3FV7A

Oxa-24 beta-lactamase complex with sa4-44 inhibitor
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
244
structure length
243
Chain Sequence
HISSQQHEKAIKSYFDEAQTQGVIIIKEGKNLSTYGNALARANKEYVPASTFMLNALIGLENHKATTNEIFKWDGKKRTYPMWEKDMTLGEAMALSAVPVYQELARRTGLELMQKEVKRVNFGNTNIGTQVDNFWLVGPLKITPVQEVNFADDLAHNRLPFKLETQEEVKKMLLIKEVNGSKIYAKSGWGMGVTPQVGWLTGWVEQANGKKIPFSLNLEMKEGMSGSIRNEITYKSLENLGII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase OXA-24
publication title Design, synthesis, and crystal structures of 6-alkylidene-2'-substituted penicillanic acid sulfones as potent inhibitors of Acinetobacter baumannii OXA-24 carbapenemase.
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Hydrolase
total genus 78
structure length 243
sequence length 244
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2009-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3fv7A00
4E3LA 1YMXA 3V3RA 1HVBA 4FCFA 3FKWA 1L0EA 3VFFA 3IF6C 1K56A 4DRTA 2OLUA 3WS2A 3M2KA 4BD1A 5GLCA 4R3JA 2RCXA 5HAIA 3G2YA 3MFDA 3ZNTA 1S6RA 4NK3A 4K91A 3UO9A 3ZG9B 4S2IA 1HTZA 5GLAA 2V20A 5E2FA 1XA1A 4RVAA 5AQ7A 4LENA 2EFUA 5A93A 4QB8A 4S2NA 2Y2OA 3QHYA 5DF9A 4QHCA 4R3BA 1FCMA 1MKIA 3IWOA 2HP6A 3ITAA 3NCKA 1MY8A 5CHUA 1LL9A 4GN2A 3UE0A 1GHMA 4Y7PA 4LCLA 5CEDA 4BD0A 2ZC3B 1YM1A 4ZJ3A 3UNWA 4D2OA 1CEFA 4X56A 1ONGA 4KG2A 4GD8A 4WZ5A 5CERA 3WS5A 4MNRA 1VM1A 4F94A 1KE3A 3NIAA 4N92A 3ZCZA 5FAPA 3IHBA 3NI9A 3OPHA 3UN7A 2ZQAA 3PAGA 3IH9A 3UDIA 5FAOA 1CI9A 4LV3A 3CZDA 2J9OA 3ZDJA 4QU3A 2WUQA 4XXRA 1FSWA 4EBLA 3E2KA 3OPRA 1ES5A 1MWTA 4DE0A 3BEBA 1O7EA 4N1XA 1H8YA 2Y2MA 1ESUA 5DTKA 4PM5A 3BFEA 5FASA 4XUXA 1KVLA 2DCFA 3G34A 3SS5A 4DDYA 5I94A 4MLLA 1M6KA 1NJ4A 3Q7VA 5IHVA 2DNSA 3IXGA 1E3UA 5DTTA 3ZGAB 3MXRA 1PYYA 2WKHA 1ESIA 4GNUA 3VP3A 3HUMA 1MXOA 4N9KA 3UDXA 4Q8IA 4DDSA 4H8RA 1Y54A 3S22A 5JYPA 1K54A 1BSGA 1PZOA 3MKFA 3GQZA 4GDNA 5E2GA 2G2WA 4KZ5A 1BLHA 4RA7A 3MKEA 1XX2A 3GR2A 3UPOA 1RGYA 4QY5A 4GOGA 1TDLA 4JF4A 3VP2A 4UA7A 3UPPA 1JTGA 4JKTA 5A90A 1J9MA 3V50A 5FQIA 3SH8A 1SKFA 5EOEA 4JLFA 2JE5A 1KVMA 2ZC5B 3LO7A 3Q1FA 3V5MA 1NXYA 1NY0A 2ZM8A 1KE4A 3S1YA 1TVFA 2DRWA 2ZLYA 1DY6A 4OQ0A 3V39A 3VP4A 5EVIA 5J8XA 5D3OA 1PWGA 1C3BA 4MBFA 4R0QA 1BT5A 4S2MA 1TEMA 5E2EA 1YT4A 2J7VA 5CGWA 2WGIA 2Y2QA 1JWZA 3G32A 4KG5A 2WGWA 4OOMA 3GV9A 4BJPA 4K0XA 1N4OA 3PBNA 1K55C 1Q2QA 2Q9NA 3N4IA 2JC7A 1E3UD 3SH7A 3HUNA 3HLDA 2XEPA 4P0MA 2Y2HA 1BLPA 4ZJ1A 2ZQ8A 3MZEA 4WZ4A 3A3DA 2EX6A 3W4QA 2FFYA 2H10A 3FKVA 3S4XA 4N9LA 5M19A 4OVDA 4OQIA 1ES3A 2E8IA 2PBYA 3FYZA 4P87A 1ZG6A 1XPBA 4KZ6A 3UE3A 3W4PA 5E43A 4E3NA 4OPZA 4OQGA 2XQZA 3QNBA 4R4RA 2XGNA 3FV7A 1MBLA 4JXSA 3ZG0A 3BRMA 5TFQA 1N9BA 5EECA 5KSHA 1K4FA 1PWDA 1K6RA 2PU2A 3AGEA 1ERQA 1JTDA 1W8QA 3N8SA 1PW8A 2A49A 3DWZA 3NC8A 1BTLA 3PTEA 4KENB 4PM7A 4RX3A 5GHZA 2B5RA 1JVJA 1SCWA 1E25A 1MWSA 4OOYA 4U0XA 3VOZA 4OQHA 5EVID 3LY3A 2H0YA 4Y0OA 2ZMAA 2IWDA 1XXMA 3HUOA 1OMEA 2QMIA 3C4PA 3WWXA 5HFOA 1LLBA 1FSYA 1YLPA 3GRJA 4R1GA 3A3FA 2WADA 3C4OA 4C3QA 5EVIB 1XKZA 3ITBA 3O86A 1WYBA 3CG5A 3HL9A 3MXSA 5F83A 3M6HA 1IEMA 2XFSA 3OPLA 5DF7A 5FQKA 4JBFA 3VFHA 3VP1A 1E4DA 1K57A 2WGWB 4R4SA 4X6TA 1FR6A 4OH0A 1JWPA 3TSGA 3BFCA 2ZM0A 1TDGA 4E3KA 2QPNA 2EX8A 2C6WB 3EQUA 4S2NC 4WYYA 3WS0A 5KMWA 3CMZA 2Y2JA 1LL5A 4HEFA 3IXBA 4HESA 5GHYA 2P74A 5EE8A 3Q82A 2A3UA 2XH9A 1GHIA 2EXBA 3C5AA 3VSLA 2CC1A 4JXVA 2EFXA 2UWXA 5CRFA 2X02A 2X71A 4ZTKA 4ID4A 2J8YA 4WZ5C 3FZCA 4X55A 3PBQA 2Y2IA 1W8YA 4JF6A 2XR0A 1YLTA 5HARA 2XD1A 4GDBA 1PI4A 4WBGA 1KGGA 4U3TA 4OKPA 3LY4A 4LV1A 3PAEA 4WMCA 5HX9A 4JPMA 4BL3A 2J9PA 1PI5A 1K4EA 3Q7ZA 3ZHHA 5FA7A 3WS4A 1H8ZA 3DW0A 2IWCA 1Z6FA 2VGJA 4UA9A 5DVAA 2Y2KA 3JYIA 3UE1A 1NYYA 2ZQ7A 1I2SA 3E2LA 2WYXA 5CTNA 1IYOA 5GHXA 3Q81A 2Z2LB 1PZPA 4FSFA 1CI8A 4L0LA 4S2KA 5CXWA 2IWBA 3W4OA 1XA7A 1YMSA 5FDHA 3P98A 1FR1A 4P85A 1W5DA 4UHUA 1ZC2A 3C7UA 4DF6A 1K54C 1VQQA 3V3SA 2EXAA 1MWUA 5TGFA 3CJMA 4E3OA 3QNCA 2ZQ9A 3IF5A 4EV4A 2JCHA 1W7FA 1YLZA 1QMEA 5TR7A 5DF8A 1K6SA 4JXWA 2PU4A 3DWKA 3BFFA 2HDSA 3BFGA 1GHPA 2WZZA 3HLCA 3IQAA 4X68A 2OV5A 5A92A 2ZJ9A 1I5QA 3A3EA 2P9VB 4PM9A 5CHJA 4EBPA 5KSCA 2XK1A 1ZG4A 4GB7A 5CEBA 1DJBA 1IYPA 5EVLA 3HLFA 5U47A 3ZVTA 3PBTA 5FQ9A 5F82A 3G4PA 3ZG8B 3BFDA 2R9WA 5EVIC 4WM9A 4KQQA 1ES2A 2XF3A 4ZJ2A 4BENA 3B3XA 1BLSA 4WMCD 3TOIA 2EX2A 4KZ9A 1LI9A 1W79A 3N8LA 1L0FA 1K25A 3ISGA 4KZ4A 1LHYA 3N7WA 1L0GA 2ZC7A 2ZQCA 4O7DA 3A3IA 4Z9QA 3WRTA 4UAAA 5CGSA 4A5RA 4MBHA 4DXBA 2H0TA 3O3VA 1S0WA 1MPLA 3AGDA 1FQGA 5CECA 1GCEA 3GSGA 3BLMA 4E6WA 5HL1A 2Y2NA 2OSUA 1XGIA 1JWVA 2VGKA 5JYOA 1G68A 4PMAA 4LCMA 3IF6A 4R23A 3VSKA 2X01A 2WGVA 5EOOA 3NDEA 2V1ZA 1KGEA 4FH2A 4LV2A 3LEZA 4WEKA 3RXXA 1WE4A 1PW1A 2JBFA 4QJGA 4PM8A 3UY6A 4P6BA 3OCNA 2OLVA 1YLWA 2HDUA 4HBUA 3BM6A 3O88A 4OP8A 3VOYA 1NRFA 3PBSA 2WAEA 4E3MA 4ZAMA 3RXWA 4IBXA 1WYCA 3HLBA 2C5WB 2GDNA 4NETA 1NZUA 3TG9A 3VMAA 5KZHA 3BECA 3WS1A 1HZOA 3IXDA 4GD6A 5CHMA 5HAQA 3HLGA 1KDWA 3GTCA 2EX9A 2XDMA 4KG6A 1CK3A 4QY6A 1FOFA 1DJCA 4E6XA 5FSRA 2XD5A 3P09A 1L0DA 5F1GA 1QMFA 2P9VA 1GA9A 3M2JA 4WEJA 2WKIA 4YINA 4OP5A 1YLYA 5AQBA 3ZG7B 2Y2PA 3BLSA 3PBOA 5GLDA 4OPRA 1K57C 3ZVWA 3DTMA 3OPPA 4DE1A 1IYQA 2ZD8A 3ZNYA 2Y55A 3UPNA 4QD4A 3SS4A 5CTMA 4E3IA 1H5XA 3SH9A 1ONHA 2G2UA 3NDGA 4Y0UA 3SS3A 1IELA 5HAPA 3IWIA 2H5SA 5FI6A 2Y2LA 4KQOA 3UDFA 3N8RA 3MZDA 2WK0A 5FQMA 2XFTA 1BLCA 1L2SA 5FQJA 5GL9A 2HPBA 4S2LA 1NZOA 4KZ8A 3ZG5A 3AGFA 1ES4A 3IT9A 2Y4AA 3M6BA 3IF6B 3MBZA 4OPYA 5AQ9A 5EPHA 1NYMA 4DE3A 4XUZA 4DE2A 4E3JA 3G2ZA 4ZDXA 1AXBA 4OLDA 4EWFA 3LCEA 2WAFA 1PWCA 4N1HA 4X53A 4OONA 1K56D 5M1AA 3HBRA 3OZHA 2HP5A 3G31A 3G35A 4CPKA 4DKIA 2BG1A 1IYSA 3OCLA 4MEZA 3Q07A 1CEGA 1ERMA 4KZBA 4MBKA 4S2OA 5BOHA 1EWZA 4JXGA 5EUAA 5FAQA 4OLGA 4LV0A 4KQRA 2Q9MA 5A91A 2BLSA 4B88A 2HDQA 1KGFA 2QZ6A 1G6AA 2WZXA 1FCOA 5DTSA 5GLBA 1ZKJA 4KZ7A 5FATA 3BYDA 1KDSA 1SHVA 2ZC4B 4B4ZA 4BLMA 2ZQDA 3FWLA 1K38A 1LI0A 1RP5A 4S2JA 1EROA 3G30A 4RYEA 3HREA 1HD8A 3PBRA 4B4XA 4IVIA 3IHAA 1I2WA 3RJUA 2V2FF 4BL2A 3NBLA 3O87A 5HW3A 4GKUA 1XGJA 1M40A 4GZBA 5CGXA 3C7VA 5E2HA 1BUEA 1BULA 3D4FA 1YQSA 3GMWA 2Z2MB 2Y59A 1K55A 5M18A 4BQMA 4OPQA 2R9XA 5AQAA 2Y2GA 3HLEA 3IH8A 4U0TA 4YFMA 4DXCA 3MZFA 4IEDA 3GVBA 4M3KA 2FFFB 4OOLA 1EI5A 5G18A 3SOIA 4RX2A 2Y91A 5FI7A 1RCJA 2HDRA 1O07A 4ZBEA 4PPRA 4IBRA 4WELA 4C75A 1Q2PA 1YLJA 3N6IA 4EBNA 3IWQA 1KE0A 3EQVA 3VP0A 4Y0TA 1IKGA 4EQIA 5L2FA 4JF5A 4K0WA 3ZFZA 3HVFA 1PIOA 4UA6A 4KZAA 1ALQA 3A3JA 2XLNA 2I72A 4FD8A 3Q7VB 5F1FA 2RL3A 3IXHA 1DJAA 3NY4A 1IKIA 2HP9A 2WKEA 2ZM2A 3OC2A 1FCNA 2ZC6B 3HLWA 4HBTA 4KZ3A 1BZAA 1SDEA 4EUZA 4S2PA 1GA0A 4PM6A 1SDNA 3WRZA 4X69A 1U60A 3I7JA 4CJNA 1XP4A 4C6YA 3W8KA 4FH4A 5FQQA 5FI2A 1MWRA 1RGZA 4IVKA
chains in the Genus database with same CATH superfamily
2V9AA 3MJQA 1L0EA 3VFFA 4DRTA 4UEYA 4CLCC 5GLCA 5HAIA 4NK3A 5L10A 3FPWA 5IS1A 4HJ4A 2Q0OA 4QHCA 4IUHA 4R3BA 1FCMA 2HP6A 5CHUA 5HWWA 1XJ3A 3NOTC 4ZJ3A 3KSIA 1CEFA 3U2AA 5FDSA 5CERA 3T4OA 4IHQA 2D02A 1LT0A 3NIAA 2PRFA 1CI9A 4LV3A 2DMWA 4QU3A 2WUQA 3OPRA 1G6OA 1MWTA 3A0VA 2O0YA 4HH3A 1H8YA 2Y2MA 4XUXA 2DCFA 1BYWA 3LUQA 1E3UA 3H9WA 1PYYA 2VA0A 3UDXA 3TJZC 4Q8IA 1BSGA 2G2WA 4KZ5A 4RA7A 3GR2A 3F1OB 4GOGA 1TDLA 2VV8A 3UPPA 3T1XA 3SH8A 2JE5A 3R7WB 1NXYA 5L09A 2DRWA 2HZ5A 3UE6A 3VP4A 3V39A 4KUOA 4BMWA 3C2WA 4G3KA 4S2MA 2HF6A 3PXPA 1N4OA 2VV6A 2OAQ1 3QP5A 2NUTC 3HUNA 4WLAA 2XEPA 3PYPA 4WZ4A 2EX6A 3T4JA 2FFYA 3FKVA 5DFYA 4OQIA 3KYZA 4E3NA 3E4OA 5HDDA 2XQZA 2XGNA 3FV7A 4JXSA 5FL3A 4ETZA 1N9BA 5G4YA 2OOLA 1K4FA 4QY5A 1W8QA 3PTEA 1BTLA 3D72A 1JVJA 3VOZA 1Y28A 3B33A 2QMIA 1LLBA 3RH8B 1FSYA 3F1OA 2WADA 3C4OA 1OPXA 1WYBA 1IEMA 5FQKA 3MQ0A 4X6TA 2EX8A 3WS0A 2PAVP 1LL5A 2V8FA 2JKGA 3NECA 5EE8A 2YKHA 4L9FA 2CC1A 4JXVA 3CWFA 2J3TD 5CRFA 2X02A 4WZ5C 2J8YA 4X55A 5C5KA 3H82B 4HNBA 4EEPA 3IS2A 1PI4A 4WBGA 4G3WA 5HX9A 4JPMA 4BL3A 1MC0A 4EU0A 5FA7A 3DW0A 2L0WA 1P9RA 3ICYA 1Z6FA 3L7HA 4UA9A 2Y2KA 1I2SA 5DJTA 1IYOA 3Q81A 4FSFA 1PZPA 1XA7A 1YMSA 1FR1A 4P85A 4UHUA 1ZC2A 2OAP1 3CJMA 4E3OA 4JGOA 2ZQ9A 2JCHA 1QMEA 5TR7A 3HLCA 3DWKA 2HDSA 3BFGA 4GCZA 3NOPC 1I5QA 5CHJA 4PM9A 5KSCA 1S1ZA 2MJ6A 5EVLA 5U47A 5FQ9A 5F82A 1ES2A 2XF3A 3B3XA 3NOUC 4WMCD 3U4LP 4X25A 4DMZA 3BY9A 3KSFA 1P97A 5HSQA 3KX0X 2ZQCA 1L0GA 3WRTA 4DXBA 1S0WA 3MS6A 5DJUA 3IBRA 5CECA 3GSGA 2OSUA 1JWVA 2L4RA 5JYOA 4PKYA 3H7WA 1MZUA 2ZL1B 2X01A 3LGOA 2V1ZA 1PW1A 2JBFA 4PM8A 4P6BA 3OCNA 1YLWA 3BY8A 1NRFA 3UB8A 4E3MA 3SZTA 1DRMA 3LI9A 3CHWP 3F1NB 4ME4A 4GD6A 2EX9A 4EXOA 5FSRA 3B42A 3P09A 3A0RA 3JVUA 4OP5A 3ZG7B 3PR6A 4DE1A 3QP2A 3ZNYA 3UPNA 4DN0A 4Y0UA 3SS3A 3D3OA 5FI6A 3N8RA 2M7VA 2WK0A 3JVVA 4KZ8A 3ZG5A 3LFVA 3MQQA 2Y4AA 3MBZA 2PYPA 3GDIA 4DE2A 3G2ZA 4OLDA 3EEHA 2V0UA 2VKSA 3C30A 3OZHA 5DKKA 3G35A 4LGWA 2BG1A 4MEZA 3Q07A 1CEGA 1ERMA 1EWZA 4EERA 4KQRA 5A91A 1XJ6A 1KGFA 2QZ6A 1G6AA 2WZXA 1D06A 1KDSA 2ZC4B 4BLMA 2ZQDA 1RP5A 2KOIA 3LR4A 4B4XA 4IVIA 3IHAA 4BL2A 3K3CA 3CPTA 4GKUA 4I38A 1NLYA 5AJGA 3UMEA 4H6JA 2Y59A 3K3DA 5M18A 2R9XA 5HD5A 2QWSA 3HLEA 4YFMA 4DXCA 2FFFB 3E0YA 3SOIA 2QJ5A 2Y91A 4ZBEA 4K08A 4EQ1A 4EBNA 2ACGA 3FC7A 5F5YA 1T1AA 1OJ5A 4UA6A 1F9IA 5HWVA 2VV7A 3NY4A 2HP9A 1FCNA 2ZC6B 3TRCA 4EUZA 1GA0A 4PM6A 1U60A 5FI2A 2O9CA 4IVKA 1YMXA 4Q0JA 3V67A 2P7JA 1GSXA 1K56A 3QP1A 1L3LA 2OLUA 4BD1A 3M2KA 4R3JA 3MFDA 3ZNTA 1S6RA 4K91A 1V9ZA 3CLOA 2W1TA 2V20A 5E2FA 1H0MA 1SZVA 5AQ7A 4LENA 3MXQA 4S2NA 4Q0HA 1MKIA 3ITAA 3NCKA 1LL9A 4BD0A 4D2OA 2EWWA 1CJFA 4D60A 4GD8A 1VM1A 4F94A 4N92A 1VEUB 1VETB 3PAGA 3UDIA 2JKRI 5L8MA 1TS8A 4LFUA 2PR5A 4XXRA 2ZMVA 4EBLA 3LIAA 3BEBA 4N1XA 5DTKA 3DTIA 3BFEA 1KVLA 4MLLA 1NJ4A 2WKHA 4FTXA 3VE4A 3HUMA 3LR5A 4BWIA 5JYPA 3S22A 3UMDA 3GQZA 1BLHA 1S1YA 4JF4A 3MQOA 2JHEA 1J9MA 1XJ4A 4IJGA 1YKDA 1KVMA 2JKRM 3LO7A 4HP4A 3V5MA 1NY0A 1TVFA 2ZLYA 1DY6A 3FG8A 2VGLS 1TS7A 1PWGA 4R0QA 5E2EA 1YT4A 2WGIA 2VX8A 2WGWA 4OOMA 3TE8A 2WKPA 4B93A 1K55C 3N4IA 3HLDA 4P0MA 1BLPA 4HHDA 5DKLA 3S4XA 2E8IA 3FYZA 2HV1A 4KZ6A 5DFXA 4OPZA 1XFQA 2W3DA 4MCWA 2ZMFA 3T4QA 3BRMA 4NEED 3OLOA 5EECA 3AGEA 2A49A 5GHZA 4RX3A 2B5RA 1SCWA 4AFIA 5EVID 4Y0OA 3HUOA 3C4PA 3WWXA 2GJ3A 2WKRA 3ITBA 3T4SA 4X1MA 3OPLA 5DF7A 3P7NA 3VP1A 1E4DA 1K57A 3TSGA 3LEQA 1TDGA 4DJ3A 3EQUA 5KMWA 3CMZA 4HESA 4WUJA 3Q82A 1GHIA 2EXBA 3VSLA 2EFXA 2I9VA 2X71A 1MKMA 3EGXC 2P04A 2W1RA 1W8YA 5J3WA 5HARA 2XD1A 3F1PA 4LV1A 4WMCA 3UB9A 1PI5A 1KOUA 2PDRA 3T4KA 1YSQA 1LL8A 5GHXA 4S2KA 4I3AA 3W4OA 1H8MA 3T12B 3IF5A 1YLZA 4WN5A 1K6SA 4JXWA 2OV5A 5F69A 1OTBA 4HP9A 2P9VB 4DJ2A 5J7EA 2XK1A 3DTKA 4GB7A 5CEBA 4O01A 3BFDA 2O9AA 2R9WA 1FIKA 3G6OA 4P6ZM 4BENA 3DAVA 1Y4OA 3HCYA 2EX2A 3IS2B 5AVEA 3LIEA 1IOUA 1LHYA 5HW3A 3E4QA 3A3IA 4A5RA 5CGSA 4Y15A 4MBHA 2H0TA 2V0WA 5IU1A 1MPLA 3AGDA 2XA7S 1GCEA 2GZAA 2VGKA 1G68A 4PMAA 3JPUA 4LCMA 3IF6A 4M4XA 5EOOA 1KGEA 2KX6A 2R78A 2OLVA 2HDUA 4HBUA 3BM6A 3O88A 3EEAA 3PBSA 4HY8A 2GDNA 1TS6A 2A24A 1NZUA 1T19A 3TG9A 5FEGA 3B47A 3QP4A 1A0KA 3WS1A 1KDWA 3GTCA 1CK3A 2VZWA 2J3WA 2V8CA 3EWKA 5F1GA 1QMFA 2P9VA 1GA9A 2WKIA 4YINA 4OPRA 3OPPA 1P9WA 2Y55A 4ZRRA 3SS4A 2GX5A 3S7OA 3NDGA 1G5UA 1IELA 4EETB 3IWIA 1JNUA 2H5SA 2JKTI 2W0NA 2Y2LA 4KQOA 3UDFA 5FQMA 2XRNA 4UQIM 4CLCD 1TD5A 2XROA 1NZOA 4ARZA 2PT7A 1ES4A 3H7WB 3MR0A 1NYMA 4E3JA 4ZDXA 4EWFA 3C38A 1PWCA 4X53A 4DKIA 1G28A 1IYSA 4R6LA 4S2OA 5EUAA 5HD3A 3S7NA 1HLUP 2Q9MA 2BLSA 4B88A 2PD8A 3CAXA 3LIFA 3RFBA 4HOIA 1FCOA 5MC7A 1SHVA 1LI0A 5CX7A 4S2JA 1EROA 2Y79A 4RYEA 1HD8A 4LPZA 4Z1WA 2JKTM 2INWA 2V2FF 1XGJA 1M40A 5E2HA 1YQSA 3P01A 2YKFA 2OWJA 2V1AA 2Y2GA 4U0TA 5G18A 4XT2A 1RCJA 4PPRA 3IX8A 3CUEA 4GS9A 1Q2PA 1YLJA 3N6IA 4JGQA 1GSWA 1UGUA 4EQIA 1PIOA 1ALQA 3A3JA 2I72A 3Q7VB 5F1FA 5EFWA 1IKIA 2ZM2A 3OC2A 4EW7A 4HBTA 3HLWA 1BZAA 1SDEA 3L9KA 1SDNA 3WRZA 1XP4A 5J4EA 1RGZA 4E3LA 3FPVA 4KUKA 4HJ3A 3WS2A 1TF1A 3CPTB 3LR0A 5HL6A 3UO9A 3ZG9B 2JKFA 5GLAA 3KYQA 1XA1A 4H6JB 3BQAA 3LYXA 2EFUA 5A93A 4QB8A 4NXBA 3W2ZA 4GN2A 5CEDA 4Y7PA 1Z09A 2Y8HA 5KIZA 3UNWA 4X56A 4KG2A 4MNRA 3ZQ5A 1KE3A 2BASA 4L9EA 3NI9A 2KLIA 3OPHA 2ZQAA 3VOLA 3CZDA 1XJ2A 4Y13A 3LR3A 4F3LA 2LB5A 4UQIS 1ES5A 3LICA 2W3FA 1O7EA 5G4ZA 1ESUA 4PM5A 3Q7VA 1VB6A 1V9YA 3ZGAB 3MXRA 2M7UA 3NULA 4GNUA 2BTFP 1MXOA 2EA9A 4N9KA 3VV4A 4H8RA 1Y54A 1K54A 1PZOA 3NJAA 3MKFA 4GDNA 5E2GA 4NG2A 3MKEA 2W1TB 3UPOA 4MN7A 3VP2A 4UA7A 1JTGA 5A90A 3UB6A 1SKFA 2ZC5B 4YWZA 4OQ0A 5EVIA 5D3OA 1C3BA 4MBFA 1BT5A 2O99A 1F5MA 2Y2QA 1JWZA 3G32A 4KG5A 3GV9A 5F6AA 1OJGA 4HIAA 2M1CA 2Z6CA 3T1QB 3PBNA 2JC7A 1SKOA 4ZJ1A 2ZQ8A 3MZEA 3A3DA 3W4QA 4N9LA 4FOFA 3TW8A 1ZG6A 1DP9A 3BW6A 3UE3A 4OQGA 4YOFA 4R4RA 3MMHA 2PBDP 5KSHA 1ERQA 1PW8A 3DWZA 4PM7A 4L9GA 1MWSA 4OOYA 1YSPA 4U0XA 4OQHA 4NXEA 3LY3A 2H0YA 1YAXA 1XXMA 1J3WA 1OMEA 5HFOA 1YLPA 4R1GA 4C3QA 2VK3A 1DP8A 4LRYC 5F83A 3LIDA 4HH2A 3VFHA 2WGWB 1DP6A 1FR6A 4OH0A 2ZM0A 3SW1A 2QPNA 2C6WB 4S2NC 3DTEA 3UB7A 4HEFA 2XH9A 4Y3IA 3C5AA 2UWXA 2ZBBA 4ZTKA 4ID4A 3PBQA 2Y2IA 4JF6A 3BQ8A 2XR0A 4GHIA 4GDBA 1KGGA 1T1BA 4OKPA 3LY4A 4U3TA 4EUVA 1T1CA 2J9PA 3Q7ZA 3ZHHA 3WS4A 1H8ZA 3ZYTA 1F98A 2IWCA 3JYIA 3UE1A 1NYYA 2H28A 2ZQ7A 3E2LA 3T4TA 5J8XA 1CI8A 5CXWA 2IWBA 3P98A 1W5DA 4ETXA 2PD7A 4DF6A 1OT9A 1VQQA 2EXAA 1MWUA 4Y5FA 3QNCA 4QWOA 5DF8A 2PU4A 5M19A 4X68A 1GHPA 2WZZA 1EW0A 3A3EA 4EBPA 3NHQA 4R38A 1H3QA 3KO6A 2Z6DA 1DJBA 1IYPA 5TBMA 3ZG8B 3G4PA 3QP6A 4KQQA 4ZJ2A 1N9OA 1BLSA 4KZ9A 5IT5A 1CF0A 1W79A 2P08A 3BJNA 3F1PB 4KZ4A 5F68A 2ZC7A 4O7DA 4UAAA 2HGVA 3O3VA 3IX4A 1FQGA 2LB9A 1OTEA 1W63M 4R23A 1PRQA 2WGVA 1CQAA 1P0ZA 2A2LA 3NDEA 4BBVA 2K31A 4CLCA 4LV2A 4CQHA 1XFNA 2FH5A 4QJGA 3OBFA 3KYEA 3VOYA 2WAEA 4ZAMA 4B9OA 4IBXA 3HLBA 4NETA 2C5WB 1S4RA 3VMAA 5KZHA 3BECA 3IXDA 5HAQA 2XDMA 3PHYA 4QY6A 1FOFA 1DJCA 4E6XA 1L0DA 3M2JA 4WEJA 3MSHA 5AVFA 3BLSA 5GLDA 1K57C 3ZVWA 3O5YA 2G2UA 2XFTA 1BLCA 1L2SA 5GL9A 2HPBA 4S2LA 3S7PA 3IT9A 3IF6B 4OPYA 5AQ9A 3UB5P 4JGRA 4XUZA 1VHMA 1AXBA 1TS0A 2WAFA 1K56D 5M1AA 4G3VA 4CPKA 4KZBA 2W3GA 4MBKA 5BOHA 5FAQA 2HDQA 2A24B 4JGPA 5GLBA 4KZ7A 1ZTUA 4B4ZA 4PAUA 3G30A 3HREA 1I2WA 3RJUA 3GECA 3O87A 4GZBA 3C7VA 1BULA 3D4FA 3GMWA 2Z2MB 4BQMA 1D1JA 5A8BA 5AQAA 4OOLA 4EEUA 4M3KA 1EI5A 3CITA 4RX2A 5FI7A 4ARZB 1O07A 1OTAA 3IX3A 3BWLA 4IBRA 1YPRA 4C75A 1N9NA 3IWQA 1KE0A 1PNEA 4HQAA 4Y0TA 1IKGA 3ZFZA 3HVFA 1NLZA 4EESA 4KZAA 1OT6A 2RL3A 3IXHA 1DJAA 2WKEA 4KZ3A 1ZHHB 1NRJA 2OWHA 4X69A 4Q0IA 4C6YA 4FH4A 5K5BA 2QKPA 4NKPA 1MWRA 1K6RA 3V3RA 1HVBA 4FCFA 3MF0A 3FKWA 3E4PA 3IF6C 4MN6A 2HJEA 3LIBA 2RCXA 3G2YA 5TJJA 4S2IA 5HPFA 1HTZA 4RVAA 1UWNX 4KQDA 2Y2OA 3QHYA 4Y2FA 5DF9A 3IWOA 1MY8A 4XT2B 3UE0A 1GHMA 3R7WA 4LCLA 1ACFA 2ZC3B 3EGDC 1YM1A 4GS9B 1ONGA 2JN7A 4MDZA 4WZ5A 3WS5A 3ZCZA 5FAPA 3IHBA 1F2KA 3UN7A 3IH9A 4MMNA 1OTIA 5FAOA 2J9OA 3ZDJA 5HWTA 1FSWA 3E2KA 3D9YA 4DE0A 3KSGA 2KDKA 5FASA 5I94A 2V1BA 3G34A 3SS5A 4DDYA 3CI6A 1M6KA 5IHVA 2DNSA 3IXGA 5DTTA 1WA9A 4R70A 1ESIA 3VP3A 4DDSA 3A0SA 1XX2A 4I3JA 3HJIA 1RGYA 4JKTA 4NXGA 4I5SA 3ULFA 3V50A 5FQIA 5EOEA 4JLFA 3Q1FA 2ZM8A 1KE4A 3S1YA 2QHKA 4P6ZS 1TEMA 1D7EA 2ZOHA 2J7VA 5CGWA 3T4LA 4BJPA 4F3LB 4K0XA 4I39A 1Q2QA 2Q9NA 3SH7A 1E3UD 4BBTA 2Y2HA 2VEAA 4R3AA 2H10A 4OVDA 1ES3A 3CUEC 4FUWA 5FEFA 2PBYA 4P87A 2UV0E 1XPBA 3W4PA 5E43A 4WF0A 3H82A 3QNBA 1MBLA 3ZG0A 5TFQA 5LBRA 2QYBA 2ZOIA 1PWDA 3HJKA 2PU2A 3N8SA 3NC8A 1JTDA 4KENB 1IFQA 1GSVA 4LRZE 1E25A 4QPRA 2ZMAA 2IWDA 2W27A 4ESPA 3GRJA 5I5LA 3A3FA 2VJWA 5EVIB 1XKZA 2J80A 3O86A 3CG5A 2AVXA 3HL9A 3MXSA 5L07A 5EV0A 1FILA 2G7UA 4MN5A 3M6HA 2XFSA 4JBFA 1LSXA 4R4SA 1JWPA 4YNRA 3BFCA 3DBAA 4E3KA 2O9BA 1X0OA 4WYYA 2B95A 2Y2JA 1SKOB 3IXBA 5GHYA 2P74A 4LLOB 2L1MA 2A3UA 4WL9A 4O8GA 2W3HA 2QJ7A 4RQ9A 3FZCA 1OTDA 2D01A 1YLTA 4BBUA 3PAEA 1S67L 1K4EA 2FZ0A 3VE3A 4GLQA 4X1LA 2VGJA 5DVAA 5HPIA 2CMNA 3RTYA 2WYXA 4NXFA 5CTNA 2Z2LB 4L0LA 2ZL1A 5FDHA 4E04A 3T1SA 1LSVA 4IUKA 3C7UA 2B18A 1K54C 4II7A 3V3SA 5TGFA 5HZHA 4EV4A 4O0PA 1W7FA 2PR6A 3BFFA 5A92A 3IQAA 2ZJ9A 4PKYG 2PHYA 1ZG4A 3F1NA 3IBJA 3E98A 3QP8A 3HLFA 3ZVTA 3PBTA 3MFXA 2VGLM 5EM1A 5EVIC 4WM9A 1NWZA 2NUPC 3TOIA 3C8CA 1LI9A 3N8LA 4GHIB 1L0FA 1K25A 3ISGA 3OOVA 3N7WA 4Z9QA 4CLCE 3BLMA 4E6WA 5HL1A 2Y2NA 2GNXA 1XGIA 3VSKA 1ODVA 1K0KA 4FH2A 3EOIA 3LEZA 4WEKA 3RXXA 3T50A 1WE4A 4PHTA 3UY6A 4OP8A 3RXWA 1WYCA 3KSHA 1HZOA 5CHMA 5TBMB 1AWIA 3HLGA 4KG6A 2W3EA 2XD5A 1S66L 2XSSA 2VLGA 1YLYA 5AQBA 2Y2PA 3PBOA 3DTMA 1IYQA 2E8JA 2ZD8A 4QD4A 5CTMA 4E3IA 1H5XA 1T18A 3SH9A 1ONHA 2PYRA 5HAPA 3MZDA 5FQJA 3AGFA 3M6BA 5EPHA 4CLCB 4DE3A 2HJ9C 2EWVA 3LCEA 1N9LA 4N1HA 4OONA 2IA2A 3HBRA 2HP5A 3G31A 3LI8A 3OCLA 3K2NA 1LSWA 4JXGA 4OLGA 4Y17A 4LV0A 2K7SA 5DTSA 2B02A 1ZKJA 5HDSA 5FATA 3BYDA 3FWLA 1K38A 5EVEA 4HI4A 3PBRA 2WKQA 3NBLA 4GW9A 5CGXA 1BUEA 5EM0A 1K55A 1STZA 4OPQA 3IH8A 1PFLA 3MZFA 3GVBA 4IEDA 4LRXC 2HDRA 4I3IA 4HJ6A 4WELA 1W63Q 1S4SA 3R4KA 3T1RA 1VEUA 3EQVA 3VP0A 5L2FA 2K2NA 4JF5A 1VETA 4K0WA 2XLNA 4FD8A 1UWPX 4S2PA 2J3TC 2XA7M 3I7JA 4CJNA 3S7QA 5HDCA 3W8KA 5FQQA 4GJ4A
chains in the Genus database with same CATH topology
4E3LA 1YMXA 3V3RA 1HVBA 4FCFA 3FKWA 1L0EA 3VFFA 3IF6C 1K56A 4DRTA 2OLUA 3WS2A 3M2KA 4BD1A 5GLCA 4R3JA 2RCXA 5HAIA 3G2YA 3MFDA 3ZNTA 1S6RA 4NK3A 4K91A 3UO9A 3ZG9B 4S2IA 1HTZA 5GLAA 2V20A 5E2FA 1XA1A 4RVAA 5AQ7A 4LENA 2EFUA 5A93A 4QB8A 4S2NA 2Y2OA 3QHYA 5DF9A 4QHCA 4R3BA 1FCMA 1MKIA 3IWOA 2HP6A 3ITAA 3NCKA 1MY8A 5CHUA 1LL9A 4GN2A 3UE0A 1GHMA 4Y7PA 4LCLA 5CEDA 4BD0A 2ZC3B 1YM1A 4ZJ3A 3UNWA 4D2OA 1CEFA 4X56A 1ONGA 4KG2A 4GD8A 4WZ5A 5CERA 3WS5A 4MNRA 1VM1A 4F94A 1KE3A 3NIAA 4N92A 3ZCZA 5FAPA 3IHBA 3NI9A 3OPHA 3UN7A 2ZQAA 3PAGA 3IH9A 3UDIA 5FAOA 1CI9A 4LV3A 3CZDA 2J9OA 3ZDJA 4QU3A 2WUQA 4XXRA 1FSWA 4EBLA 3E2KA 3OPRA 1ES5A 1MWTA 4DE0A 3BEBA 1O7EA 4N1XA 1H8YA 2Y2MA 1ESUA 5DTKA 4PM5A 3BFEA 5FASA 4XUXA 1KVLA 2DCFA 3G34A 3SS5A 4DDYA 5I94A 4MLLA 1M6KA 1NJ4A 3Q7VA 5IHVA 2DNSA 3IXGA 1E3UA 5DTTA 3ZGAB 3MXRA 1PYYA 2WKHA 1ESIA 4GNUA 3VP3A 3HUMA 1MXOA 4N9KA 3UDXA 4Q8IA 4DDSA 4H8RA 1Y54A 3S22A 5JYPA 1K54A 1BSGA 1PZOA 3MKFA 3GQZA 4GDNA 5E2GA 2G2WA 4KZ5A 1BLHA 4RA7A 3MKEA 1XX2A 3GR2A 3UPOA 1RGYA 4QY5A 4GOGA 1TDLA 4JF4A 3VP2A 4UA7A 3UPPA 1JTGA 4JKTA 5A90A 1J9MA 3V50A 5FQIA 3SH8A 1SKFA 5EOEA 4JLFA 2JE5A 1KVMA 2ZC5B 3LO7A 3Q1FA 3V5MA 1NXYA 1NY0A 2ZM8A 1KE4A 3S1YA 1TVFA 2DRWA 2ZLYA 1DY6A 4OQ0A 3V39A 3VP4A 5EVIA 5J8XA 5D3OA 1PWGA 1C3BA 4MBFA 4R0QA 1BT5A 4S2MA 1TEMA 5E2EA 1YT4A 2J7VA 5CGWA 2WGIA 2Y2QA 1JWZA 3G32A 4KG5A 2WGWA 4OOMA 3GV9A 4BJPA 4K0XA 1N4OA 3PBNA 1K55C 1Q2QA 2Q9NA 3N4IA 2JC7A 1E3UD 3SH7A 3HUNA 3HLDA 2XEPA 4P0MA 2Y2HA 1BLPA 4ZJ1A 2ZQ8A 3MZEA 4WZ4A 3A3DA 2EX6A 3W4QA 2FFYA 2H10A 3FKVA 3S4XA 4N9LA 5M19A 4OVDA 4OQIA 1ES3A 2E8IA 2PBYA 3FYZA 4P87A 1ZG6A 1XPBA 4KZ6A 3UE3A 3W4PA 5E43A 4E3NA 4OPZA 4OQGA 2XQZA 3QNBA 4R4RA 2XGNA 3FV7A 1MBLA 4JXSA 3ZG0A 3BRMA 5TFQA 1N9BA 5EECA 5KSHA 1K4FA 1PWDA 1K6RA 2PU2A 3AGEA 1ERQA 1JTDA 1W8QA 3N8SA 1PW8A 2A49A 3DWZA 3NC8A 1BTLA 3PTEA 4KENB 4PM7A 4RX3A 5GHZA 2B5RA 1JVJA 1SCWA 1E25A 1MWSA 4OOYA 4U0XA 3VOZA 4OQHA 5EVID 3LY3A 2H0YA 4Y0OA 2ZMAA 2IWDA 1XXMA 3HUOA 1OMEA 2QMIA 3C4PA 3WWXA 5HFOA 1LLBA 1FSYA 1YLPA 3GRJA 4R1GA 3A3FA 2WADA 3C4OA 4C3QA 5EVIB 1XKZA 3ITBA 3O86A 1WYBA 3CG5A 3HL9A 3MXSA 5F83A 3M6HA 1IEMA 2XFSA 3OPLA 5DF7A 5FQKA 4JBFA 3VFHA 3VP1A 1E4DA 1K57A 2WGWB 4R4SA 4X6TA 1FR6A 4OH0A 1JWPA 3TSGA 3BFCA 2ZM0A 1TDGA 4E3KA 2QPNA 2EX8A 2C6WB 3EQUA 4S2NC 4WYYA 3WS0A 5KMWA 3CMZA 2Y2JA 1LL5A 4HEFA 3IXBA 4HESA 5GHYA 2P74A 5EE8A 3Q82A 2A3UA 2XH9A 1GHIA 2EXBA 3C5AA 3VSLA 2CC1A 4JXVA 2EFXA 2UWXA 5CRFA 2X02A 2X71A 4ZTKA 4ID4A 2J8YA 4WZ5C 3FZCA 4X55A 3PBQA 2Y2IA 1W8YA 4JF6A 2XR0A 1YLTA 5HARA 2XD1A 4GDBA 1PI4A 4WBGA 1KGGA 4U3TA 4OKPA 3LY4A 4LV1A 3PAEA 4WMCA 5HX9A 4JPMA 4BL3A 2J9PA 1PI5A 1K4EA 3Q7ZA 3ZHHA 5FA7A 3WS4A 1H8ZA 3DW0A 2IWCA 1Z6FA 2VGJA 4UA9A 5DVAA 2Y2KA 3JYIA 3UE1A 1NYYA 2ZQ7A 1I2SA 3E2LA 2WYXA 5CTNA 1IYOA 5GHXA 3Q81A 2Z2LB 1PZPA 4FSFA 1CI8A 4L0LA 4S2KA 5CXWA 2IWBA 3W4OA 1XA7A 1YMSA 5FDHA 3P98A 1FR1A 4P85A 1W5DA 4UHUA 1ZC2A 3C7UA 4DF6A 1K54C 1VQQA 3V3SA 2EXAA 1MWUA 5TGFA 3CJMA 4E3OA 3QNCA 2ZQ9A 3IF5A 4EV4A 2JCHA 1W7FA 1YLZA 1QMEA 5TR7A 5DF8A 1K6SA 4JXWA 2PU4A 3DWKA 3BFFA 2HDSA 3BFGA 1GHPA 2WZZA 3HLCA 3IQAA 4X68A 2OV5A 5A92A 2ZJ9A 1I5QA 3A3EA 2P9VB 4PM9A 5CHJA 4EBPA 5KSCA 2XK1A 1ZG4A 4GB7A 5CEBA 1DJBA 1IYPA 5EVLA 3HLFA 5U47A 3ZVTA 3PBTA 5FQ9A 5F82A 3G4PA 3ZG8B 3BFDA 2R9WA 5EVIC 4WM9A 4KQQA 1ES2A 2XF3A 4ZJ2A 4BENA 3B3XA 1BLSA 4WMCD 3TOIA 2EX2A 4KZ9A 1LI9A 1W79A 3N8LA 1L0FA 1K25A 3ISGA 4KZ4A 1LHYA 3N7WA 1L0GA 2ZC7A 2ZQCA 4O7DA 3A3IA 4Z9QA 3WRTA 4UAAA 5CGSA 4A5RA 4MBHA 4DXBA 2H0TA 3O3VA 1S0WA 1MPLA 3AGDA 1FQGA 5CECA 1GCEA 3GSGA 3BLMA 4E6WA 5HL1A 2Y2NA 2OSUA 1XGIA 1JWVA 2VGKA 5JYOA 1G68A 4PMAA 4LCMA 3IF6A 4R23A 3VSKA 2X01A 2WGVA 5EOOA 3NDEA 2V1ZA 1KGEA 4FH2A 4LV2A 3LEZA 4WEKA 3RXXA 1WE4A 1PW1A 2JBFA 4QJGA 4PM8A 3UY6A 4P6BA 3OCNA 2OLVA 1YLWA 2HDUA 4HBUA 3BM6A 3O88A 4OP8A 3VOYA 1NRFA 3PBSA 2WAEA 4E3MA 4ZAMA 3RXWA 4IBXA 1WYCA 3HLBA 2C5WB 2GDNA 4NETA 1NZUA 3TG9A 3VMAA 5KZHA 3BECA 3WS1A 1HZOA 3IXDA 4GD6A 5CHMA 5HAQA 3HLGA 1KDWA 3GTCA 2EX9A 2XDMA 4KG6A 1CK3A 4QY6A 1FOFA 1DJCA 4E6XA 5FSRA 2XD5A 3P09A 1L0DA 5F1GA 1QMFA 2P9VA 1GA9A 3M2JA 4WEJA 2WKIA 4YINA 4OP5A 1YLYA 5AQBA 3ZG7B 2Y2PA 3BLSA 3PBOA 5GLDA 4OPRA 1K57C 3ZVWA 3DTMA 3OPPA 4DE1A 1IYQA 2ZD8A 3ZNYA 2Y55A 3UPNA 4QD4A 3SS4A 5CTMA 4E3IA 1H5XA 3SH9A 1ONHA 2G2UA 3NDGA 4Y0UA 3SS3A 1IELA 5HAPA 3IWIA 2H5SA 5FI6A 2Y2LA 4KQOA 3UDFA 3N8RA 3MZDA 2WK0A 5FQMA 2XFTA 1BLCA 1L2SA 5FQJA 5GL9A 2HPBA 4S2LA 1NZOA 4KZ8A 3ZG5A 3AGFA 1ES4A 3IT9A 2Y4AA 3M6BA 3IF6B 3MBZA 4OPYA 5AQ9A 5EPHA 1NYMA 4DE3A 4XUZA 4DE2A 4E3JA 3G2ZA 4ZDXA 1AXBA 4OLDA 4EWFA 3LCEA 2WAFA 1PWCA 4N1HA 4X53A 4OONA 1K56D 5M1AA 3HBRA 3OZHA 2HP5A 3G31A 3G35A 4CPKA 4DKIA 2BG1A 1IYSA 3OCLA 4MEZA 3Q07A 1CEGA 1ERMA 4KZBA 4MBKA 4S2OA 5BOHA 1EWZA 4JXGA 5EUAA 5FAQA 4OLGA 4LV0A 4KQRA 2Q9MA 5A91A 2BLSA 4B88A 2HDQA 1KGFA 2QZ6A 1G6AA 2WZXA 1FCOA 5DTSA 5GLBA 1ZKJA 4KZ7A 5FATA 3BYDA 1KDSA 1SHVA 2ZC4B 4B4ZA 4BLMA 2ZQDA 3FWLA 1K38A 1LI0A 1RP5A 4S2JA 1EROA 3G30A 4RYEA 3HREA 1HD8A 3PBRA 4B4XA 4IVIA 3IHAA 1I2WA 3RJUA 2V2FF 4BL2A 3NBLA 3O87A 5HW3A 4GKUA 1XGJA 1M40A 4GZBA 5CGXA 3C7VA 5E2HA 1BUEA 1BULA 3D4FA 1YQSA 3GMWA 2Z2MB 2Y59A 1K55A 5M18A 4BQMA 4OPQA 2R9XA 5AQAA 2Y2GA 3HLEA 3IH8A 4U0TA 4YFMA 4DXCA 3MZFA 4IEDA 3GVBA 4M3KA 2FFFB 4OOLA 1EI5A 5G18A 3SOIA 4RX2A 2Y91A 5FI7A 1RCJA 2HDRA 1O07A 4ZBEA 4PPRA 4IBRA 4WELA 4C75A 1Q2PA 1YLJA 3N6IA 4EBNA 3IWQA 1KE0A 3EQVA 3VP0A 4Y0TA 1IKGA 4EQIA 5L2FA 4JF5A 4K0WA 3ZFZA 3HVFA 1PIOA 4UA6A 4KZAA 1ALQA 3A3JA 2XLNA 2I72A 4FD8A 3Q7VB 5F1FA 2RL3A 3IXHA 1DJAA 3NY4A 1IKIA 2HP9A 2WKEA 2ZM2A 3OC2A 1FCNA 2ZC6B 3HLWA 4HBTA 4KZ3A 1BZAA 1SDEA 4EUZA 4S2PA 1GA0A 4PM6A 1SDNA 3WRZA 4X69A 1U60A 3I7JA 4CJNA 1XP4A 4C6YA 3W8KA 4FH4A 5FQQA 5FI2A 1MWRA 1RGZA 4IVKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E3L A;  1YMX A;  3V3R A;  1HVB A;  4FCF A;  3FKW A;  1L0E A;  3VFF A;  3IF6 C;  1K56 A;  4DRT A;  2OLU A;  3WS2 A;  3M2K A;  4BD1 A;  5GLC A;  4R3J A;  2RCX A;  5HAI A;  3G2Y A;  3MFD A;  3ZNT A;  1S6R A;  4NK3 A;  4K91 A;  3UO9 A;  3ZG9 B;  4S2I A;  1HTZ A;  5GLA A;  2V20 A;  5E2F A;  1XA1 A;  4RVA A;  5AQ7 A;  4LEN A;  2EFU A;  5A93 A;  4QB8 A;  4S2N A;  2Y2O A;  3QHY A;  5DF9 A;  4QHC A;  4R3B A;  1FCM A;  1MKI A;  3IWO A;  2HP6 A;  3ITA A;  3NCK A;  1MY8 A;  5CHU A;  1LL9 A;  4GN2 A;  3UE0 A;  1GHM A;  4Y7P A;  4LCL A;  5CED A;  4BD0 A;  2ZC3 B;  1YM1 A;  4ZJ3 A;  3UNW A;  4D2O A;  1CEF A;  4X56 A;  1ONG A;  4KG2 A;  4GD8 A;  4WZ5 A;  5CER A;  3WS5 A;  4MNR A;  1VM1 A;  4F94 A;  1KE3 A;  3NIA A;  4N92 A;  3ZCZ A;  5FAP A;  3IHB A;  3NI9 A;  3OPH A;  3UN7 A;  2ZQA A;  3PAG A;  3IH9 A;  3UDI A;  5FAO A;  1CI9 A;  4LV3 A;  3CZD A;  2J9O A;  3ZDJ A;  4QU3 A;  2WUQ A;  4XXR A;  1FSW A;  4EBL A;  3E2K A;  3OPR A;  1ES5 A;  1MWT A;  4DE0 A;  3BEB A;  1O7E A;  4N1X A;  1H8Y A;  2Y2M A;  1ESU A;  5DTK A;  4PM5 A;  3BFE A;  5FAS A;  4XUX A;  1KVL A;  2DCF A;  3G34 A;  3SS5 A;  4DDY A;  5I94 A;  4MLL A;  1M6K A;  1NJ4 A;  3Q7V A;  5IHV A;  2DNS A;  3IXG A;  1E3U A;  5DTT A;  3ZGA B;  3MXR A;  1PYY A;  2WKH A;  1ESI A;  4GNU A;  3VP3 A;  3HUM A;  1MXO A;  4N9K A;  3UDX A;  4Q8I A;  4DDS A;  4H8R A;  1Y54 A;  3S22 A;  5JYP A;  1K54 A;  1BSG A;  1PZO A;  3MKF A;  3GQZ A;  4GDN A;  5E2G A;  2G2W A;  4KZ5 A;  1BLH A;  4RA7 A;  3MKE A;  1XX2 A;  3GR2 A;  3UPO A;  1RGY A;  4QY5 A;  4GOG A;  1TDL A;  4JF4 A;  3VP2 A;  4UA7 A;  3UPP A;  1JTG A;  4JKT A;  5A90 A;  1J9M A;  3V50 A;  5FQI A;  3SH8 A;  1SKF A;  5EOE A;  4JLF A;  2JE5 A;  1KVM A;  2ZC5 B;  3LO7 A;  3Q1F A;  3V5M A;  1NXY A;  1NY0 A;  2ZM8 A;  1KE4 A;  3S1Y A;  1TVF A;  2DRW A;  2ZLY A;  1DY6 A;  4OQ0 A;  3V39 A;  3VP4 A;  5EVI A;  5J8X A;  5D3O A;  1PWG A;  1C3B A;  4MBF A;  4R0Q A;  1BT5 A;  4S2M A;  1TEM A;  5E2E A;  1YT4 A;  2J7V A;  5CGW A;  2WGI A;  2Y2Q A;  1JWZ A;  3G32 A;  4KG5 A;  2WGW A;  4OOM A;  3GV9 A;  4BJP A;  4K0X A;  1N4O A;  3PBN A;  1K55 C;  1Q2Q A;  2Q9N A;  3N4I A;  2JC7 A;  1E3U D;  3SH7 A;  3HUN A;  3HLD A;  2XEP A;  4P0M A;  2Y2H A;  1BLP A;  4ZJ1 A;  2ZQ8 A;  3MZE A;  4WZ4 A;  3A3D A;  2EX6 A;  3W4Q A;  2FFY A;  2H10 A;  3FKV A;  3S4X A;  4N9L A;  5M19 A;  4OVD A;  4OQI A;  1ES3 A;  2E8I A;  2PBY A;  3FYZ A;  4P87 A;  1ZG6 A;  1XPB A;  4KZ6 A;  3UE3 A;  3W4P A;  5E43 A;  4E3N A;  4OPZ A;  4OQG A;  2XQZ A;  3QNB A;  4R4R A;  2XGN A;  3FV7 A;  1MBL A;  4JXS A;  3ZG0 A;  3BRM A;  5TFQ A;  1N9B A;  5EEC A;  5KSH A;  1K4F A;  1PWD A;  1K6R A;  2PU2 A;  3AGE A;  1ERQ A;  1JTD A;  1W8Q A;  3N8S A;  1PW8 A;  2A49 A;  3DWZ A;  3NC8 A;  1BTL A;  3PTE A;  4KEN B;  4PM7 A;  4RX3 A;  5GHZ A;  2B5R A;  1JVJ A;  1SCW A;  1E25 A;  1MWS A;  4OOY A;  4U0X A;  3VOZ A;  4OQH A;  5EVI D;  3LY3 A;  2H0Y A;  4Y0O A;  2ZMA A;  2IWD A;  1XXM A;  3HUO A;  1OME A;  2QMI A;  3C4P A;  3WWX A;  5HFO A;  1LLB A;  1FSY A;  1YLP A;  3GRJ A;  4R1G A;  3A3F A;  2WAD A;  3C4O A;  4C3Q A;  5EVI B;  1XKZ A;  3ITB A;  3O86 A;  1WYB A;  3CG5 A;  3HL9 A;  3MXS A;  5F83 A;  3M6H A;  1IEM A;  2XFS A;  3OPL A;  5DF7 A;  5FQK A;  4JBF A;  3VFH A;  3VP1 A;  1E4D A;  1K57 A;  2WGW B;  4R4S A;  4X6T A;  1FR6 A;  4OH0 A;  1JWP A;  3TSG A;  3BFC A;  2ZM0 A;  1TDG A;  4E3K A;  2QPN A;  2EX8 A;  2C6W B;  3EQU A;  4S2N C;  4WYY A;  3WS0 A;  5KMW A;  3CMZ A;  2Y2J A;  1LL5 A;  4HEF A;  3IXB A;  4HES A;  5GHY A;  2P74 A;  5EE8 A;  3Q82 A;  2A3U A;  2XH9 A;  1GHI A;  2EXB A;  3C5A A;  3VSL A;  2CC1 A;  4JXV A;  2EFX A;  2UWX A;  5CRF A;  2X02 A;  2X71 A;  4ZTK A;  4ID4 A;  2J8Y A;  4WZ5 C;  3FZC A;  4X55 A;  3PBQ A;  2Y2I A;  1W8Y A;  4JF6 A;  2XR0 A;  1YLT A;  5HAR A;  2XD1 A;  4GDB A;  1PI4 A;  4WBG A;  1KGG A;  4U3T A;  4OKP A;  3LY4 A;  4LV1 A;  3PAE A;  4WMC A;  5HX9 A;  4JPM A;  4BL3 A;  2J9P A;  1PI5 A;  1K4E A;  3Q7Z A;  3ZHH A;  5FA7 A;  3WS4 A;  1H8Z A;  3DW0 A;  2IWC A;  1Z6F A;  2VGJ A;  4UA9 A;  5DVA A;  2Y2K A;  3JYI A;  3UE1 A;  1NYY A;  2ZQ7 A;  1I2S A;  3E2L A;  2WYX A;  5CTN A;  1IYO A;  5GHX A;  3Q81 A;  2Z2L B;  1PZP A;  4FSF A;  1CI8 A;  4L0L A;  4S2K A;  5CXW A;  2IWB A;  3W4O A;  1XA7 A;  1YMS A;  5FDH A;  3P98 A;  1FR1 A;  4P85 A;  1W5D A;  4UHU A;  1ZC2 A;  3C7U A;  4DF6 A;  1K54 C;  1VQQ A;  3V3S A;  2EXA A;  1MWU A;  5TGF A;  3CJM A;  4E3O A;  3QNC A;  2ZQ9 A;  3IF5 A;  4EV4 A;  2JCH A;  1W7F A;  1YLZ A;  1QME A;  5TR7 A;  5DF8 A;  1K6S A;  4JXW A;  2PU4 A;  3DWK A;  3BFF A;  2HDS A;  3BFG A;  1GHP A;  2WZZ A;  3HLC A;  3IQA A;  4X68 A;  2OV5 A;  5A92 A;  2ZJ9 A;  1I5Q A;  3A3E A;  2P9V B;  4PM9 A;  5CHJ A;  4EBP A;  5KSC A;  2XK1 A;  1ZG4 A;  4GB7 A;  5CEB A;  1DJB A;  1IYP A;  5EVL A;  3HLF A;  5U47 A;  3ZVT A;  3PBT A;  5FQ9 A;  5F82 A;  3G4P A;  3ZG8 B;  3BFD A;  2R9W A;  5EVI C;  4WM9 A;  4KQQ A;  1ES2 A;  2XF3 A;  4ZJ2 A;  4BEN A;  3B3X A;  1BLS A;  4WMC D;  3TOI A;  2EX2 A;  4KZ9 A;  1LI9 A;  1W79 A;  3N8L A;  1L0F A;  1K25 A;  3ISG A;  4KZ4 A;  1LHY A;  3N7W A;  1L0G A;  2ZC7 A;  2ZQC A;  4O7D A;  3A3I A;  4Z9Q A;  3WRT A;  4UAA A;  5CGS A;  4A5R A;  4MBH A;  4DXB A;  2H0T A;  3O3V A;  1S0W A;  1MPL A;  3AGD A;  1FQG A;  5CEC A;  1GCE A;  3GSG A;  3BLM A;  4E6W A;  5HL1 A;  2Y2N A;  2OSU A;  1XGI A;  1JWV A;  2VGK A;  5JYO A;  1G68 A;  4PMA A;  4LCM A;  3IF6 A;  4R23 A;  3VSK A;  2X01 A;  2WGV A;  5EOO A;  3NDE A;  2V1Z A;  1KGE A;  4FH2 A;  4LV2 A;  3LEZ A;  4WEK A;  3RXX A;  1WE4 A;  1PW1 A;  2JBF A;  4QJG A;  4PM8 A;  3UY6 A;  4P6B A;  3OCN A;  2OLV A;  1YLW A;  2HDU A;  4HBU A;  3BM6 A;  3O88 A;  4OP8 A;  3VOY A;  1NRF A;  3PBS A;  2WAE A;  4E3M A;  4ZAM A;  3RXW A;  4IBX A;  1WYC A;  3HLB A;  2C5W B;  2GDN A;  4NET A;  1NZU A;  3TG9 A;  3VMA A;  5KZH A;  3BEC A;  3WS1 A;  1HZO A;  3IXD A;  4GD6 A;  5CHM A;  5HAQ A;  3HLG A;  1KDW A;  3GTC A;  2EX9 A;  2XDM A;  4KG6 A;  1CK3 A;  4QY6 A;  1FOF A;  1DJC A;  4E6X A;  5FSR A;  2XD5 A;  3P09 A;  1L0D A;  5F1G A;  1QMF A;  2P9V A;  1GA9 A;  3M2J A;  4WEJ A;  2WKI A;  4YIN A;  4OP5 A;  1YLY A;  5AQB A;  3ZG7 B;  2Y2P A;  3BLS A;  3PBO A;  5GLD A;  4OPR A;  1K57 C;  3ZVW A;  3DTM A;  3OPP A;  4DE1 A;  1IYQ A;  2ZD8 A;  3ZNY A;  2Y55 A;  3UPN A;  4QD4 A;  3SS4 A;  5CTM A;  4E3I A;  1H5X A;  3SH9 A;  1ONH A;  2G2U A;  3NDG A;  4Y0U A;  3SS3 A;  1IEL A;  5HAP A;  3IWI A;  2H5S A;  5FI6 A;  2Y2L A;  4KQO A;  3UDF A;  3N8R A;  3MZD A;  2WK0 A;  5FQM A;  2XFT A;  1BLC A;  1L2S A;  5FQJ A;  5GL9 A;  2HPB A;  4S2L A;  1NZO A;  4KZ8 A;  3ZG5 A;  3AGF A;  1ES4 A;  3IT9 A;  2Y4A A;  3M6B A;  3IF6 B;  3MBZ A;  4OPY A;  5AQ9 A;  5EPH A;  1NYM A;  4DE3 A;  4XUZ A;  4DE2 A;  4E3J A;  3G2Z A;  4ZDX A;  1AXB A;  4OLD A;  4EWF A;  3LCE A;  2WAF A;  1PWC A;  4N1H A;  4X53 A;  4OON A;  1K56 D;  5M1A A;  3HBR A;  3OZH A;  2HP5 A;  3G31 A;  3G35 A;  4CPK A;  4DKI A;  2BG1 A;  1IYS A;  3OCL A;  4MEZ A;  3Q07 A;  1CEG A;  1ERM A;  4KZB A;  4MBK A;  4S2O A;  5BOH A;  1EWZ A;  4JXG A;  5EUA A;  5FAQ A;  4OLG A;  4LV0 A;  4KQR A;  2Q9M A;  5A91 A;  2BLS A;  4B88 A;  2HDQ A;  1KGF A;  2QZ6 A;  1G6A A;  2WZX A;  1FCO A;  5DTS A;  5GLB A;  1ZKJ A;  4KZ7 A;  5FAT A;  3BYD A;  1KDS A;  1SHV A;  2ZC4 B;  4B4Z A;  4BLM A;  2ZQD A;  3FWL A;  1K38 A;  1LI0 A;  1RP5 A;  4S2J A;  1ERO A;  3G30 A;  4RYE A;  3HRE A;  1HD8 A;  3PBR A;  4B4X A;  4IVI A;  3IHA A;  1I2W A;  3RJU A;  2V2F F;  4BL2 A;  3NBL A;  3O87 A;  5HW3 A;  4GKU A;  1XGJ A;  1M40 A;  4GZB A;  5CGX A;  3C7V A;  5E2H A;  1BUE A;  1BUL A;  3D4F A;  1YQS A;  3GMW A;  2Z2M B;  2Y59 A;  1K55 A;  5M18 A;  4BQM A;  4OPQ A;  2R9X A;  5AQA A;  2Y2G A;  3HLE A;  3IH8 A;  4U0T A;  4YFM A;  4DXC A;  3MZF A;  4IED A;  3GVB A;  4M3K A;  2FFF B;  4OOL A;  1EI5 A;  5G18 A;  3SOI A;  4RX2 A;  2Y91 A;  5FI7 A;  1RCJ A;  2HDR A;  1O07 A;  4ZBE A;  4PPR A;  4IBR A;  4WEL A;  4C75 A;  1Q2P A;  1YLJ A;  3N6I A;  4EBN A;  3IWQ A;  1KE0 A;  3EQV A;  3VP0 A;  4Y0T A;  1IKG A;  4EQI A;  5L2F A;  4JF5 A;  4K0W A;  3ZFZ A;  3HVF A;  1PIO A;  4UA6 A;  4KZA A;  1ALQ A;  3A3J A;  2XLN A;  2I72 A;  4FD8 A;  3Q7V B;  5F1F A;  2RL3 A;  3IXH A;  1DJA A;  3NY4 A;  1IKI A;  2HP9 A;  2WKE A;  2ZM2 A;  3OC2 A;  1FCN A;  2ZC6 B;  3HLW A;  4HBT A;  4KZ3 A;  1BZA A;  1SDE A;  4EUZ A;  4S2P A;  1GA0 A;  4PM6 A;  1SDN A;  3WRZ A;  4X69 A;  1U60 A;  3I7J A;  4CJN A;  1XP4 A;  4C6Y A;  3W8K A;  4FH4 A;  5FQQ A;  5FI2 A;  1MWR A;  1RGZ A;  4IVK A; 
#chains in the Genus database with same CATH topology
 2V9A A;  3MJQ A;  1L0E A;  3VFF A;  4DRT A;  4UEY A;  4CLC C;  5GLC A;  5HAI A;  4NK3 A;  5L10 A;  3FPW A;  5IS1 A;  4HJ4 A;  2Q0O A;  4QHC A;  4IUH A;  4R3B A;  1FCM A;  2HP6 A;  5CHU A;  5HWW A;  1XJ3 A;  3NOT C;  4ZJ3 A;  3KSI A;  1CEF A;  3U2A A;  5FDS A;  5CER A;  3T4O A;  4IHQ A;  2D02 A;  1LT0 A;  3NIA A;  2PRF A;  1CI9 A;  4LV3 A;  2DMW A;  4QU3 A;  2WUQ A;  3OPR A;  1G6O A;  1MWT A;  3A0V A;  2O0Y A;  4HH3 A;  1H8Y A;  2Y2M A;  4XUX A;  2DCF A;  1BYW A;  3LUQ A;  1E3U A;  3H9W A;  1PYY A;  2VA0 A;  3UDX A;  3TJZ C;  4Q8I A;  1BSG A;  2G2W A;  4KZ5 A;  4RA7 A;  3GR2 A;  3F1O B;  4GOG A;  1TDL A;  2VV8 A;  3UPP A;  3T1X A;  3SH8 A;  2JE5 A;  3R7W B;  1NXY A;  5L09 A;  2DRW A;  2HZ5 A;  3UE6 A;  3VP4 A;  3V39 A;  4KUO A;  4BMW A;  3C2W A;  4G3K A;  4S2M A;  2HF6 A;  3PXP A;  1N4O A;  2VV6 A;  2OAQ 1;  3QP5 A;  2NUT C;  3HUN A;  4WLA A;  2XEP A;  3PYP A;  4WZ4 A;  2EX6 A;  3T4J A;  2FFY A;  3FKV A;  5DFY A;  4OQI A;  3KYZ A;  4E3N A;  3E4O A;  5HDD A;  2XQZ A;  2XGN A;  3FV7 A;  4JXS A;  5FL3 A;  4ETZ A;  1N9B A;  5G4Y A;  2OOL A;  1K4F A;  4QY5 A;  1W8Q A;  3PTE A;  1BTL A;  3D72 A;  1JVJ A;  3VOZ A;  1Y28 A;  3B33 A;  2QMI A;  1LLB A;  3RH8 B;  1FSY A;  3F1O A;  2WAD A;  3C4O A;  1OPX A;  1WYB A;  1IEM A;  5FQK A;  3MQ0 A;  4X6T A;  2EX8 A;  3WS0 A;  2PAV P;  1LL5 A;  2V8F A;  2JKG A;  3NEC A;  5EE8 A;  2YKH A;  4L9F A;  2CC1 A;  4JXV A;  3CWF A;  2J3T D;  5CRF A;  2X02 A;  4WZ5 C;  2J8Y A;  4X55 A;  5C5K A;  3H82 B;  4HNB A;  4EEP A;  3IS2 A;  1PI4 A;  4WBG A;  4G3W A;  5HX9 A;  4JPM A;  4BL3 A;  1MC0 A;  4EU0 A;  5FA7 A;  3DW0 A;  2L0W A;  1P9R A;  3ICY A;  1Z6F A;  3L7H A;  4UA9 A;  2Y2K A;  1I2S A;  5DJT A;  1IYO A;  3Q81 A;  4FSF A;  1PZP A;  1XA7 A;  1YMS A;  1FR1 A;  4P85 A;  4UHU A;  1ZC2 A;  2OAP 1;  3CJM A;  4E3O A;  4JGO A;  2ZQ9 A;  2JCH A;  1QME A;  5TR7 A;  3HLC A;  3DWK A;  2HDS A;  3BFG A;  4GCZ A;  3NOP C;  1I5Q A;  5CHJ A;  4PM9 A;  5KSC A;  1S1Z A;  2MJ6 A;  5EVL A;  5U47 A;  5FQ9 A;  5F82 A;  1ES2 A;  2XF3 A;  3B3X A;  3NOU C;  4WMC D;  3U4L P;  4X25 A;  4DMZ A;  3BY9 A;  3KSF A;  1P97 A;  5HSQ A;  3KX0 X;  2ZQC A;  1L0G A;  3WRT A;  4DXB A;  1S0W A;  3MS6 A;  5DJU A;  3IBR A;  5CEC A;  3GSG A;  2OSU A;  1JWV A;  2L4R A;  5JYO A;  4PKY A;  3H7W A;  1MZU A;  2ZL1 B;  2X01 A;  3LGO A;  2V1Z A;  1PW1 A;  2JBF A;  4PM8 A;  4P6B A;  3OCN A;  1YLW A;  3BY8 A;  1NRF A;  3UB8 A;  4E3M A;  3SZT A;  1DRM A;  3LI9 A;  3CHW P;  3F1N B;  4ME4 A;  4GD6 A;  2EX9 A;  4EXO A;  5FSR A;  3B42 A;  3P09 A;  3A0R A;  3JVU A;  4OP5 A;  3ZG7 B;  3PR6 A;  4DE1 A;  3QP2 A;  3ZNY A;  3UPN A;  4DN0 A;  4Y0U A;  3SS3 A;  3D3O A;  5FI6 A;  3N8R A;  2M7V A;  2WK0 A;  3JVV A;  4KZ8 A;  3ZG5 A;  3LFV A;  3MQQ A;  2Y4A A;  3MBZ A;  2PYP A;  3GDI A;  4DE2 A;  3G2Z A;  4OLD A;  3EEH A;  2V0U A;  2VKS A;  3C30 A;  3OZH A;  5DKK A;  3G35 A;  4LGW A;  2BG1 A;  4MEZ A;  3Q07 A;  1CEG A;  1ERM A;  1EWZ A;  4EER A;  4KQR A;  5A91 A;  1XJ6 A;  1KGF A;  2QZ6 A;  1G6A A;  2WZX A;  1D06 A;  1KDS A;  2ZC4 B;  4BLM A;  2ZQD A;  1RP5 A;  2KOI A;  3LR4 A;  4B4X A;  4IVI A;  3IHA A;  4BL2 A;  3K3C A;  3CPT A;  4GKU A;  4I38 A;  1NLY A;  5AJG A;  3UME A;  4H6J A;  2Y59 A;  3K3D A;  5M18 A;  2R9X A;  5HD5 A;  2QWS A;  3HLE A;  4YFM A;  4DXC A;  2FFF B;  3E0Y A;  3SOI A;  2QJ5 A;  2Y91 A;  4ZBE A;  4K08 A;  4EQ1 A;  4EBN A;  2ACG A;  3FC7 A;  5F5Y A;  1T1A A;  1OJ5 A;  4UA6 A;  1F9I A;  5HWV A;  2VV7 A;  3NY4 A;  2HP9 A;  1FCN A;  2ZC6 B;  3TRC A;  4EUZ A;  1GA0 A;  4PM6 A;  1U60 A;  5FI2 A;  2O9C A;  4IVK A;  1YMX A;  4Q0J A;  3V67 A;  2P7J A;  1GSX A;  1K56 A;  3QP1 A;  1L3L A;  2OLU A;  4BD1 A;  3M2K A;  4R3J A;  3MFD A;  3ZNT A;  1S6R A;  4K91 A;  1V9Z A;  3CLO A;  2W1T A;  2V20 A;  5E2F A;  1H0M A;  1SZV A;  5AQ7 A;  4LEN A;  3MXQ A;  4S2N A;  4Q0H A;  1MKI A;  3ITA A;  3NCK A;  1LL9 A;  4BD0 A;  4D2O A;  2EWW A;  1CJF A;  4D60 A;  4GD8 A;  1VM1 A;  4F94 A;  4N92 A;  1VEU B;  1VET B;  3PAG A;  3UDI A;  2JKR I;  5L8M A;  1TS8 A;  4LFU A;  2PR5 A;  4XXR A;  2ZMV A;  4EBL A;  3LIA A;  3BEB A;  4N1X A;  5DTK A;  3DTI A;  3BFE A;  1KVL A;  4MLL A;  1NJ4 A;  2WKH A;  4FTX A;  3VE4 A;  3HUM A;  3LR5 A;  4BWI A;  5JYP A;  3S22 A;  3UMD A;  3GQZ A;  1BLH A;  1S1Y A;  4JF4 A;  3MQO A;  2JHE A;  1J9M A;  1XJ4 A;  4IJG A;  1YKD A;  1KVM A;  2JKR M;  3LO7 A;  4HP4 A;  3V5M A;  1NY0 A;  1TVF A;  2ZLY A;  1DY6 A;  3FG8 A;  2VGL S;  1TS7 A;  1PWG A;  4R0Q A;  5E2E A;  1YT4 A;  2WGI A;  2VX8 A;  2WGW A;  4OOM A;  3TE8 A;  2WKP A;  4B93 A;  1K55 C;  3N4I A;  3HLD A;  4P0M A;  1BLP A;  4HHD A;  5DKL A;  3S4X A;  2E8I A;  3FYZ A;  2HV1 A;  4KZ6 A;  5DFX A;  4OPZ A;  1XFQ A;  2W3D A;  4MCW A;  2ZMF A;  3T4Q A;  3BRM A;  4NEE D;  3OLO A;  5EEC A;  3AGE A;  2A49 A;  5GHZ A;  4RX3 A;  2B5R A;  1SCW A;  4AFI A;  5EVI D;  4Y0O A;  3HUO A;  3C4P A;  3WWX A;  2GJ3 A;  2WKR A;  3ITB A;  3T4S A;  4X1M A;  3OPL A;  5DF7 A;  3P7N A;  3VP1 A;  1E4D A;  1K57 A;  3TSG A;  3LEQ A;  1TDG A;  4DJ3 A;  3EQU A;  5KMW A;  3CMZ A;  4HES A;  4WUJ A;  3Q82 A;  1GHI A;  2EXB A;  3VSL A;  2EFX A;  2I9V A;  2X71 A;  1MKM A;  3EGX C;  2P04 A;  2W1R A;  1W8Y A;  5J3W A;  5HAR A;  2XD1 A;  3F1P A;  4LV1 A;  4WMC A;  3UB9 A;  1PI5 A;  1KOU A;  2PDR A;  3T4K A;  1YSQ A;  1LL8 A;  5GHX A;  4S2K A;  4I3A A;  3W4O A;  1H8M A;  3T12 B;  3IF5 A;  1YLZ A;  4WN5 A;  1K6S A;  4JXW A;  2OV5 A;  5F69 A;  1OTB A;  4HP9 A;  2P9V B;  4DJ2 A;  5J7E A;  2XK1 A;  3DTK A;  4GB7 A;  5CEB A;  4O01 A;  3BFD A;  2O9A A;  2R9W A;  1FIK A;  3G6O A;  4P6Z M;  4BEN A;  3DAV A;  1Y4O A;  3HCY A;  2EX2 A;  3IS2 B;  5AVE A;  3LIE A;  1IOU A;  1LHY A;  5HW3 A;  3E4Q A;  3A3I A;  4A5R A;  5CGS A;  4Y15 A;  4MBH A;  2H0T A;  2V0W A;  5IU1 A;  1MPL A;  3AGD A;  2XA7 S;  1GCE A;  2GZA A;  2VGK A;  1G68 A;  4PMA A;  3JPU A;  4LCM A;  3IF6 A;  4M4X A;  5EOO A;  1KGE A;  2KX6 A;  2R78 A;  2OLV A;  2HDU A;  4HBU A;  3BM6 A;  3O88 A;  3EEA A;  3PBS A;  4HY8 A;  2GDN A;  1TS6 A;  2A24 A;  1NZU A;  1T19 A;  3TG9 A;  5FEG A;  3B47 A;  3QP4 A;  1A0K A;  3WS1 A;  1KDW A;  3GTC A;  1CK3 A;  2VZW A;  2J3W A;  2V8C A;  3EWK A;  5F1G A;  1QMF A;  2P9V A;  1GA9 A;  2WKI A;  4YIN A;  4OPR A;  3OPP A;  1P9W A;  2Y55 A;  4ZRR A;  3SS4 A;  2GX5 A;  3S7O A;  3NDG A;  1G5U A;  1IEL A;  4EET B;  3IWI A;  1JNU A;  2H5S A;  2JKT I;  2W0N A;  2Y2L A;  4KQO A;  3UDF A;  5FQM A;  2XRN A;  4UQI M;  4CLC D;  1TD5 A;  2XRO A;  1NZO A;  4ARZ A;  2PT7 A;  1ES4 A;  3H7W B;  3MR0 A;  1NYM A;  4E3J A;  4ZDX A;  4EWF A;  3C38 A;  1PWC A;  4X53 A;  4DKI A;  1G28 A;  1IYS A;  4R6L A;  4S2O A;  5EUA A;  5HD3 A;  3S7N A;  1HLU P;  2Q9M A;  2BLS A;  4B88 A;  2PD8 A;  3CAX A;  3LIF A;  3RFB A;  4HOI A;  1FCO A;  5MC7 A;  1SHV A;  1LI0 A;  5CX7 A;  4S2J A;  1ERO A;  2Y79 A;  4RYE A;  1HD8 A;  4LPZ A;  4Z1W A;  2JKT M;  2INW A;  2V2F F;  1XGJ A;  1M40 A;  5E2H A;  1YQS A;  3P01 A;  2YKF A;  2OWJ A;  2V1A A;  2Y2G A;  4U0T A;  5G18 A;  4XT2 A;  1RCJ A;  4PPR A;  3IX8 A;  3CUE A;  4GS9 A;  1Q2P A;  1YLJ A;  3N6I A;  4JGQ A;  1GSW A;  1UGU A;  4EQI A;  1PIO A;  1ALQ A;  3A3J A;  2I72 A;  3Q7V B;  5F1F A;  5EFW A;  1IKI A;  2ZM2 A;  3OC2 A;  4EW7 A;  4HBT A;  3HLW A;  1BZA A;  1SDE A;  3L9K A;  1SDN A;  3WRZ A;  1XP4 A;  5J4E A;  1RGZ A;  4E3L A;  3FPV A;  4KUK A;  4HJ3 A;  3WS2 A;  1TF1 A;  3CPT B;  3LR0 A;  5HL6 A;  3UO9 A;  3ZG9 B;  2JKF A;  5GLA A;  3KYQ A;  1XA1 A;  4H6J B;  3BQA A;  3LYX A;  2EFU A;  5A93 A;  4QB8 A;  4NXB A;  3W2Z A;  4GN2 A;  5CED A;  4Y7P A;  1Z09 A;  2Y8H A;  5KIZ A;  3UNW A;  4X56 A;  4KG2 A;  4MNR A;  3ZQ5 A;  1KE3 A;  2BAS A;  4L9E A;  3NI9 A;  2KLI A;  3OPH A;  2ZQA A;  3VOL A;  3CZD A;  1XJ2 A;  4Y13 A;  3LR3 A;  4F3L A;  2LB5 A;  4UQI S;  1ES5 A;  3LIC A;  2W3F A;  1O7E A;  5G4Z A;  1ESU A;  4PM5 A;  3Q7V A;  1VB6 A;  1V9Y A;  3ZGA B;  3MXR A;  2M7U A;  3NUL A;  4GNU A;  2BTF P;  1MXO A;  2EA9 A;  4N9K A;  3VV4 A;  4H8R A;  1Y54 A;  1K54 A;  1PZO A;  3NJA A;  3MKF A;  4GDN A;  5E2G A;  4NG2 A;  3MKE A;  2W1T B;  3UPO A;  4MN7 A;  3VP2 A;  4UA7 A;  1JTG A;  5A90 A;  3UB6 A;  1SKF A;  2ZC5 B;  4YWZ A;  4OQ0 A;  5EVI A;  5D3O A;  1C3B A;  4MBF A;  1BT5 A;  2O99 A;  1F5M A;  2Y2Q A;  1JWZ A;  3G32 A;  4KG5 A;  3GV9 A;  5F6A A;  1OJG A;  4HIA A;  2M1C A;  2Z6C A;  3T1Q B;  3PBN A;  2JC7 A;  1SKO A;  4ZJ1 A;  2ZQ8 A;  3MZE A;  3A3D A;  3W4Q A;  4N9L A;  4FOF A;  3TW8 A;  1ZG6 A;  1DP9 A;  3BW6 A;  3UE3 A;  4OQG A;  4YOF A;  4R4R A;  3MMH A;  2PBD P;  5KSH A;  1ERQ A;  1PW8 A;  3DWZ A;  4PM7 A;  4L9G A;  1MWS A;  4OOY A;  1YSP A;  4U0X A;  4OQH A;  4NXE A;  3LY3 A;  2H0Y A;  1YAX A;  1XXM A;  1J3W A;  1OME A;  5HFO A;  1YLP A;  4R1G A;  4C3Q A;  2VK3 A;  1DP8 A;  4LRY C;  5F83 A;  3LID A;  4HH2 A;  3VFH A;  2WGW B;  1DP6 A;  1FR6 A;  4OH0 A;  2ZM0 A;  3SW1 A;  2QPN A;  2C6W B;  4S2N C;  3DTE A;  3UB7 A;  4HEF A;  2XH9 A;  4Y3I A;  3C5A A;  2UWX A;  2ZBB A;  4ZTK A;  4ID4 A;  3PBQ A;  2Y2I A;  4JF6 A;  3BQ8 A;  2XR0 A;  4GHI A;  4GDB A;  1KGG A;  1T1B A;  4OKP A;  3LY4 A;  4U3T A;  4EUV A;  1T1C A;  2J9P A;  3Q7Z A;  3ZHH A;  3WS4 A;  1H8Z A;  3ZYT A;  1F98 A;  2IWC A;  3JYI A;  3UE1 A;  1NYY A;  2H28 A;  2ZQ7 A;  3E2L A;  3T4T A;  5J8X A;  1CI8 A;  5CXW A;  2IWB A;  3P98 A;  1W5D A;  4ETX A;  2PD7 A;  4DF6 A;  1OT9 A;  1VQQ A;  2EXA A;  1MWU A;  4Y5F A;  3QNC A;  4QWO A;  5DF8 A;  2PU4 A;  5M19 A;  4X68 A;  1GHP A;  2WZZ A;  1EW0 A;  3A3E A;  4EBP A;  3NHQ A;  4R38 A;  1H3Q A;  3KO6 A;  2Z6D A;  1DJB A;  1IYP A;  5TBM A;  3ZG8 B;  3G4P A;  3QP6 A;  4KQQ A;  4ZJ2 A;  1N9O A;  1BLS A;  4KZ9 A;  5IT5 A;  1CF0 A;  1W79 A;  2P08 A;  3BJN A;  3F1P B;  4KZ4 A;  5F68 A;  2ZC7 A;  4O7D A;  4UAA A;  2HGV A;  3O3V A;  3IX4 A;  1FQG A;  2LB9 A;  1OTE A;  1W63 M;  4R23 A;  1PRQ A;  2WGV A;  1CQA A;  1P0Z A;  2A2L A;  3NDE A;  4BBV A;  2K31 A;  4CLC A;  4LV2 A;  4CQH A;  1XFN A;  2FH5 A;  4QJG A;  3OBF A;  3KYE A;  3VOY A;  2WAE A;  4ZAM A;  4B9O A;  4IBX A;  3HLB A;  4NET A;  2C5W B;  1S4R A;  3VMA A;  5KZH A;  3BEC A;  3IXD A;  5HAQ A;  2XDM A;  3PHY A;  4QY6 A;  1FOF A;  1DJC A;  4E6X A;  1L0D A;  3M2J A;  4WEJ A;  3MSH A;  5AVF A;  3BLS A;  5GLD A;  1K57 C;  3ZVW A;  3O5Y A;  2G2U A;  2XFT A;  1BLC A;  1L2S A;  5GL9 A;  2HPB A;  4S2L A;  3S7P A;  3IT9 A;  3IF6 B;  4OPY A;  5AQ9 A;  3UB5 P;  4JGR A;  4XUZ A;  1VHM A;  1AXB A;  1TS0 A;  2WAF A;  1K56 D;  5M1A A;  4G3V A;  4CPK A;  4KZB A;  2W3G A;  4MBK A;  5BOH A;  5FAQ A;  2HDQ A;  2A24 B;  4JGP A;  5GLB A;  4KZ7 A;  1ZTU A;  4B4Z A;  4PAU A;  3G30 A;  3HRE A;  1I2W A;  3RJU A;  3GEC A;  3O87 A;  4GZB A;  3C7V A;  1BUL A;  3D4F A;  3GMW A;  2Z2M B;  4BQM A;  1D1J A;  5A8B A;  5AQA A;  4OOL A;  4EEU A;  4M3K A;  1EI5 A;  3CIT A;  4RX2 A;  5FI7 A;  4ARZ B;  1O07 A;  1OTA A;  3IX3 A;  3BWL A;  4IBR A;  1YPR A;  4C75 A;  1N9N A;  3IWQ A;  1KE0 A;  1PNE A;  4HQA A;  4Y0T A;  1IKG A;  3ZFZ A;  3HVF A;  1NLZ A;  4EES A;  4KZA A;  1OT6 A;  2RL3 A;  3IXH A;  1DJA A;  2WKE A;  4KZ3 A;  1ZHH B;  1NRJ A;  2OWH A;  4X69 A;  4Q0I A;  4C6Y A;  4FH4 A;  5K5B A;  2QKP A;  4NKP A;  1MWR A;  1K6R A;  3V3R A;  1HVB A;  4FCF A;  3MF0 A;  3FKW A;  3E4P A;  3IF6 C;  4MN6 A;  2HJE A;  3LIB A;  2RCX A;  3G2Y A;  5TJJ A;  4S2I A;  5HPF A;  1HTZ A;  4RVA A;  1UWN X;  4KQD A;  2Y2O A;  3QHY A;  4Y2F A;  5DF9 A;  3IWO A;  1MY8 A;  4XT2 B;  3UE0 A;  1GHM A;  3R7W A;  4LCL A;  1ACF A;  2ZC3 B;  3EGD C;  1YM1 A;  4GS9 B;  1ONG A;  2JN7 A;  4MDZ A;  4WZ5 A;  3WS5 A;  3ZCZ A;  5FAP A;  3IHB A;  1F2K A;  3UN7 A;  3IH9 A;  4MMN A;  1OTI A;  5FAO A;  2J9O A;  3ZDJ A;  5HWT A;  1FSW A;  3E2K A;  3D9Y A;  4DE0 A;  3KSG A;  2KDK A;  5FAS A;  5I94 A;  2V1B A;  3G34 A;  3SS5 A;  4DDY A;  3CI6 A;  1M6K A;  5IHV A;  2DNS A;  3IXG A;  5DTT A;  1WA9 A;  4R70 A;  1ESI A;  3VP3 A;  4DDS A;  3A0S A;  1XX2 A;  4I3J A;  3HJI A;  1RGY A;  4JKT A;  4NXG A;  4I5S A;  3ULF A;  3V50 A;  5FQI A;  5EOE A;  4JLF A;  3Q1F A;  2ZM8 A;  1KE4 A;  3S1Y A;  2QHK A;  4P6Z S;  1TEM A;  1D7E A;  2ZOH A;  2J7V A;  5CGW A;  3T4L A;  4BJP A;  4F3L B;  4K0X A;  4I39 A;  1Q2Q A;  2Q9N A;  3SH7 A;  1E3U D;  4BBT A;  2Y2H A;  2VEA A;  4R3A A;  2H10 A;  4OVD A;  1ES3 A;  3CUE C;  4FUW A;  5FEF A;  2PBY A;  4P87 A;  2UV0 E;  1XPB A;  3W4P A;  5E43 A;  4WF0 A;  3H82 A;  3QNB A;  1MBL A;  3ZG0 A;  5TFQ A;  5LBR A;  2QYB A;  2ZOI A;  1PWD A;  3HJK A;  2PU2 A;  3N8S A;  3NC8 A;  1JTD A;  4KEN B;  1IFQ A;  1GSV A;  4LRZ E;  1E25 A;  4QPR A;  2ZMA A;  2IWD A;  2W27 A;  4ESP A;  3GRJ A;  5I5L A;  3A3F A;  2VJW A;  5EVI B;  1XKZ A;  2J80 A;  3O86 A;  3CG5 A;  2AVX A;  3HL9 A;  3MXS A;  5L07 A;  5EV0 A;  1FIL A;  2G7U A;  4MN5 A;  3M6H A;  2XFS A;  4JBF A;  1LSX A;  4R4S A;  1JWP A;  4YNR A;  3BFC A;  3DBA A;  4E3K A;  2O9B A;  1X0O A;  4WYY A;  2B95 A;  2Y2J A;  1SKO B;  3IXB A;  5GHY A;  2P74 A;  4LLO B;  2L1M A;  2A3U A;  4WL9 A;  4O8G A;  2W3H A;  2QJ7 A;  4RQ9 A;  3FZC A;  1OTD A;  2D01 A;  1YLT A;  4BBU A;  3PAE A;  1S67 L;  1K4E A;  2FZ0 A;  3VE3 A;  4GLQ A;  4X1L A;  2VGJ A;  5DVA A;  5HPI A;  2CMN A;  3RTY A;  2WYX A;  4NXF A;  5CTN A;  2Z2L B;  4L0L A;  2ZL1 A;  5FDH A;  4E04 A;  3T1S A;  1LSV A;  4IUK A;  3C7U A;  2B18 A;  1K54 C;  4II7 A;  3V3S A;  5TGF A;  5HZH A;  4EV4 A;  4O0P A;  1W7F A;  2PR6 A;  3BFF A;  5A92 A;  3IQA A;  2ZJ9 A;  4PKY G;  2PHY A;  1ZG4 A;  3F1N A;  3IBJ A;  3E98 A;  3QP8 A;  3HLF A;  3ZVT A;  3PBT A;  3MFX A;  2VGL M;  5EM1 A;  5EVI C;  4WM9 A;  1NWZ A;  2NUP C;  3TOI A;  3C8C A;  1LI9 A;  3N8L A;  4GHI B;  1L0F A;  1K25 A;  3ISG A;  3OOV A;  3N7W A;  4Z9Q A;  4CLC E;  3BLM A;  4E6W A;  5HL1 A;  2Y2N A;  2GNX A;  1XGI A;  3VSK A;  1ODV A;  1K0K A;  4FH2 A;  3EOI A;  3LEZ A;  4WEK A;  3RXX A;  3T50 A;  1WE4 A;  4PHT A;  3UY6 A;  4OP8 A;  3RXW A;  1WYC A;  3KSH A;  1HZO A;  5CHM A;  5TBM B;  1AWI A;  3HLG A;  4KG6 A;  2W3E A;  2XD5 A;  1S66 L;  2XSS A;  2VLG A;  1YLY A;  5AQB A;  2Y2P A;  3PBO A;  3DTM A;  1IYQ A;  2E8J A;  2ZD8 A;  4QD4 A;  5CTM A;  4E3I A;  1H5X A;  1T18 A;  3SH9 A;  1ONH A;  2PYR A;  5HAP A;  3MZD A;  5FQJ A;  3AGF A;  3M6B A;  5EPH A;  4CLC B;  4DE3 A;  2HJ9 C;  2EWV A;  3LCE A;  1N9L A;  4N1H A;  4OON A;  2IA2 A;  3HBR A;  2HP5 A;  3G31 A;  3LI8 A;  3OCL A;  3K2N A;  1LSW A;  4JXG A;  4OLG A;  4Y17 A;  4LV0 A;  2K7S A;  5DTS A;  2B02 A;  1ZKJ A;  5HDS A;  5FAT A;  3BYD A;  3FWL A;  1K38 A;  5EVE A;  4HI4 A;  3PBR A;  2WKQ A;  3NBL A;  4GW9 A;  5CGX A;  1BUE A;  5EM0 A;  1K55 A;  1STZ A;  4OPQ A;  3IH8 A;  1PFL A;  3MZF A;  3GVB A;  4IED A;  4LRX C;  2HDR A;  4I3I A;  4HJ6 A;  4WEL A;  1W63 Q;  1S4S A;  3R4K A;  3T1R A;  1VEU A;  3EQV A;  3VP0 A;  5L2F A;  2K2N A;  4JF5 A;  1VET A;  4K0W A;  2XLN A;  4FD8 A;  1UWP X;  4S2P A;  2J3T C;  2XA7 M;  3I7J A;  4CJN A;  3S7Q A;  5HDC A;  3W8K A;  5FQQ A;  4GJ4 A; 
#chains in the Genus database with same CATH homology
 4E3L A;  1YMX A;  3V3R A;  1HVB A;  4FCF A;  3FKW A;  1L0E A;  3VFF A;  3IF6 C;  1K56 A;  4DRT A;  2OLU A;  3WS2 A;  3M2K A;  4BD1 A;  5GLC A;  4R3J A;  2RCX A;  5HAI A;  3G2Y A;  3MFD A;  3ZNT A;  1S6R A;  4NK3 A;  4K91 A;  3UO9 A;  3ZG9 B;  4S2I A;  1HTZ A;  5GLA A;  2V20 A;  5E2F A;  1XA1 A;  4RVA A;  5AQ7 A;  4LEN A;  2EFU A;  5A93 A;  4QB8 A;  4S2N A;  2Y2O A;  3QHY A;  5DF9 A;  4QHC A;  4R3B A;  1FCM A;  1MKI A;  3IWO A;  2HP6 A;  3ITA A;  3NCK A;  1MY8 A;  5CHU A;  1LL9 A;  4GN2 A;  3UE0 A;  1GHM A;  4Y7P A;  4LCL A;  5CED A;  4BD0 A;  2ZC3 B;  1YM1 A;  4ZJ3 A;  3UNW A;  4D2O A;  1CEF A;  4X56 A;  1ONG A;  4KG2 A;  4GD8 A;  4WZ5 A;  5CER A;  3WS5 A;  4MNR A;  1VM1 A;  4F94 A;  1KE3 A;  3NIA A;  4N92 A;  3ZCZ A;  5FAP A;  3IHB A;  3NI9 A;  3OPH A;  3UN7 A;  2ZQA A;  3PAG A;  3IH9 A;  3UDI A;  5FAO A;  1CI9 A;  4LV3 A;  3CZD A;  2J9O A;  3ZDJ A;  4QU3 A;  2WUQ A;  4XXR A;  1FSW A;  4EBL A;  3E2K A;  3OPR A;  1ES5 A;  1MWT A;  4DE0 A;  3BEB A;  1O7E A;  4N1X A;  1H8Y A;  2Y2M A;  1ESU A;  5DTK A;  4PM5 A;  3BFE A;  5FAS A;  4XUX A;  1KVL A;  2DCF A;  3G34 A;  3SS5 A;  4DDY A;  5I94 A;  4MLL A;  1M6K A;  1NJ4 A;  3Q7V A;  5IHV A;  2DNS A;  3IXG A;  1E3U A;  5DTT A;  3ZGA B;  3MXR A;  1PYY A;  2WKH A;  1ESI A;  4GNU A;  3VP3 A;  3HUM A;  1MXO A;  4N9K A;  3UDX A;  4Q8I A;  4DDS A;  4H8R A;  1Y54 A;  3S22 A;  5JYP A;  1K54 A;  1BSG A;  1PZO A;  3MKF A;  3GQZ A;  4GDN A;  5E2G A;  2G2W A;  4KZ5 A;  1BLH A;  4RA7 A;  3MKE A;  1XX2 A;  3GR2 A;  3UPO A;  1RGY A;  4QY5 A;  4GOG A;  1TDL A;  4JF4 A;  3VP2 A;  4UA7 A;  3UPP A;  1JTG A;  4JKT A;  5A90 A;  1J9M A;  3V50 A;  5FQI A;  3SH8 A;  1SKF A;  5EOE A;  4JLF A;  2JE5 A;  1KVM A;  2ZC5 B;  3LO7 A;  3Q1F A;  3V5M A;  1NXY A;  1NY0 A;  2ZM8 A;  1KE4 A;  3S1Y A;  1TVF A;  2DRW A;  2ZLY A;  1DY6 A;  4OQ0 A;  3V39 A;  3VP4 A;  5EVI A;  5J8X A;  5D3O A;  1PWG A;  1C3B A;  4MBF A;  4R0Q A;  1BT5 A;  4S2M A;  1TEM A;  5E2E A;  1YT4 A;  2J7V A;  5CGW A;  2WGI A;  2Y2Q A;  1JWZ A;  3G32 A;  4KG5 A;  2WGW A;  4OOM A;  3GV9 A;  4BJP A;  4K0X A;  1N4O A;  3PBN A;  1K55 C;  1Q2Q A;  2Q9N A;  3N4I A;  2JC7 A;  1E3U D;  3SH7 A;  3HUN A;  3HLD A;  2XEP A;  4P0M A;  2Y2H A;  1BLP A;  4ZJ1 A;  2ZQ8 A;  3MZE A;  4WZ4 A;  3A3D A;  2EX6 A;  3W4Q A;  2FFY A;  2H10 A;  3FKV A;  3S4X A;  4N9L A;  5M19 A;  4OVD A;  4OQI A;  1ES3 A;  2E8I A;  2PBY A;  3FYZ A;  4P87 A;  1ZG6 A;  1XPB A;  4KZ6 A;  3UE3 A;  3W4P A;  5E43 A;  4E3N A;  4OPZ A;  4OQG A;  2XQZ A;  3QNB A;  4R4R A;  2XGN A;  3FV7 A;  1MBL A;  4JXS A;  3ZG0 A;  3BRM A;  5TFQ A;  1N9B A;  5EEC A;  5KSH A;  1K4F A;  1PWD A;  1K6R A;  2PU2 A;  3AGE A;  1ERQ A;  1JTD A;  1W8Q A;  3N8S A;  1PW8 A;  2A49 A;  3DWZ A;  3NC8 A;  1BTL A;  3PTE A;  4KEN B;  4PM7 A;  4RX3 A;  5GHZ A;  2B5R A;  1JVJ A;  1SCW A;  1E25 A;  1MWS A;  4OOY A;  4U0X A;  3VOZ A;  4OQH A;  5EVI D;  3LY3 A;  2H0Y A;  4Y0O A;  2ZMA A;  2IWD A;  1XXM A;  3HUO A;  1OME A;  2QMI A;  3C4P A;  3WWX A;  5HFO A;  1LLB A;  1FSY A;  1YLP A;  3GRJ A;  4R1G A;  3A3F A;  2WAD A;  3C4O A;  4C3Q A;  5EVI B;  1XKZ A;  3ITB A;  3O86 A;  1WYB A;  3CG5 A;  3HL9 A;  3MXS A;  5F83 A;  3M6H A;  1IEM A;  2XFS A;  3OPL A;  5DF7 A;  5FQK A;  4JBF A;  3VFH A;  3VP1 A;  1E4D A;  1K57 A;  2WGW B;  4R4S A;  4X6T A;  1FR6 A;  4OH0 A;  1JWP A;  3TSG A;  3BFC A;  2ZM0 A;  1TDG A;  4E3K A;  2QPN A;  2EX8 A;  2C6W B;  3EQU A;  4S2N C;  4WYY A;  3WS0 A;  5KMW A;  3CMZ A;  2Y2J A;  1LL5 A;  4HEF A;  3IXB A;  4HES A;  5GHY A;  2P74 A;  5EE8 A;  3Q82 A;  2A3U A;  2XH9 A;  1GHI A;  2EXB A;  3C5A A;  3VSL A;  2CC1 A;  4JXV A;  2EFX A;  2UWX A;  5CRF A;  2X02 A;  2X71 A;  4ZTK A;  4ID4 A;  2J8Y A;  4WZ5 C;  3FZC A;  4X55 A;  3PBQ A;  2Y2I A;  1W8Y A;  4JF6 A;  2XR0 A;  1YLT A;  5HAR A;  2XD1 A;  4GDB A;  1PI4 A;  4WBG A;  1KGG A;  4U3T A;  4OKP A;  3LY4 A;  4LV1 A;  3PAE A;  4WMC A;  5HX9 A;  4JPM A;  4BL3 A;  2J9P A;  1PI5 A;  1K4E A;  3Q7Z A;  3ZHH A;  5FA7 A;  3WS4 A;  1H8Z A;  3DW0 A;  2IWC A;  1Z6F A;  2VGJ A;  4UA9 A;  5DVA A;  2Y2K A;  3JYI A;  3UE1 A;  1NYY A;  2ZQ7 A;  1I2S A;  3E2L A;  2WYX A;  5CTN A;  1IYO A;  5GHX A;  3Q81 A;  2Z2L B;  1PZP A;  4FSF A;  1CI8 A;  4L0L A;  4S2K A;  5CXW A;  2IWB A;  3W4O A;  1XA7 A;  1YMS A;  5FDH A;  3P98 A;  1FR1 A;  4P85 A;  1W5D A;  4UHU A;  1ZC2 A;  3C7U A;  4DF6 A;  1K54 C;  1VQQ A;  3V3S A;  2EXA A;  1MWU A;  5TGF A;  3CJM A;  4E3O A;  3QNC A;  2ZQ9 A;  3IF5 A;  4EV4 A;  2JCH A;  1W7F A;  1YLZ A;  1QME A;  5TR7 A;  5DF8 A;  1K6S A;  4JXW A;  2PU4 A;  3DWK A;  3BFF A;  2HDS A;  3BFG A;  1GHP A;  2WZZ A;  3HLC A;  3IQA A;  4X68 A;  2OV5 A;  5A92 A;  2ZJ9 A;  1I5Q A;  3A3E A;  2P9V B;  4PM9 A;  5CHJ A;  4EBP A;  5KSC A;  2XK1 A;  1ZG4 A;  4GB7 A;  5CEB A;  1DJB A;  1IYP A;  5EVL A;  3HLF A;  5U47 A;  3ZVT A;  3PBT A;  5FQ9 A;  5F82 A;  3G4P A;  3ZG8 B;  3BFD A;  2R9W A;  5EVI C;  4WM9 A;  4KQQ A;  1ES2 A;  2XF3 A;  4ZJ2 A;  4BEN A;  3B3X A;  1BLS A;  4WMC D;  3TOI A;  2EX2 A;  4KZ9 A;  1LI9 A;  1W79 A;  3N8L A;  1L0F A;  1K25 A;  3ISG A;  4KZ4 A;  1LHY A;  3N7W A;  1L0G A;  2ZC7 A;  2ZQC A;  4O7D A;  3A3I A;  4Z9Q A;  3WRT A;  4UAA A;  5CGS A;  4A5R A;  4MBH A;  4DXB A;  2H0T A;  3O3V A;  1S0W A;  1MPL A;  3AGD A;  1FQG A;  5CEC A;  1GCE A;  3GSG A;  3BLM A;  4E6W A;  5HL1 A;  2Y2N A;  2OSU A;  1XGI A;  1JWV A;  2VGK A;  5JYO A;  1G68 A;  4PMA A;  4LCM A;  3IF6 A;  4R23 A;  3VSK A;  2X01 A;  2WGV A;  5EOO A;  3NDE A;  2V1Z A;  1KGE A;  4FH2 A;  4LV2 A;  3LEZ A;  4WEK A;  3RXX A;  1WE4 A;  1PW1 A;  2JBF A;  4QJG A;  4PM8 A;  3UY6 A;  4P6B A;  3OCN A;  2OLV A;  1YLW A;  2HDU A;  4HBU A;  3BM6 A;  3O88 A;  4OP8 A;  3VOY A;  1NRF A;  3PBS A;  2WAE A;  4E3M A;  4ZAM A;  3RXW A;  4IBX A;  1WYC A;  3HLB A;  2C5W B;  2GDN A;  4NET A;  1NZU A;  3TG9 A;  3VMA A;  5KZH A;  3BEC A;  3WS1 A;  1HZO A;  3IXD A;  4GD6 A;  5CHM A;  5HAQ A;  3HLG A;  1KDW A;  3GTC A;  2EX9 A;  2XDM A;  4KG6 A;  1CK3 A;  4QY6 A;  1FOF A;  1DJC A;  4E6X A;  5FSR A;  2XD5 A;  3P09 A;  1L0D A;  5F1G A;  1QMF A;  2P9V A;  1GA9 A;  3M2J A;  4WEJ A;  2WKI A;  4YIN A;  4OP5 A;  1YLY A;  5AQB A;  3ZG7 B;  2Y2P A;  3BLS A;  3PBO A;  5GLD A;  4OPR A;  1K57 C;  3ZVW A;  3DTM A;  3OPP A;  4DE1 A;  1IYQ A;  2ZD8 A;  3ZNY A;  2Y55 A;  3UPN A;  4QD4 A;  3SS4 A;  5CTM A;  4E3I A;  1H5X A;  3SH9 A;  1ONH A;  2G2U A;  3NDG A;  4Y0U A;  3SS3 A;  1IEL A;  5HAP A;  3IWI A;  2H5S A;  5FI6 A;  2Y2L A;  4KQO A;  3UDF A;  3N8R A;  3MZD A;  2WK0 A;  5FQM A;  2XFT A;  1BLC A;  1L2S A;  5FQJ A;  5GL9 A;  2HPB A;  4S2L A;  1NZO A;  4KZ8 A;  3ZG5 A;  3AGF A;  1ES4 A;  3IT9 A;  2Y4A A;  3M6B A;  3IF6 B;  3MBZ A;  4OPY A;  5AQ9 A;  5EPH A;  1NYM A;  4DE3 A;  4XUZ A;  4DE2 A;  4E3J A;  3G2Z A;  4ZDX A;  1AXB A;  4OLD A;  4EWF A;  3LCE A;  2WAF A;  1PWC A;  4N1H A;  4X53 A;  4OON A;  1K56 D;  5M1A A;  3HBR A;  3OZH A;  2HP5 A;  3G31 A;  3G35 A;  4CPK A;  4DKI A;  2BG1 A;  1IYS A;  3OCL A;  4MEZ A;  3Q07 A;  1CEG A;  1ERM A;  4KZB A;  4MBK A;  4S2O A;  5BOH A;  1EWZ A;  4JXG A;  5EUA A;  5FAQ A;  4OLG A;  4LV0 A;  4KQR A;  2Q9M A;  5A91 A;  2BLS A;  4B88 A;  2HDQ A;  1KGF A;  2QZ6 A;  1G6A A;  2WZX A;  1FCO A;  5DTS A;  5GLB A;  1ZKJ A;  4KZ7 A;  5FAT A;  3BYD A;  1KDS A;  1SHV A;  2ZC4 B;  4B4Z A;  4BLM A;  2ZQD A;  3FWL A;  1K38 A;  1LI0 A;  1RP5 A;  4S2J A;  1ERO A;  3G30 A;  4RYE A;  3HRE A;  1HD8 A;  3PBR A;  4B4X A;  4IVI A;  3IHA A;  1I2W A;  3RJU A;  2V2F F;  4BL2 A;  3NBL A;  3O87 A;  5HW3 A;  4GKU A;  1XGJ A;  1M40 A;  4GZB A;  5CGX A;  3C7V A;  5E2H A;  1BUE A;  1BUL A;  3D4F A;  1YQS A;  3GMW A;  2Z2M B;  2Y59 A;  1K55 A;  5M18 A;  4BQM A;  4OPQ A;  2R9X A;  5AQA A;  2Y2G A;  3HLE A;  3IH8 A;  4U0T A;  4YFM A;  4DXC A;  3MZF A;  4IED A;  3GVB A;  4M3K A;  2FFF B;  4OOL A;  1EI5 A;  5G18 A;  3SOI A;  4RX2 A;  2Y91 A;  5FI7 A;  1RCJ A;  2HDR A;  1O07 A;  4ZBE A;  4PPR A;  4IBR A;  4WEL A;  4C75 A;  1Q2P A;  1YLJ A;  3N6I A;  4EBN A;  3IWQ A;  1KE0 A;  3EQV A;  3VP0 A;  4Y0T A;  1IKG A;  4EQI A;  5L2F A;  4JF5 A;  4K0W A;  3ZFZ A;  3HVF A;  1PIO A;  4UA6 A;  4KZA A;  1ALQ A;  3A3J A;  2XLN A;  2I72 A;  4FD8 A;  3Q7V B;  5F1F A;  2RL3 A;  3IXH A;  1DJA A;  3NY4 A;  1IKI A;  2HP9 A;  2WKE A;  2ZM2 A;  3OC2 A;  1FCN A;  2ZC6 B;  3HLW A;  4HBT A;  4KZ3 A;  1BZA A;  1SDE A;  4EUZ A;  4S2P A;  1GA0 A;  4PM6 A;  1SDN A;  3WRZ A;  4X69 A;  1U60 A;  3I7J A;  4CJN A;  1XP4 A;  4C6Y A;  3W8K A;  4FH4 A;  5FQQ A;  5FI2 A;  1MWR A;  1RGZ A;  4IVK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...