M 1MY8A 2W3FA 3KYEA 5L2FA 4OPQA 1K55A 4Y0UA 5I94A 2P04A 5HWVA 2ZC4B 4OPYA 5GLBA 2Y2LA 1P97A 4O8GA 1PWDA 4GS9B 3O88A 5J3WA 3VP3A 4OOYA 4IVIA 4OKPA 2JKTM 1ONHA 3GMWA 1TEMA 5FEGA 1TDGA 4FCFA 1W63Q 2B02A 3GR2A 2O9CA 5AQ7A 3WRZA 1PW8A 3TW8A 1ESIA 2VV6A 4KQRA 4JF4A 2C5WB 1Y4OA 1WYBA 4Z9QA 2Y79A 4CJNA 5CEBA 5GHXA 3EOIA 5CEDA 4HOIA 1CK3A 2J3WA 5EUAA 2Q9MA 4EBNA 3IBJA 3MKFA 4HQAA 4X53A 3QNCA 1G6OA 1Y28A 2Z6CA
chains in the Genus database with same CATH topology
3HL9A 2XLNA 3VOZA 1SCWA 1W8YA 1FCNA 3FWLA 1K6SA 4GN2A 4IVKA 3GVBA 1NYMA 4B4XA 2JBFA 4KQOA 3VSLA 4WEKA 4N92A 1FCOA 2VGJA 2EFUA 2WUQA 1KDSA 1GA9A 2H0YA 3UDXA 1XX2A 3A3IA 3P09A 2ZC5B 3VFFA 4WEJA 4IEDA 3TSGA 3DWZA 3PBQA 2BLSA 5FAQA 4DE2A 1YMSA 1DY6A 3VP2A 3MXRA 1KE4A 1RCJA 3N8SA 3NDGA 1TDLA 1Z6FA 1XA1A 5DF7A 2ZC6B 2HDUA 1E3UD 1FR1A 3IH9A 2DRWA 4OLGA 4PMAA 4U3TA 3IHBA 4ZJ3A 2EX2A 4S2IA 2OV5A 3VP0A 1EROA 2WGWA 3A3EA 3WRTA 1YT4A 2Y55A 4QD4A 3UDFA 1XP4A 4QHCA 1N4OA 4MBHA 4DE0A 4LV0A 1MWSA 4RVAA 4F94A 4U0XA 4LV3A 2Y2HA 4ZBEA 5BOHA 5IHVA 5CHJA 3UPNA 3SH8A 5DTTA 2WZZA 3SS3A 3IXGA 1FR6A 1YM1A 1IEMA 2Z2MB 3Q81A 3Q1FA 3ZFZA 2BG1A 3A3FA 2Y2KA 1ES2A 5DF8A 4OQIA 4JKTA 4S2PA 3VFHA 3QHYA 4S2JA 1Q2PA 2XFSA 3Q7VA 3G4PA 1IYSA 2DCFA 2Y2OA 4PM8A 2ZJ9A 3MXSA 3AGFA 2QPNA 2EX6A 1MWUA 2J7VA 5FQIA 4WM9A 2HDQA 5KZHA 3UE1A 2J9OA 5CXWA 5JYOA 3ZHHA 5HAIA 2ZQ7A 3Q7ZA 2ZC3B 3C7UA 3G35A 3UO9A 4R23A 3ZCZA 2OLVA 2PU4A 2VGKA 3HLWA 4HESA 5F83A 2XK1A 2WGVA 3UDIA 2ZQDA 4P6BA 2WGIA 1ONGA 1PW1A 1NYYA 1KE0A 3UN7A 1SKFA 3M6BA 4Y0OA 5FQMA 3FKVA 2DNSA 2H10A 3VMAA 1AXBA 3D4FA 4NETA 1JWPA 1ZKJA 4O7DA 5FDHA 3BEBA 2QZ6A 1L0GA 2X71A 1BT5A 4DF6A 1YQSA 1M40A 1IKGA 1RP5A 4N1HA 1FCMA 5KSCA 3PTEA 1G6AA 2WADA 5E2GA 4S2NC 5EVIB 1KVMA 3VSKA 5D3OA 3UNWA 2EXBA 5EPHA 2Y91A 5HX9A 3ZG8B 1EI5A 4WZ4A 1BLSA 4S2LA 3IH8A 1YLTA 3A3JA 4XUZA 1NZOA 5EVIC 1C3BA 3CG5A 3MFDA 5FI6A 5FAOA 3HLGA 4X68A 3V3RA 3CZDA 3GRJA 4OQGA 3M2KA 4CPKA 1H8YA 3BFEA 5EE8A 3S4XA 1XKZA 1ERQA 1DJBA 4GDBA 4L0LA 3UE3A 2P9VB 3BECA 3GQZA 4BJPA 5GLAA 4RX3A 1N9BA 3HREA 3PBSA 2H0TA 3V5MA 3IXBA 4KZBA 1MKIA 1BUEA 3OCLA 3NCKA 1J9MA 2ZC7A 3C4OA 1L2SA 2EX9A 2V20A 5CGSA 5E2EA 5AQAA 5GLCA 3SS4A 4S2OA 4YINA 3W8KA 4LV2A 1YLWA 2V2FF 3RXXA 1ES5A 1DJAA 1LI0A 4QY5A 3ZNTA 1HD8A 4GNUA 4KG5A 3HLFA 5KMWA 4HEFA 1GHPA 3HLDA 1U60A 2Q9NA 4U0TA 4X55A 4KZ7A 1K38A 3IF6A 1PYYA 4RX2A 5FSRA 5CGXA 4FH2A 5A92A 3HVFA 5GLDA 2XR0A 2GDNA 3BFCA 3WS1A 4BD0A 3BYDA 1EWZA 1PZOA 4ZAMA 2ZQCA 1W5DA 4PM7A 5CHUA 4A5RA 5FQJA 4BD1A 5EECA 1KGFA 4OPRA 1H5XA 4QU3A 5A90A 3BFGA 4DE3A 5JYPA 3C5AA 4JXVA 1I2SA 4EQIA 4EBLA 1ZC2A 1H8ZA 3RJUA 3DWKA 2I72A 3N6IA 4DRTA 3WS4A 3Q82A 3N4IA 2A3UA 3FZCA 5CHMA 1XGIA 3MZFA 2PU2A 2XF3A 4WBGA 1LL5A 4N9LA 5DF9A 5A91A 1ES3A 2H5SA 3ZG7B 4C75A 3OPLA 2XGNA 2EX8A 2XQZA 3JYIA 3NIAA 4FSFA 3EQUA 3E2LA 3S22A 4QY6A 1K54A 2WAEA 4LCLA 1RGZA 2HDRA 3MZEA 2Y2MA 2X01A 3M6HA 1PWGA 3MZDA 4FH4A 4K0WA 3ISGA 5E43A 1QMEA 3ZDJA 1WE4A 1JVJA 1E4DA 1K56D 4UHUA 1IYOA 4MNRA 2WGWB 1XPBA 2ZM2A 2WZXA 4WYYA 4GZBA 2R9WA 1L0DA 3V39A 5FQQA 1VQQA 2WKHA 1JTGA 1NZUA 5HAPA 4C6YA 1DJCA 1IYQA 1KE3A 1MBLA 1XXMA 1CEGA 1HZOA 4JXSA 4DDYA 1K56A 3WS2A 3E2KA 2HP6A 1NRFA 3BFFA 1K57C 5GHYA 1JTDA 2HP5A 5DTKA 4RA7A 3BLSA 4JLFA 3IHAA 4H8RA 4WZ5A 3UY6A 4GD8A 2EXAA 3G32A 4OH0A 1GA0A 4X69A 3MBZA 3OPHA 4GDNA 1K6RA 3CMZA 4OONA 5HL1A 2G2WA 3NDEA 3DTMA 1CI8A 3Q07A 2Y2JA 5EVID 2IWCA 4HBTA 5EOOA 4R4SA 3VP4A 4S2NA 2ZD8A 3O86A 3HLCA 3IXHA 5FAPA 1MXOA 3LEZA 2XFTA 1PI5A 5FI2A 1VM1A 2Y2QA 1JWZA 5EOEA 1XA7A 1FSYA 4R0QA 3ZGAB 1BZAA 3W4OA 3OZHA 4S2KA 4OQHA 1L0FA 4P87A 1MWTA 5EVIA 3A3DA 3IT9A 2XEPA 4XXRA 1KDWA 1K55C 2B5RA 3V50A 4ZDXA 4ID4A 4JBFA 1GHMA 1YLZA 4S2MA 5TGFA 2XH9A 3O87A 1ESUA 1BLHA 4JF6A 3V3SA 4N1XA 4OQ0A 5E2FA 5FQKA 4FD8A 4OP8A 1S0WA 1BLPA 3WS5A 1O07A 1S6RA 2Y2NA 4ZTKA 3ZG0A 3OPPA 3IF5A 4B4ZA 1NY0A 1FQGA 2G2UA 1LI9A 2XDMA 3I7JA 4GKUA 4E3KA 5HFOA 1Y54A 2P9VA 3HUMA 3IWOA 2RCXA 4R3JA 4KENB 3BFDA 1SHVA 4BQMA 4EBPA 3GV9A 5KSHA 1MPLA 3ITAA 3RXWA 4UA7A 4KZ4A 2IWBA 2WYXA 3IWQA 4OOLA 5U47A 2R9XA 1ALQA 4KG2A 1HTZA 2CC1A 4EUZA 1GHIA 2Y2PA 5GHZA 5AQBA 2OSUA 1I5QA 2JCHA 1YLPA 1MWRA 4WELA 4E6WA 4HBUA 2IWDA 2J8YA 3WWXA 1YLYA 4ZJ2A 3NC8A 3DW0A 2HDSA 3OC2A 3PAGA 4M3KA 4GB7A 3TG9A 3WS0A 5FA7A 4X6TA 4KQQA 1HVBA 4OP5A 5CRFA 1K25A 4ZJ1A 3ZVTA 2WK0A 5F1FA 4LENA 1E25A 3HBRA 1BSGA 1NJ4A 1PWCA 5HW3A 1W7FA 4P0MA 4E3LA 1IYPA 1ES4A 2J9PA 4UA6A 4PM5A 5CECA 1G68A 4Y0TA 1SDNA 3HUNA 2ZQ9A 2WAFA 1K4EA 5HARA 4JPMA 2EFXA 4PPRA 1Q2QA 1M6KA 4LCMA 4OLDA 3O3VA 5CTNA 1NXYA 1KGEA 4JF5A 3IF6B 3LO7A 3P98A 2PBYA 2UWXA 3NI9A 5F82A 4DKIA 1LLBA 2Y2IA 3G34A 4MLLA 3SH9A 4BLMA 3SS5A 1PZPA 4PM9A 4E3MA 4KZAA 4KZ3A 3BLMA 2WKIA 2WKEA 3N8RA 5HAQA 5M19A 3IF6C 3LCEA 3IWIA 1WYCA 3SOIA 4DXCA 4NK3A 5FI7A 3ZVWA 3M2JA 3G30A 1XGJA 3C4PA 5CERA 4UA9A 3C7VA 2A49A 5GL9A 4JXWA 4BENA 5J8XA 1K57A 5TFQA 1FSWA 4BL2A 4YFMA 4E3JA 2ZM8A 3PAEA 4QJGA 3FV7A 2P74A 3PBRA 1IKIA 3PBTA 4Y7PA 1E3UA 2ZQ8A 3ITBA 3QNBA 4XUXA 3TOIA 4E3NA 4KZ5A 1W79A 4PM6A 4DXBA 1GCEA 3G2ZA 4WMCD 3AGDA 4R4RA 3Q7VB 5AQ9A 4IBXA 3W4PA 1K54C 4E6XA 3LY4A 3LY3A 5FASA 4B88A 3G2YA 3OCNA 3AGEA 2Y2GA 4KG6A 1KGGA 2FFYA 4P85A 5A93A 1LHYA 3N7WA 4KZ8A 1W8QA 5E2HA 2HPBA 4EV4A 1PIOA 3HLEA 1PI4A 2RL3A 4R1GA 4WMCA 4IBRA 4UAAA 3UE0A 5DTSA 1IELA 2C6WB 4GD6A 4MEZA 5DVAA 2Y59A 3MKEA 2JE5A 1ERMA 4K0XA 4C3QA 1MY8A 4Q8IA 5L2FA 4OPQA 1K55A 2OLUA 4OPZA 3B3XA 4LV1A 1TVFA 1KVLA 4Y0UA 5I94A 5M18A 3ZG9B 3ZG5A 3GSGA 1OMEA 2ZC4B 4OPYA 3PBNA 2FFFB 2Y2LA 5G18A 4WZ5C 1LL9A 3PBOA 3NY4A 5GLBA 3FYZA 1PWDA 4OOMA 3BRMA 1BTLA 3HLBA 1I2WA 4QB8A 5TR7A 4X56A 1JWVA 2ZM0A 4OVDA 3FKWA 1FOFA 3S1YA 3O88A 2Z2LB 4DE1A 3VP3A 2E8IA 4OOYA 4E3IA 4IVIA 4OKPA 1ONHA 5CGWA 3GMWA 1TEMA 4JXGA 3BM6A 4MBFA 5CTMA 3N8LA 4KZ9A 3IXDA 1TDGA 4FCFA 4RYEA 3W4QA 3GR2A 5AQ7A 4GOGA 1PW8A 5F1GA 3WRZA 2ZQAA 1SDEA 1ESIA 3EQVA 1CI9A 3NBLA 3OPRA 3ZNYA 4D2OA 4K91A 2ZLYA 2XD5A 4KQRA 5M1AA 1O7EA 4JF4A 1K4FA 1RGYA 2C5WB 1BULA 4DDSA 1CEFA 1WYBA 2ZMAA 4R3BA 3GTCA 3VP1A 2Y4AA 4Z9QA 2V1ZA 2XD1A 4N9KA 3UPPA 4CJNA 5CEBA 2X02A 5GHXA 5CEDA 5FQ9A 2QMIA 3CJMA 3HUOA 1CK3A 1ZG6A 4E3OA 1BLCA 4MBKA 5EVLA 1L0EA 5FATA 1YMXA 5EUAA 2Q9MA 4EBNA 4BL3A 3MKFA 4X53A 3SH7A 1ZG4A 1YLJA 1QMFA 3QNCA 2HP9A 3IQAA 4EWFA 3UPOA 4KZ6A 2JC7A 3G31A 3VOYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HL9 A;  2XLN A;  3VOZ A;  1SCW A;  1W8Y A;  1FCN A;  3FWL A;  1K6S A;  4GN2 A;  4IVK A;  3GVB A;  1NYM A;  4B4X A;  2JBF A;  4KQO A;  3VSL A;  4WEK A;  4N92 A;  1FCO A;  2VGJ A;  2EFU A;  2WUQ A;  1KDS A;  1GA9 A;  2H0Y A;  3UDX A;  1XX2 A;  3A3I A;  3P09 A;  2ZC5 B;  3VFF A;  4WEJ A;  4IED A;  3TSG A;  3DWZ A;  3PBQ A;  2BLS A;  5FAQ A;  4DE2 A;  1YMS A;  1DY6 A;  3VP2 A;  3MXR A;  1KE4 A;  1RCJ A;  3N8S A;  3NDG A;  1TDL A;  1Z6F A;  1XA1 A;  5DF7 A;  2ZC6 B;  2HDU A;  1E3U D;  1FR1 A;  3IH9 A;  2DRW A;  4OLG A;  4PMA A;  4U3T A;  3IHB A;  4ZJ3 A;  2EX2 A;  4S2I A;  2OV5 A;  3VP0 A;  1ERO A;  2WGW A;  3A3E A;  3WRT A;  1YT4 A;  2Y55 A;  4QD4 A;  3UDF A;  1XP4 A;  4QHC A;  1N4O A;  4MBH A;  4DE0 A;  4LV0 A;  1MWS A;  4RVA A;  4F94 A;  4U0X A;  4LV3 A;  2Y2H A;  4ZBE A;  5BOH A;  5IHV A;  5CHJ A;  3UPN A;  3SH8 A;  5DTT A;  2WZZ A;  3SS3 A;  3IXG A;  1FR6 A;  1YM1 A;  1IEM A;  2Z2M B;  3Q81 A;  3Q1F A;  3ZFZ A;  2BG1 A;  3A3F A;  2Y2K A;  1ES2 A;  5DF8 A;  4OQI A;  4JKT A;  4S2P A;  3VFH A;  3QHY A;  4S2J A;  1Q2P A;  2XFS A;  3Q7V A;  3G4P A;  1IYS A;  2DCF A;  2Y2O A;  4PM8 A;  2ZJ9 A;  3MXS A;  3AGF A;  2QPN A;  2EX6 A;  1MWU A;  2J7V A;  5FQI A;  4WM9 A;  2HDQ A;  5KZH A;  3UE1 A;  2J9O A;  5CXW A;  5JYO A;  3ZHH A;  5HAI A;  2ZQ7 A;  3Q7Z A;  2ZC3 B;  3C7U A;  3G35 A;  3UO9 A;  4R23 A;  3ZCZ A;  2OLV A;  2PU4 A;  2VGK A;  3HLW A;  4HES A;  5F83 A;  2XK1 A;  2WGV A;  3UDI A;  2ZQD A;  4P6B A;  2WGI A;  1ONG A;  1PW1 A;  1NYY A;  1KE0 A;  3UN7 A;  1SKF A;  3M6B A;  4Y0O A;  5FQM A;  3FKV A;  2DNS A;  2H10 A;  3VMA A;  1AXB A;  3D4F A;  4NET A;  1JWP A;  1ZKJ A;  4O7D A;  5FDH A;  3BEB A;  2QZ6 A;  1L0G A;  2X71 A;  1BT5 A;  4DF6 A;  1YQS A;  1M40 A;  1IKG A;  1RP5 A;  4N1H A;  1FCM A;  5KSC A;  3PTE A;  1G6A A;  2WAD A;  5E2G A;  4S2N C;  5EVI B;  1KVM A;  3VSK A;  5D3O A;  3UNW A;  2EXB A;  5EPH A;  2Y91 A;  5HX9 A;  3ZG8 B;  1EI5 A;  4WZ4 A;  1BLS A;  4S2L A;  3IH8 A;  1YLT A;  3A3J A;  4XUZ A;  1NZO A;  5EVI C;  1C3B A;  3CG5 A;  3MFD A;  5FI6 A;  5FAO A;  3HLG A;  4X68 A;  3V3R A;  3CZD A;  3GRJ A;  4OQG A;  3M2K A;  4CPK A;  1H8Y A;  3BFE A;  5EE8 A;  3S4X A;  1XKZ A;  1ERQ A;  1DJB A;  4GDB A;  4L0L A;  3UE3 A;  2P9V B;  3BEC A;  3GQZ A;  4BJP A;  5GLA A;  4RX3 A;  1N9B A;  3HRE A;  3PBS A;  2H0T A;  3V5M A;  3IXB A;  4KZB A;  1MKI A;  1BUE A;  3OCL A;  3NCK A;  1J9M A;  2ZC7 A;  3C4O A;  1L2S A;  2EX9 A;  2V20 A;  5CGS A;  5E2E A;  5AQA A;  5GLC A;  3SS4 A;  4S2O A;  4YIN A;  3W8K A;  4LV2 A;  1YLW A;  2V2F F;  3RXX A;  1ES5 A;  1DJA A;  1LI0 A;  4QY5 A;  3ZNT A;  1HD8 A;  4GNU A;  4KG5 A;  3HLF A;  5KMW A;  4HEF A;  1GHP A;  3HLD A;  1U60 A;  2Q9N A;  4U0T A;  4X55 A;  4KZ7 A;  1K38 A;  3IF6 A;  1PYY A;  4RX2 A;  5FSR A;  5CGX A;  4FH2 A;  5A92 A;  3HVF A;  5GLD A;  2XR0 A;  2GDN A;  3BFC A;  3WS1 A;  4BD0 A;  3BYD A;  1EWZ A;  1PZO A;  4ZAM A;  2ZQC A;  1W5D A;  4PM7 A;  5CHU A;  4A5R A;  5FQJ A;  4BD1 A;  5EEC A;  1KGF A;  4OPR A;  1H5X A;  4QU3 A;  5A90 A;  3BFG A;  4DE3 A;  5JYP A;  3C5A A;  4JXV A;  1I2S A;  4EQI A;  4EBL A;  1ZC2 A;  1H8Z A;  3RJU A;  3DWK A;  2I72 A;  3N6I A;  4DRT A;  3WS4 A;  3Q82 A;  3N4I A;  2A3U A;  3FZC A;  5CHM A;  1XGI A;  3MZF A;  2PU2 A;  2XF3 A;  4WBG A;  1LL5 A;  4N9L A;  5DF9 A;  5A91 A;  1ES3 A;  2H5S A;  3ZG7 B;  4C75 A;  3OPL A;  2XGN A;  2EX8 A;  2XQZ A;  3JYI A;  3NIA A;  4FSF A;  3EQU A;  3E2L A;  3S22 A;  4QY6 A;  1K54 A;  2WAE A;  4LCL A;  1RGZ A;  2HDR A;  3MZE A;  2Y2M A;  2X01 A;  3M6H A;  1PWG A;  3MZD A;  4FH4 A;  4K0W A;  3ISG A;  5E43 A;  1QME A;  3ZDJ A;  1WE4 A;  1JVJ A;  1E4D A;  1K56 D;  4UHU A;  1IYO A;  4MNR A;  2WGW B;  1XPB A;  2ZM2 A;  2WZX A;  4WYY A;  4GZB A;  2R9W A;  1L0D A;  3V39 A;  5FQQ A;  1VQQ A;  2WKH A;  1JTG A;  1NZU A;  5HAP A;  4C6Y A;  1DJC A;  1IYQ A;  1KE3 A;  1MBL A;  1XXM A;  1CEG A;  1HZO A;  4JXS A;  4DDY A;  1K56 A;  3WS2 A;  3E2K A;  2HP6 A;  1NRF A;  3BFF A;  1K57 C;  5GHY A;  1JTD A;  2HP5 A;  5DTK A;  4RA7 A;  3BLS A;  4JLF A;  3IHA A;  4H8R A;  4WZ5 A;  3UY6 A;  4GD8 A;  2EXA A;  3G32 A;  4OH0 A;  1GA0 A;  4X69 A;  3MBZ A;  3OPH A;  4GDN A;  1K6R A;  3CMZ A;  4OON A;  5HL1 A;  2G2W A;  3NDE A;  3DTM A;  1CI8 A;  3Q07 A;  2Y2J A;  5EVI D;  2IWC A;  4HBT A;  5EOO A;  4R4S A;  3VP4 A;  4S2N A;  2ZD8 A;  3O86 A;  3HLC A;  3IXH A;  5FAP A;  1MXO A;  3LEZ A;  2XFT A;  1PI5 A;  5FI2 A;  1VM1 A;  2Y2Q A;  1JWZ A;  5EOE A;  1XA7 A;  1FSY A;  4R0Q A;  3ZGA B;  1BZA A;  3W4O A;  3OZH A;  4S2K A;  4OQH A;  1L0F A;  4P87 A;  1MWT A;  5EVI A;  3A3D A;  3IT9 A;  2XEP A;  4XXR A;  1KDW A;  1K55 C;  2B5R A;  3V50 A;  4ZDX A;  4ID4 A;  4JBF A;  1GHM A;  1YLZ A;  4S2M A;  5TGF A;  2XH9 A;  3O87 A;  1ESU A;  1BLH A;  4JF6 A;  3V3S A;  4N1X A;  4OQ0 A;  5E2F A;  5FQK A;  4FD8 A;  4OP8 A;  1S0W A;  1BLP A;  3WS5 A;  1O07 A;  1S6R A;  2Y2N A;  4ZTK A;  3ZG0 A;  3OPP A;  3IF5 A;  4B4Z A;  1NY0 A;  1FQG A;  2G2U A;  1LI9 A;  2XDM A;  3I7J A;  4GKU A;  4E3K A;  5HFO A;  1Y54 A;  2P9V A;  3HUM A;  3IWO A;  2RCX A;  4R3J A;  4KEN B;  3BFD A;  1SHV A;  4BQM A;  4EBP A;  3GV9 A;  5KSH A;  1MPL A;  3ITA A;  3RXW A;  4UA7 A;  4KZ4 A;  2IWB A;  2WYX A;  3IWQ A;  4OOL A;  5U47 A;  2R9X A;  1ALQ A;  4KG2 A;  1HTZ A;  2CC1 A;  4EUZ A;  1GHI A;  2Y2P A;  5GHZ A;  5AQB A;  2OSU A;  1I5Q A;  2JCH A;  1YLP A;  1MWR A;  4WEL A;  4E6W A;  4HBU A;  2IWD A;  2J8Y A;  3WWX A;  1YLY A;  4ZJ2 A;  3NC8 A;  3DW0 A;  2HDS A;  3OC2 A;  3PAG A;  4M3K A;  4GB7 A;  3TG9 A;  3WS0 A;  5FA7 A;  4X6T A;  4KQQ A;  1HVB A;  4OP5 A;  5CRF A;  1K25 A;  4ZJ1 A;  3ZVT A;  2WK0 A;  5F1F A;  4LEN A;  1E25 A;  3HBR A;  1BSG A;  1NJ4 A;  1PWC A;  5HW3 A;  1W7F A;  4P0M A;  4E3L A;  1IYP A;  1ES4 A;  2J9P A;  4UA6 A;  4PM5 A;  5CEC A;  1G68 A;  4Y0T A;  1SDN A;  3HUN A;  2ZQ9 A;  2WAF A;  1K4E A;  5HAR A;  4JPM A;  2EFX A;  4PPR A;  1Q2Q A;  1M6K A;  4LCM A;  4OLD A;  3O3V A;  5CTN A;  1NXY A;  1KGE A;  4JF5 A;  3IF6 B;  3LO7 A;  3P98 A;  2PBY A;  2UWX A;  3NI9 A;  5F82 A;  4DKI A;  1LLB A;  2Y2I A;  3G34 A;  4MLL A;  3SH9 A;  4BLM A;  3SS5 A;  1PZP A;  4PM9 A;  4E3M A;  4KZA A;  4KZ3 A;  3BLM A;  2WKI A;  2WKE A;  3N8R A;  5HAQ A;  5M19 A;  3IF6 C;  3LCE A;  3IWI A;  1WYC A;  3SOI A;  4DXC A;  4NK3 A;  5FI7 A;  3ZVW A;  3M2J A;  3G30 A;  1XGJ A;  3C4P A;  5CER A;  4UA9 A;  3C7V A;  2A49 A;  5GL9 A;  4JXW A;  4BEN A;  5J8X A;  1K57 A;  5TFQ A;  1FSW A;  4BL2 A;  4YFM A;  4E3J A;  2ZM8 A;  3PAE A;  4QJG A;  3FV7 A;  2P74 A;  3PBR A;  1IKI A;  3PBT A;  4Y7P A;  1E3U A;  2ZQ8 A;  3ITB A;  3QNB A;  4XUX A;  3TOI A;  4E3N A;  4KZ5 A;  1W79 A;  4PM6 A;  4DXB A;  1GCE A;  3G2Z A;  4WMC D;  3AGD A;  4R4R A;  3Q7V B;  5AQ9 A;  4IBX A;  3W4P A;  1K54 C;  4E6X A;  3LY4 A;  3LY3 A;  5FAS A;  4B88 A;  3G2Y A;  3OCN A;  3AGE A;  2Y2G A;  4KG6 A;  1KGG A;  2FFY A;  4P85 A;  5A93 A;  1LHY A;  3N7W A;  4KZ8 A;  1W8Q A;  5E2H A;  2HPB A;  4EV4 A;  1PIO A;  3HLE A;  1PI4 A;  2RL3 A;  4R1G A;  4WMC A;  4IBR A;  4UAA A;  3UE0 A;  5DTS A;  1IEL A;  2C6W B;  4GD6 A;  4MEZ A;  5DVA A;  2Y59 A;  3MKE A;  2JE5 A;  1ERM A;  4K0X A;  4C3Q A;  1MY8 A;  4Q8I A;  5L2F A;  4OPQ A;  1K55 A;  2OLU A;  4OPZ A;  3B3X A;  4LV1 A;  1TVF A;  1KVL A;  4Y0U A;  5I94 A;  5M18 A;  3ZG9 B;  3ZG5 A;  3GSG A;  1OME A;  2ZC4 B;  4OPY A;  3PBN A;  2FFF B;  2Y2L A;  5G18 A;  4WZ5 C;  1LL9 A;  3PBO A;  3NY4 A;  5GLB A;  3FYZ A;  1PWD A;  4OOM A;  3BRM A;  1BTL A;  3HLB A;  1I2W A;  4QB8 A;  5TR7 A;  4X56 A;  1JWV A;  2ZM0 A;  4OVD A;  3FKW A;  1FOF A;  3S1Y A;  3O88 A;  2Z2L B;  4DE1 A;  3VP3 A;  2E8I A;  4OOY A;  4E3I A;  4IVI A;  4OKP A;  1ONH A;  5CGW A;  3GMW A;  1TEM A;  4JXG A;  3BM6 A;  4MBF A;  5CTM A;  3N8L A;  4KZ9 A;  3IXD A;  1TDG A;  4FCF A;  4RYE A;  3W4Q A;  3GR2 A;  5AQ7 A;  4GOG A;  1PW8 A;  5F1G A;  3WRZ A;  2ZQA A;  1SDE A;  1ESI A;  3EQV A;  1CI9 A;  3NBL A;  3OPR A;  3ZNY A;  4D2O A;  4K91 A;  2ZLY A;  2XD5 A;  4KQR A;  5M1A A;  1O7E A;  4JF4 A;  1K4F A;  1RGY A;  2C5W B;  1BUL A;  4DDS A;  1CEF A;  1WYB A;  2ZMA A;  4R3B A;  3GTC A;  3VP1 A;  2Y4A A;  4Z9Q A;  2V1Z A;  2XD1 A;  4N9K A;  3UPP A;  4CJN A;  5CEB A;  2X02 A;  5GHX A;  5CED A;  5FQ9 A;  2QMI A;  3CJM A;  3HUO A;  1CK3 A;  1ZG6 A;  4E3O A;  1BLC A;  4MBK A;  5EVL A;  1L0E A;  5FAT A;  1YMX A;  5EUA A;  2Q9M A;  4EBN A;  4BL3 A;  3MKF A;  4X53 A;  3SH7 A;  1ZG4 A;  1YLJ A;  1QMF A;  3QNC A;  2HP9 A;  3IQA A;  4EWF A;  3UPO A;  4KZ6 A;  2JC7 A;  3G31 A;  3VOY A; 
#chains in the Genus database with same CATH topology
 4KUK A;  4ETZ A;  2UV0 E;  3GVB A;  4B4X A;  1OTI A;  3OBF A;  4KQO A;  3VSL A;  4WEK A;  4N92 A;  3TE8 A;  2M1C A;  3UDX A;  2EFU A;  2WUQ A;  1KDS A;  2ZC5 B;  3VE3 A;  3DWZ A;  5FAQ A;  1LL8 A;  3UB6 A;  3VP2 A;  1KE4 A;  2BTF P;  3N8S A;  1TDL A;  2HDU A;  3IH9 A;  3W2Z A;  3C38 A;  1ERO A;  3WRT A;  1YT4 A;  2Y55 A;  4QD4 A;  2LB9 A;  1N4O A;  4LV0 A;  5IS1 A;  4LV3 A;  1SKO B;  5BOH A;  4DMZ A;  1FR6 A;  1LSV A;  1S67 L;  3Q1F A;  3A3F A;  1ES2 A;  5HD5 A;  4OQI A;  4S2J A;  2YKH A;  2XFS A;  3G4P A;  3NOU C;  2ZJ9 A;  1WA9 A;  2EX6 A;  1MWU A;  1D7E A;  5JYO A;  3ZHH A;  2ZQ7 A;  2ZC3 B;  2GNX A;  3BY9 A;  4F3L B;  3BQ8 A;  1OT6 A;  4YOF A;  5G4Z A;  5FQM A;  3FKV A;  2H10 A;  4GS9 A;  3IX8 A;  1ZKJ A;  2J80 A;  3K3C A;  4N1H A;  3PTE A;  3L9K A;  3TRC A;  1XJ3 A;  4S2N C;  1K0K A;  2Y91 A;  3MQ0 A;  5DKK A;  3IH8 A;  1YLT A;  2XRO A;  1NZO A;  1C3B A;  2O0Y A;  3HLG A;  3CZD A;  4R70 A;  2KX6 A;  4L9E A;  2V0U A;  4HP9 A;  3BEC A;  3MFX A;  2PD7 A;  4RX3 A;  4NXG A;  3PBS A;  2H0T A;  4O0P A;  4KZB A;  3OCL A;  3NCK A;  3B33 A;  4YIN A;  2V9A A;  1YLW A;  4GNU A;  1H3Q A;  3HLF A;  3HLD A;  2PR5 A;  1JNU A;  1K38 A;  4NEE D;  4RX2 A;  5CGX A;  3HVF A;  5GLD A;  1T1A A;  4O01 A;  2J3T C;  4BD0 A;  2ZQC A;  3LYX A;  4A5R A;  5FQJ A;  2OAP 1;  5EEC A;  3LIE A;  3BFG A;  1I2S A;  3LR3 A;  4EQI A;  1ZC2 A;  2ZMV A;  1F98 A;  4DRT A;  5HL6 A;  5TBM A;  1NLZ A;  3MZF A;  3ZG7 B;  3OPL A;  2XGN A;  3NIA A;  4LRY C;  2BAS A;  3CI6 A;  2HDR A;  3MZE A;  4CQH A;  2Y2M A;  2PT7 A;  1HLU P;  3ISG A;  3ZDJ A;  1E4D A;  2INW A;  3K3D A;  4I3J A;  4EER A;  2HZ5 A;  2VZW A;  2ZM2 A;  3D3O A;  3P7N A;  5FQQ A;  2WKH A;  1DJC A;  1CEG A;  4JXS A;  1K56 A;  4Q0I A;  3BFF A;  2HP5 A;  2V8C A;  3U4L P;  4JLF A;  4H8R A;  4WZ5 A;  3UY6 A;  2EXA A;  5F68 A;  3LI9 A;  4F3L A;  4X69 A;  3MBZ A;  1OTE A;  3MS6 A;  4GDN A;  3VE4 A;  3L7H A;  3MQQ A;  5F6A A;  1K6R A;  3RTY A;  2G2W A;  3Q07 A;  4HBT A;  3VP4 A;  4S2N A;  5J7E A;  3HLC A;  1MXO A;  2P08 A;  3LEZ A;  2EWV A;  3W4O A;  1L0F A;  4EW7 A;  3A3D A;  4XXR A;  3V50 A;  4S2M A;  1FIK A;  4NXE A;  5TGF A;  2PYR A;  1BLH A;  4JF6 A;  4N1X A;  1J3W A;  5E2F A;  5FQK A;  4HH2 A;  1S0W A;  1O07 A;  4ZTK A;  1NY0 A;  2G2U A;  5HFO A;  3IWO A;  4BQM A;  5KSH A;  4WLA A;  5C5K A;  2R9X A;  1ALQ A;  4KG2 A;  1GHI A;  1I5Q A;  1YLP A;  4WEL A;  4E6W A;  4ZJ2 A;  3DTI A;  3OC2 A;  4X25 A;  5FA7 A;  4KQQ A;  4OP5 A;  5CRF A;  2KDK A;  4II7 A;  5HW3 A;  1NJ4 A;  4PM5 A;  1ES4 A;  4UA6 A;  1G68 A;  1SDN A;  3HUN A;  2ZQ9 A;  5EFW A;  2V0W A;  1S4R A;  2QKP A;  3P98 A;  2PBY A;  5F82 A;  3KYZ A;  3G34 A;  1SZV A;  4BLM A;  4HNB A;  1DP6 A;  3KO6 A;  3BLM A;  5HAQ A;  5M19 A;  3LCE A;  2VV7 A;  3SOI A;  4XT2 B;  3C4P A;  3T1S A;  1DRM A;  5TFQ A;  4QJG A;  5HWW A;  3PBR A;  2ZQ8 A;  1W79 A;  4PM6 A;  1YSQ A;  3G2Z A;  3Q7V B;  5AQ9 A;  3W4P A;  2W1T A;  5FAS A;  1S66 L;  3AGE A;  1KGG A;  2FFY A;  5EM1 A;  4UEY A;  5A93 A;  4KZ8 A;  3T50 A;  4EV4 A;  2WKQ A;  4IBR A;  4UAA A;  5DTS A;  4MN7 A;  1IEL A;  1AWI A;  3S7O A;  2JE5 A;  1ERM A;  4Q8I A;  4NG2 A;  4LV1 A;  2KLI A;  3ZG5 A;  3GSG A;  2A24 B;  3KX0 X;  2FFF B;  5G18 A;  3PBO A;  3NY4 A;  3LR5 A;  4G3W A;  3HLB A;  2GJ3 A;  1JWV A;  1FOF A;  3MJQ A;  3LI8 A;  4PAU A;  4E3I A;  3RFB A;  3UME A;  4JXG A;  2QWS A;  4MBF A;  5F1G A;  1SDE A;  3OPR A;  5A8B A;  2XD5 A;  2QJ5 A;  1RGY A;  2EA9 A;  1BUL A;  2ZMA A;  3CPT B;  4NXF A;  1UWN X;  3T4S A;  2NUT C;  2XD1 A;  1VEU B;  2QMI A;  5FQ9 A;  4GJ4 A;  1BLC A;  3KSG A;  1P9W A;  2HP9 A;  5KIZ A;  3VOL A;  3G31 A;  2XLN A;  3VOZ A;  1GSV A;  3FWL A;  4IVK A;  1NYM A;  2JBF A;  3DAV A;  1ODV A;  4MN5 A;  3CHW P;  1FCO A;  1IOU A;  2H0Y A;  1XX2 A;  3P09 A;  4LGW A;  4WEJ A;  3TSG A;  4DE2 A;  2JKR I;  1YMS A;  4EUV A;  1RCJ A;  3EEH A;  1Z6F A;  1XA1 A;  5DF7 A;  2QYB A;  3IHB A;  4ZJ3 A;  3LIC A;  5IU1 A;  2WGW A;  3CAX A;  3UDF A;  4R3A A;  4DE0 A;  4RVA A;  2Z6D A;  1G28 A;  2Y2H A;  4ZBE A;  5IHV A;  1XJ6 A;  5DTT A;  2WZZ A;  4HJ6 A;  2Y8H A;  2Z2M B;  1S4S A;  2W3D A;  3Q7V A;  1IYS A;  2Y2O A;  2PYP A;  3MXS A;  1NWZ A;  2J7V A;  5FQI A;  3UE1 A;  5HAI A;  2VJW A;  3MF0 A;  1VB6 A;  3BJN A;  1PNE A;  2FZ0 A;  3UO9 A;  2PU4 A;  2VGK A;  3HLW A;  2VLG A;  5F83 A;  3F1O B;  3UMD A;  2A24 A;  1ONG A;  4Y0O A;  3M6B A;  4CLC B;  3D4F A;  1JWP A;  4O7D A;  3BEB A;  1T1C A;  1BT5 A;  3BY8 A;  4DF6 A;  1M40 A;  1RP5 A;  3NOT C;  4ARZ B;  5KSC A;  4CLC C;  5EVI B;  1NRJ A;  1KVM A;  3VSK A;  3UNW A;  2EXB A;  1OT9 A;  5EPH A;  1GSX A;  2XRN A;  4S2L A;  3T4T A;  3T4L A;  5EVI C;  5FAO A;  4X68 A;  3GEC A;  3MSH A;  4L0L A;  3LR4 A;  4PHT A;  1VEU A;  4BJP A;  4ME4 A;  5GLA A;  1N9B A;  3HRE A;  3V5M A;  3BQA A;  2ZC7 A;  1L2S A;  2EX9 A;  2V20 A;  5HDD A;  5GLC A;  2VX8 A;  4LV2 A;  2HV1 A;  4I38 A;  4GW9 A;  5L07 A;  1ES5 A;  4Y15 A;  3ZNT A;  4KG5 A;  5KMW A;  1U60 A;  4U0T A;  4KZ7 A;  5TJJ A;  5FSR A;  5A92 A;  4FH2 A;  5EM0 A;  2XR0 A;  4Q0J A;  2B95 A;  4ZAM A;  1W5D A;  5JYP A;  4JXV A;  1H8Z A;  3DWK A;  3N6I A;  3UB9 A;  3C30 A;  2H5S A;  4C75 A;  3JYI A;  4QY6 A;  1K54 A;  4LCL A;  2D01 A;  1QME A;  2PD8 A;  1WE4 A;  1K56 D;  1G5U A;  1IYO A;  4MNR A;  5DFY A;  1XPB A;  1L0D A;  1VQQ A;  1NZU A;  1IYQ A;  1HZO A;  4DDY A;  3E2K A;  2HP6 A;  1K57 C;  1JTD A;  5DTK A;  3BLS A;  3D9Y A;  3IHA A;  3NJA A;  4LRX C;  5AJG A;  3G32 A;  4OH0 A;  5EVE A;  3PR6 A;  2VKS A;  3F1O A;  5HSQ A;  1YAX A;  1F5M A;  3NUL A;  2P7J A;  3RH8 B;  3NDE A;  4EXO A;  2Y2J A;  4CLC A;  3O86 A;  2WKP A;  3IXH A;  1CQA A;  2XFT A;  5HD3 A;  1PI5 A;  4HJ4 A;  1JWZ A;  4R0Q A;  3C8C A;  1PFL A;  3OZH A;  1UWP X;  3LID A;  1MWT A;  5EVI A;  3IT9 A;  2XEP A;  4ZRR A;  1GHM A;  4E04 A;  3A0R A;  4OQ0 A;  3SW1 A;  4OP8 A;  1BLP A;  3WS5 A;  3IF5 A;  3S7N A;  4GKU A;  1Y54 A;  3HUM A;  2RCX A;  4Q0H A;  4MN6 A;  1MPL A;  3RXW A;  2HF6 A;  4KZ4 A;  2WYX A;  1HTZ A;  2CC1 A;  5GHZ A;  5AQB A;  5L09 A;  2JCH A;  2L0W A;  2J8Y A;  5DJU A;  3NC8 A;  3DW0 A;  1KOU A;  3TG9 A;  3WS0 A;  4X6T A;  1HVB A;  5F1F A;  1K25 A;  5F5Y A;  2WK0 A;  2WKR A;  1E25 A;  5HPF A;  4P0M A;  4E3L A;  1STZ A;  2WAF A;  1K4E A;  2NUP C;  3LGO A;  4LCM A;  4OLD A;  3O3V A;  4GHI B;  3IF6 B;  3LO7 A;  2UWX A;  3NI9 A;  1LLB A;  4MLL A;  5I5L A;  3SS5 A;  1Z09 A;  4PM9 A;  1SKO A;  3N8R A;  2V8F A;  3IF6 C;  3OLO A;  4DXC A;  4NK3 A;  3ZVW A;  3M2J A;  5FL3 A;  2VGL S;  3G6O A;  1TS6 A;  4PKY G;  2EWW A;  4UA9 A;  3E0Y A;  3H9W A;  5GL9 A;  2YKF A;  2HGV A;  5J8X A;  1K57 A;  4YFM A;  1N9N A;  2FH5 A;  1IKI A;  3ITB A;  3TOI A;  1T1B A;  3F1N B;  3NOP C;  3LY4 A;  3LY3 A;  3G2Y A;  2Y2G A;  4Y17 A;  4KG6 A;  4P85 A;  2HPB A;  3HLE A;  1PI4 A;  4K08 A;  3QP4 A;  2C6W B;  4GD6 A;  3MKE A;  4OPZ A;  5M18 A;  1TVF A;  5FEF A;  1OME A;  4PKY A;  3BWL A;  5HDC A;  3FYZ A;  4OOM A;  3BRM A;  1BTL A;  4QB8 A;  5TR7 A;  4OVD A;  3FKW A;  3S1Y A;  1YSP A;  4DE1 A;  3NHQ A;  5CGW A;  3JVU A;  5CTM A;  4KZ9 A;  2VGL M;  3NBL A;  2ZLY A;  1O7E A;  1K4F A;  1CJF A;  1CEF A;  4DJ3 A;  4R3B A;  3VP1 A;  3T1R A;  4N9K A;  3UPP A;  4HHD A;  1LSX A;  2PBD P;  1EW0 A;  4R6L A;  1X0O A;  4E3O A;  3E4O A;  3O5Y A;  5EVL A;  1YLJ A;  1QMF A;  3IQA A;  4EWF A;  4KZ6 A;  2M7U A;  2JC7 A;  3MQO A;  3HL9 A;  4HY8 A;  3B47 A;  1W8Y A;  1FCN A;  4GN2 A;  4GHI A;  4UQI S;  2O9B A;  3HJK A;  2VGJ A;  1L3L A;  3A3I A;  3VFF A;  4IED A;  5L8M A;  3DBA A;  3MXR A;  4LPZ A;  2ZC6 B;  4PMA A;  1E3U D;  1FR1 A;  4OLG A;  2DRW A;  3T4O A;  2EX2 A;  2OWJ A;  3VP0 A;  1IFQ A;  4BBV A;  2W3E A;  4DN0 A;  4QHC A;  1MWS A;  4F94 A;  3UPN A;  3IS2 B;  1YM1 A;  3F1N A;  3ZFZ A;  2BG1 A;  2Y2K A;  5DF8 A;  1D06 A;  3LIF A;  4Z1W A;  4R38 A;  4HJ3 A;  2DCF A;  4QPR A;  3AGF A;  2QPN A;  2OWH A;  5CX7 A;  2QJ7 A;  4WM9 A;  2J9O A;  1N9L A;  2ZL1 B;  3R7W B;  3C7U A;  2G7U A;  3ZCZ A;  2OLV A;  4HES A;  2XK1 A;  3H7W B;  5L10 A;  3UDI A;  2ZQD A;  1ZTU A;  2WGI A;  1PW1 A;  3UN7 A;  4WN5 A;  5IT5 A;  4UQI M;  2K31 A;  4NET A;  4LFU A;  4X1M A;  1L0G A;  2X71 A;  4FUW A;  1TS7 A;  1IKG A;  4G3V A;  2CMN A;  1G6A A;  5E2G A;  4NXB A;  1NLY A;  3LUQ A;  2M7V A;  2O9A A;  4WZ4 A;  1F2K A;  1BLS A;  3LEQ A;  3A3J A;  4I39 A;  1YPR A;  3CG5 A;  5FI6 A;  2JN7 A;  3V3R A;  3QP6 A;  3GRJ A;  4CPK A;  5EE8 A;  3S4X A;  1OPX A;  1XKZ A;  2E8J A;  4GDB A;  3UE3 A;  3GDI A;  2P9V B;  3GQZ A;  4I3I A;  3EGX C;  3IXB A;  4IHQ A;  4BBU A;  1J9M A;  3C4O A;  2MJ6 A;  5CGS A;  5AQA A;  1H0M A;  3CLO A;  3W8K A;  4B9O A;  2V2F F;  3RXX A;  3DTK A;  3QP1 A;  3LFV A;  4HEF A;  3FG8 A;  4X55 A;  1PYY A;  3UE6 A;  1OTB A;  2GDN A;  3T4K A;  4IUH A;  1EWZ A;  1PZO A;  1T18 A;  4PM7 A;  5CHU A;  4BD1 A;  1KGF A;  4OPR A;  3DTE A;  1H5X A;  4QU3 A;  5A90 A;  4YWZ A;  3C5A A;  4XT2 A;  4BWI A;  4I3A A;  3Q82 A;  3N4I A;  2A3U A;  1ZHH B;  5CHM A;  2XF3 A;  1LL5 A;  4N9L A;  2XA7 S;  5A91 A;  2PR6 A;  2EX8 A;  2XQZ A;  3QP2 A;  3EQU A;  3E2L A;  1RGZ A;  1UGU A;  3LR0 A;  3JPU A;  1PWG A;  3MZD A;  5E43 A;  1JVJ A;  4RQ9 A;  4I5S A;  4WUJ A;  3ZQ5 A;  2WZX A;  4WYY A;  4GZB A;  2R9W A;  3V39 A;  1JTG A;  5HAP A;  4C6Y A;  1P9R A;  1XXM A;  1KE3 A;  3WS2 A;  5GHY A;  2ZL1 A;  4RA7 A;  2L1M A;  3FPV A;  2KOI A;  4CLC D;  2IA2 A;  2ZOI A;  3H7W A;  4ETX A;  2W27 A;  3CMZ A;  5HL1 A;  3DTM A;  1CI8 A;  5EVI D;  4R4S A;  3T4Q A;  5FI2 A;  5EV0 A;  4EEP A;  2Y2Q A;  5EOE A;  5MC7 A;  1P0Z A;  4S2K A;  4P87 A;  1MZU A;  1KDW A;  1YLZ A;  2XA7 M;  2XH9 A;  3V3S A;  2PDR A;  4MDZ A;  3OOV A;  3CPT A;  1S6R A;  3OPP A;  3T4J A;  1LI9 A;  2XDM A;  3I7J A;  2P9V A;  5DJT A;  1SHV A;  3ZYT A;  3GV9 A;  3ITA A;  4UA7 A;  2OOL A;  2IWB A;  3HCY A;  4H6J B;  4OOL A;  2Y2P A;  4YNR A;  4Y13 A;  5HPI A;  2VV8 A;  1MWR A;  4HBU A;  3ULF A;  1YLY A;  2VEA A;  2HDS A;  3PAG A;  4LEN A;  3HBR A;  1BSG A;  3K2N A;  1W7F A;  1IYP A;  3ICY A;  4Y0T A;  2D02 A;  4PPR A;  3UB5 P;  1Q2Q A;  5CTN A;  1NXY A;  4JF5 A;  3SZT A;  2DMW A;  1OTA A;  3NEC A;  4E3M A;  4KZA A;  4Y5F A;  3IBR A;  4HIA A;  5FI7 A;  4B93 A;  5CER A;  3QP8 A;  5TBM B;  4HH3 A;  3C7V A;  4BEN A;  1XFQ A;  4GLQ A;  2ACG A;  2ZM8 A;  3PAE A;  4IUK A;  2P74 A;  3PBT A;  3QNB A;  4XUX A;  1S1Y A;  4E3N A;  2H28 A;  1GCE A;  4P6Z S;  5J4E A;  3LIB A;  4R4R A;  4IBX A;  2OAQ 1;  4JGQ A;  5AVF A;  3N7W A;  1PIO A;  2RL3 A;  4R1G A;  4WMC A;  3UE0 A;  4KUO A;  2Y59 A;  4K0X A;  2OLU A;  4ARZ A;  3B3X A;  1KVL A;  3ZG9 B;  5HZH A;  3PBN A;  4WZ5 C;  1LL9 A;  3V67 A;  1I2W A;  3PYP A;  4X56 A;  2ZM0 A;  2Z2L B;  4Y3I A;  2E8I A;  2W3H A;  3BM6 A;  3N8L A;  1TS0 A;  3IXD A;  4RYE A;  3E98 A;  3W4Q A;  4GOG A;  2ZQA A;  3EQV A;  1CI9 A;  2W0N A;  3ZNY A;  4D2O A;  4K91 A;  5M1A A;  2J3T D;  4DDS A;  4H6J A;  3GTC A;  2Y4A A;  2V1Z A;  3IX4 A;  2X02 A;  3EWK A;  4P6Z M;  3CJM A;  1XFN A;  3HUO A;  3PXP A;  1ZG6 A;  4MBK A;  1L0E A;  4NKP A;  2PAV P;  5FAT A;  1V9Y A;  1YMX A;  4L9F A;  4KQD A;  4BL3 A;  3SH7 A;  1ZG4 A;  4ESP A;  3UPO A;  2ZOH A;  2VK3 A;  2JKF A;  3VOY A;  1SCW A;  4JGP A;  1K6S A;  3QP5 A;  2QHK A;  4WL9 A;  2ZMF A;  1GA9 A;  3PHY A;  4BMW A;  1LT0 A;  4BBT A;  3PBQ A;  2BLS A;  1DY6 A;  3MR0 A;  2JKR M;  3NDG A;  5G4Y A;  2JHE A;  4U3T A;  3FC7 A;  3H82 B;  4S2I A;  2OV5 A;  4EU0 A;  3KSI A;  3A3E A;  1XP4 A;  4AFI A;  4MBH A;  2PHY A;  3KSH A;  4U0X A;  5FDS A;  2W3G A;  5CHJ A;  3SH8 A;  1FIL A;  3SS3 A;  3IXG A;  1IEM A;  3Q81 A;  1D1J A;  2PRF A;  4LLO B;  4JKT A;  4S2P A;  3VFH A;  3QHY A;  1Q2P A;  1F9I A;  4PM8 A;  1DP9 A;  2GZA A;  3A0V A;  2HDQ A;  5KZH A;  2K7S A;  5CXW A;  3Q7Z A;  4HP4 A;  3G35 A;  3IX3 A;  4R23 A;  4EET B;  3P01 A;  2W1T B;  4QWO A;  2WGV A;  4P6B A;  2Q0O A;  5AVE A;  1NYY A;  1KE0 A;  1SKF A;  2DNS A;  3D72 A;  3VMA A;  1AXB A;  5FDH A;  2QZ6 A;  2JKT I;  1YQS A;  4WF0 A;  3CIT A;  1FCM A;  2WAD A;  1OTD A;  5D3O A;  2B18 A;  5HX9 A;  3LIA A;  1CF0 A;  3ZG8 B;  1EI5 A;  4IJG A;  4D60 A;  4XUZ A;  3T12 B;  3MFD A;  4OQG A;  3M2K A;  3T1Q B;  1H8Y A;  3BFE A;  1ERQ A;  1DJB A;  5DKL A;  1TF1 A;  3MXQ A;  1MKI A;  1BUE A;  5E2E A;  2HJ9 C;  3F1P B;  3SS4 A;  3R4K A;  2A2L A;  3B42 A;  4S2O A;  4EEU A;  1DJA A;  1LI0 A;  4QY5 A;  1OJG A;  2V1B A;  1HD8 A;  1DP8 A;  1GHP A;  2Q9N A;  3EGD C;  5LBR A;  3IF6 A;  3HJI A;  3BFC A;  3WS1 A;  2L4R A;  3EEA A;  2O99 A;  3BYD A;  1N9O A;  4DE3 A;  3FPW A;  4MMN A;  4EBL A;  1VET B;  2LB5 A;  3RJU A;  2I72 A;  3WS4 A;  3H82 A;  3FZC A;  1XGI A;  2PU2 A;  1GSW A;  4WBG A;  5DF9 A;  3UB7 A;  1ES3 A;  1MC0 A;  4FSF A;  1H8M A;  3S22 A;  4GCZ A;  2WAE A;  4HI4 A;  4LRZ E;  2GX5 A;  1MKM A;  2X01 A;  3M6H A;  4FH4 A;  4K0W A;  4DJ2 A;  4UHU A;  2K2N A;  2WGW B;  3A0S A;  2AVX A;  3C2W A;  3T1X A;  1MBL A;  1NRF A;  1A0K A;  4GD8 A;  1GA0 A;  4JGO A;  3S7P A;  3OPH A;  2XSS A;  4EES A;  1OJ5 A;  3VV4 A;  3CWF A;  4OON A;  4JGR A;  3CUE C;  2IWC A;  5EOO A;  2ZD8 A;  5FAP A;  4MCW A;  2HJE A;  5HWT A;  1VM1 A;  1XA7 A;  1FSY A;  3ZGA B;  1BZA A;  4OQH A;  1S1Z A;  1K55 C;  2B5R A;  4ZDX A;  4ID4 A;  4JBF A;  3MMH A;  3O87 A;  1ESU A;  4EQ1 A;  4FD8 A;  2Y2N A;  3ZG0 A;  4B4Z A;  1FQG A;  5DFX A;  4G3K A;  4E3K A;  2W1R A;  4FTX A;  4R3J A;  4KEN B;  3BFD A;  4EBP A;  1TD5 A;  3U2A A;  3BW6 A;  5K5B A;  3IWQ A;  5U47 A;  2V1A A;  4EUZ A;  4CLC E;  2OSU A;  3F1P A;  4Y2F A;  2I9V A;  4M4X A;  2IWD A;  3WWX A;  4L9G A;  4M3K A;  4GB7 A;  3E4Q A;  3KYQ A;  4ZJ1 A;  3ZVT A;  1PWC A;  2J9P A;  1XJ4 A;  5CEC A;  5HAR A;  5F69 A;  4FOF A;  2EFX A;  4JPM A;  1M6K A;  3E4P A;  1KGE A;  1VET A;  4DKI A;  3TJZ C;  2Y2I A;  3SH9 A;  1PZP A;  3JVV A;  4KZ3 A;  2WKI A;  2WKE A;  1ACF A;  3IWI A;  1V9Z A;  1WYC A;  3IS2 A;  1BYW A;  1LSW A;  5HDS A;  3G30 A;  1XGJ A;  3S7Q A;  2A49 A;  4JXW A;  1FSW A;  4BL2 A;  4E3J A;  3FV7 A;  2ZBB A;  1VHM A;  4Y7P A;  1T19 A;  1E3U A;  1TS8 A;  2JKG A;  4KZ5 A;  4DXB A;  3KSF A;  3R7W A;  1XJ2 A;  4WMC D;  3AGD A;  1K54 C;  4E6X A;  3UB8 A;  3CUE A;  4B88 A;  3OCN A;  4X1L A;  2VA0 A;  2R78 A;  1LHY A;  1PRQ A;  1YKD A;  1W8Q A;  5E2H A;  4MEZ A;  5DVA A;  4C3Q A;  1W63 M;  1MY8 A;  2W3F A;  3KYE A;  5L2F A;  4OPQ A;  1K55 A;  4Y0U A;  5I94 A;  2P04 A;  5HWV A;  2ZC4 B;  4OPY A;  5GLB A;  2Y2L A;  1P97 A;  4O8G A;  1PWD A;  4GS9 B;  3O88 A;  5J3W A;  3VP3 A;  4OOY A;  4IVI A;  4OKP A;  2JKT M;  1ONH A;  3GMW A;  1TEM A;  5FEG A;  1TDG A;  4FCF A;  1W63 Q;  2B02 A;  3GR2 A;  2O9C A;  5AQ7 A;  3WRZ A;  1PW8 A;  3TW8 A;  1ESI A;  2VV6 A;  4KQR A;  4JF4 A;  2C5W B;  1Y4O A;  1WYB A;  4Z9Q A;  2Y79 A;  4CJN A;  5CEB A;  5GHX A;  3EOI A;  5CED A;  4HOI A;  1CK3 A;  2J3W A;  5EUA A;  2Q9M A;  4EBN A;  3IBJ A;  3MKF A;  4HQA A;  4X53 A;  3QNC A;  1G6O A;  1Y28 A;  2Z6C A; 
#chains in the Genus database with same CATH homology
 3HL9 A;  2XLN A;  3VOZ A;  1SCW A;  1W8Y A;  1FCN A;  3FWL A;  1K6S A;  4GN2 A;  4IVK A;  3GVB A;  1NYM A;  4B4X A;  2JBF A;  4KQO A;  3VSL A;  4WEK A;  4N92 A;  1FCO A;  2VGJ A;  2EFU A;  2WUQ A;  1KDS A;  1GA9 A;  2H0Y A;  3UDX A;  1XX2 A;  3A3I A;  3P09 A;  2ZC5 B;  3VFF A;  4WEJ A;  4IED A;  3TSG A;  3DWZ A;  3PBQ A;  2BLS A;  5FAQ A;  4DE2 A;  1YMS A;  1DY6 A;  3VP2 A;  3MXR A;  1KE4 A;  1RCJ A;  3N8S A;  3NDG A;  1TDL A;  1Z6F A;  1XA1 A;  5DF7 A;  2ZC6 B;  2HDU A;  1E3U D;  1FR1 A;  3IH9 A;  2DRW A;  4OLG A;  4PMA A;  4U3T A;  3IHB A;  4ZJ3 A;  2EX2 A;  4S2I A;  2OV5 A;  3VP0 A;  1ERO A;  2WGW A;  3A3E A;  3WRT A;  1YT4 A;  2Y55 A;  4QD4 A;  3UDF A;  1XP4 A;  4QHC A;  1N4O A;  4MBH A;  4DE0 A;  4LV0 A;  1MWS A;  4RVA A;  4F94 A;  4U0X A;  4LV3 A;  2Y2H A;  4ZBE A;  5BOH A;  5IHV A;  5CHJ A;  3UPN A;  3SH8 A;  5DTT A;  2WZZ A;  3SS3 A;  3IXG A;  1FR6 A;  1YM1 A;  1IEM A;  2Z2M B;  3Q81 A;  3Q1F A;  3ZFZ A;  2BG1 A;  3A3F A;  2Y2K A;  1ES2 A;  5DF8 A;  4OQI A;  4JKT A;  4S2P A;  3VFH A;  3QHY A;  4S2J A;  1Q2P A;  2XFS A;  3Q7V A;  3G4P A;  1IYS A;  2DCF A;  2Y2O A;  4PM8 A;  2ZJ9 A;  3MXS A;  3AGF A;  2QPN A;  2EX6 A;  1MWU A;  2J7V A;  5FQI A;  4WM9 A;  2HDQ A;  5KZH A;  3UE1 A;  2J9O A;  5CXW A;  5JYO A;  3ZHH A;  5HAI A;  2ZQ7 A;  3Q7Z A;  2ZC3 B;  3C7U A;  3G35 A;  3UO9 A;  4R23 A;  3ZCZ A;  2OLV A;  2PU4 A;  2VGK A;  3HLW A;  4HES A;  5F83 A;  2XK1 A;  2WGV A;  3UDI A;  2ZQD A;  4P6B A;  2WGI A;  1ONG A;  1PW1 A;  1NYY A;  1KE0 A;  3UN7 A;  1SKF A;  3M6B A;  4Y0O A;  5FQM A;  3FKV A;  2DNS A;  2H10 A;  3VMA A;  1AXB A;  3D4F A;  4NET A;  1JWP A;  1ZKJ A;  4O7D A;  5FDH A;  3BEB A;  2QZ6 A;  1L0G A;  2X71 A;  1BT5 A;  4DF6 A;  1YQS A;  1M40 A;  1IKG A;  1RP5 A;  4N1H A;  1FCM A;  5KSC A;  3PTE A;  1G6A A;  2WAD A;  5E2G A;  4S2N C;  5EVI B;  1KVM A;  3VSK A;  5D3O A;  3UNW A;  2EXB A;  5EPH A;  2Y91 A;  5HX9 A;  3ZG8 B;  1EI5 A;  4WZ4 A;  1BLS A;  4S2L A;  3IH8 A;  1YLT A;  3A3J A;  4XUZ A;  1NZO A;  5EVI C;  1C3B A;  3CG5 A;  3MFD A;  5FI6 A;  5FAO A;  3HLG A;  4X68 A;  3V3R A;  3CZD A;  3GRJ A;  4OQG A;  3M2K A;  4CPK A;  1H8Y A;  3BFE A;  5EE8 A;  3S4X A;  1XKZ A;  1ERQ A;  1DJB A;  4GDB A;  4L0L A;  3UE3 A;  2P9V B;  3BEC A;  3GQZ A;  4BJP A;  5GLA A;  4RX3 A;  1N9B A;  3HRE A;  3PBS A;  2H0T A;  3V5M A;  3IXB A;  4KZB A;  1MKI A;  1BUE A;  3OCL A;  3NCK A;  1J9M A;  2ZC7 A;  3C4O A;  1L2S A;  2EX9 A;  2V20 A;  5CGS A;  5E2E A;  5AQA A;  5GLC A;  3SS4 A;  4S2O A;  4YIN A;  3W8K A;  4LV2 A;  1YLW A;  2V2F F;  3RXX A;  1ES5 A;  1DJA A;  1LI0 A;  4QY5 A;  3ZNT A;  1HD8 A;  4GNU A;  4KG5 A;  3HLF A;  5KMW A;  4HEF A;  1GHP A;  3HLD A;  1U60 A;  2Q9N A;  4U0T A;  4X55 A;  4KZ7 A;  1K38 A;  3IF6 A;  1PYY A;  4RX2 A;  5FSR A;  5CGX A;  4FH2 A;  5A92 A;  3HVF A;  5GLD A;  2XR0 A;  2GDN A;  3BFC A;  3WS1 A;  4BD0 A;  3BYD A;  1EWZ A;  1PZO A;  4ZAM A;  2ZQC A;  1W5D A;  4PM7 A;  5CHU A;  4A5R A;  5FQJ A;  4BD1 A;  5EEC A;  1KGF A;  4OPR A;  1H5X A;  4QU3 A;  5A90 A;  3BFG A;  4DE3 A;  5JYP A;  3C5A A;  4JXV A;  1I2S A;  4EQI A;  4EBL A;  1ZC2 A;  1H8Z A;  3RJU A;  3DWK A;  2I72 A;  3N6I A;  4DRT A;  3WS4 A;  3Q82 A;  3N4I A;  2A3U A;  3FZC A;  5CHM A;  1XGI A;  3MZF A;  2PU2 A;  2XF3 A;  4WBG A;  1LL5 A;  4N9L A;  5DF9 A;  5A91 A;  1ES3 A;  2H5S A;  3ZG7 B;  4C75 A;  3OPL A;  2XGN A;  2EX8 A;  2XQZ A;  3JYI A;  3NIA A;  4FSF A;  3EQU A;  3E2L A;  3S22 A;  4QY6 A;  1K54 A;  2WAE A;  4LCL A;  1RGZ A;  2HDR A;  3MZE A;  2Y2M A;  2X01 A;  3M6H A;  1PWG A;  3MZD A;  4FH4 A;  4K0W A;  3ISG A;  5E43 A;  1QME A;  3ZDJ A;  1WE4 A;  1JVJ A;  1E4D A;  1K56 D;  4UHU A;  1IYO A;  4MNR A;  2WGW B;  1XPB A;  2ZM2 A;  2WZX A;  4WYY A;  4GZB A;  2R9W A;  1L0D A;  3V39 A;  5FQQ A;  1VQQ A;  2WKH A;  1JTG A;  1NZU A;  5HAP A;  4C6Y A;  1DJC A;  1IYQ A;  1KE3 A;  1MBL A;  1XXM A;  1CEG A;  1HZO A;  4JXS A;  4DDY A;  1K56 A;  3WS2 A;  3E2K A;  2HP6 A;  1NRF A;  3BFF A;  1K57 C;  5GHY A;  1JTD A;  2HP5 A;  5DTK A;  4RA7 A;  3BLS A;  4JLF A;  3IHA A;  4H8R A;  4WZ5 A;  3UY6 A;  4GD8 A;  2EXA A;  3G32 A;  4OH0 A;  1GA0 A;  4X69 A;  3MBZ A;  3OPH A;  4GDN A;  1K6R A;  3CMZ A;  4OON A;  5HL1 A;  2G2W A;  3NDE A;  3DTM A;  1CI8 A;  3Q07 A;  2Y2J A;  5EVI D;  2IWC A;  4HBT A;  5EOO A;  4R4S A;  3VP4 A;  4S2N A;  2ZD8 A;  3O86 A;  3HLC A;  3IXH A;  5FAP A;  1MXO A;  3LEZ A;  2XFT A;  1PI5 A;  5FI2 A;  1VM1 A;  2Y2Q A;  1JWZ A;  5EOE A;  1XA7 A;  1FSY A;  4R0Q A;  3ZGA B;  1BZA A;  3W4O A;  3OZH A;  4S2K A;  4OQH A;  1L0F A;  4P87 A;  1MWT A;  5EVI A;  3A3D A;  3IT9 A;  2XEP A;  4XXR A;  1KDW A;  1K55 C;  2B5R A;  3V50 A;  4ZDX A;  4ID4 A;  4JBF A;  1GHM A;  1YLZ A;  4S2M A;  5TGF A;  2XH9 A;  3O87 A;  1ESU A;  1BLH A;  4JF6 A;  3V3S A;  4N1X A;  4OQ0 A;  5E2F A;  5FQK A;  4FD8 A;  4OP8 A;  1S0W A;  1BLP A;  3WS5 A;  1O07 A;  1S6R A;  2Y2N A;  4ZTK A;  3ZG0 A;  3OPP A;  3IF5 A;  4B4Z A;  1NY0 A;  1FQG A;  2G2U A;  1LI9 A;  2XDM A;  3I7J A;  4GKU A;  4E3K A;  5HFO A;  1Y54 A;  2P9V A;  3HUM A;  3IWO A;  2RCX A;  4R3J A;  4KEN B;  3BFD A;  1SHV A;  4BQM A;  4EBP A;  3GV9 A;  5KSH A;  1MPL A;  3ITA A;  3RXW A;  4UA7 A;  4KZ4 A;  2IWB A;  2WYX A;  3IWQ A;  4OOL A;  5U47 A;  2R9X A;  1ALQ A;  4KG2 A;  1HTZ A;  2CC1 A;  4EUZ A;  1GHI A;  2Y2P A;  5GHZ A;  5AQB A;  2OSU A;  1I5Q A;  2JCH A;  1YLP A;  1MWR A;  4WEL A;  4E6W A;  4HBU A;  2IWD A;  2J8Y A;  3WWX A;  1YLY A;  4ZJ2 A;  3NC8 A;  3DW0 A;  2HDS A;  3OC2 A;  3PAG A;  4M3K A;  4GB7 A;  3TG9 A;  3WS0 A;  5FA7 A;  4X6T A;  4KQQ A;  1HVB A;  4OP5 A;  5CRF A;  1K25 A;  4ZJ1 A;  3ZVT A;  2WK0 A;  5F1F A;  4LEN A;  1E25 A;  3HBR A;  1BSG A;  1NJ4 A;  1PWC A;  5HW3 A;  1W7F A;  4P0M A;  4E3L A;  1IYP A;  1ES4 A;  2J9P A;  4UA6 A;  4PM5 A;  5CEC A;  1G68 A;  4Y0T A;  1SDN A;  3HUN A;  2ZQ9 A;  2WAF A;  1K4E A;  5HAR A;  4JPM A;  2EFX A;  4PPR A;  1Q2Q A;  1M6K A;  4LCM A;  4OLD A;  3O3V A;  5CTN A;  1NXY A;  1KGE A;  4JF5 A;  3IF6 B;  3LO7 A;  3P98 A;  2PBY A;  2UWX A;  3NI9 A;  5F82 A;  4DKI A;  1LLB A;  2Y2I A;  3G34 A;  4MLL A;  3SH9 A;  4BLM A;  3SS5 A;  1PZP A;  4PM9 A;  4E3M A;  4KZA A;  4KZ3 A;  3BLM A;  2WKI A;  2WKE A;  3N8R A;  5HAQ A;  5M19 A;  3IF6 C;  3LCE A;  3IWI A;  1WYC A;  3SOI A;  4DXC A;  4NK3 A;  5FI7 A;  3ZVW A;  3M2J A;  3G30 A;  1XGJ A;  3C4P A;  5CER A;  4UA9 A;  3C7V A;  2A49 A;  5GL9 A;  4JXW A;  4BEN A;  5J8X A;  1K57 A;  5TFQ A;  1FSW A;  4BL2 A;  4YFM A;  4E3J A;  2ZM8 A;  3PAE A;  4QJG A;  3FV7 A;  2P74 A;  3PBR A;  1IKI A;  3PBT A;  4Y7P A;  1E3U A;  2ZQ8 A;  3ITB A;  3QNB A;  4XUX A;  3TOI A;  4E3N A;  4KZ5 A;  1W79 A;  4PM6 A;  4DXB A;  1GCE A;  3G2Z A;  4WMC D;  3AGD A;  4R4R A;  3Q7V B;  5AQ9 A;  4IBX A;  3W4P A;  1K54 C;  4E6X A;  3LY4 A;  3LY3 A;  5FAS A;  4B88 A;  3G2Y A;  3OCN A;  3AGE A;  2Y2G A;  4KG6 A;  1KGG A;  2FFY A;  4P85 A;  5A93 A;  1LHY A;  3N7W A;  4KZ8 A;  1W8Q A;  5E2H A;  2HPB A;  4EV4 A;  1PIO A;  3HLE A;  1PI4 A;  2RL3 A;  4R1G A;  4WMC A;  4IBR A;  4UAA A;  3UE0 A;  5DTS A;  1IEL A;  2C6W B;  4GD6 A;  4MEZ A;  5DVA A;  2Y59 A;  3MKE A;  2JE5 A;  1ERM A;  4K0X A;  4C3Q A;  1MY8 A;  4Q8I A;  5L2F A;  4OPQ A;  1K55 A;  2OLU A;  4OPZ A;  3B3X A;  4LV1 A;  1TVF A;  1KVL A;  4Y0U A;  5I94 A;  5M18 A;  3ZG9 B;  3ZG5 A;  3GSG A;  1OME A;  2ZC4 B;  4OPY A;  3PBN A;  2FFF B;  2Y2L A;  5G18 A;  4WZ5 C;  1LL9 A;  3PBO A;  3NY4 A;  5GLB A;  3FYZ A;  1PWD A;  4OOM A;  3BRM A;  1BTL A;  3HLB A;  1I2W A;  4QB8 A;  5TR7 A;  4X56 A;  1JWV A;  2ZM0 A;  4OVD A;  3FKW A;  1FOF A;  3S1Y A;  3O88 A;  2Z2L B;  4DE1 A;  3VP3 A;  2E8I A;  4OOY A;  4E3I A;  4IVI A;  4OKP A;  1ONH A;  5CGW A;  3GMW A;  1TEM A;  4JXG A;  3BM6 A;  4MBF A;  5CTM A;  3N8L A;  4KZ9 A;  3IXD A;  1TDG A;  4FCF A;  4RYE A;  3W4Q A;  3GR2 A;  5AQ7 A;  4GOG A;  1PW8 A;  5F1G A;  3WRZ A;  2ZQA A;  1SDE A;  1ESI A;  3EQV A;  1CI9 A;  3NBL A;  3OPR A;  3ZNY A;  4D2O A;  4K91 A;  2ZLY A;  2XD5 A;  4KQR A;  5M1A A;  1O7E A;  4JF4 A;  1K4F A;  1RGY A;  2C5W B;  1BUL A;  4DDS A;  1CEF A;  1WYB A;  2ZMA A;  4R3B A;  3GTC A;  3VP1 A;  2Y4A A;  4Z9Q A;  2V1Z A;  2XD1 A;  4N9K A;  3UPP A;  4CJN A;  5CEB A;  2X02 A;  5GHX A;  5CED A;  5FQ9 A;  2QMI A;  3CJM A;  3HUO A;  1CK3 A;  1ZG6 A;  4E3O A;  1BLC A;  4MBK A;  5EVL A;  1L0E A;  5FAT A;  1YMX A;  5EUA A;  2Q9M A;  4EBN A;  4BL3 A;  3MKF A;  4X53 A;  3SH7 A;  1ZG4 A;  1YLJ A;  1QMF A;  3QNC A;  2HP9 A;  3IQA A;  4EWF A;  3UPO A;  4KZ6 A;  2JC7 A;  3G31 A;  3VOY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...