3FV7A

Oxa-24 beta-lactamase complex with sa4-44 inhibitor
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
244
structure length
243
Chain Sequence
HISSQQHEKAIKSYFDEAQTQGVIIIKEGKNLSTYGNALARANKEYVPASTFMLNALIGLENHKATTNEIFKWDGKKRTYPMWEKDMTLGEAMALSAVPVYQELARRTGLELMQKEVKRVNFGNTNIGTQVDNFWLVGPLKITPVQEVNFADDLAHNRLPFKLETQEEVKKMLLIKEVNGSKIYAKSGWGMGVTPQVGWLTGWVEQANGKKIPFSLNLEMKEGMSGSIRNEITYKSLENLGII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase OXA-24
publication title Design, synthesis, and crystal structures of 6-alkylidene-2'-substituted penicillanic acid sulfones as potent inhibitors of Acinetobacter baumannii OXA-24 carbapenemase.
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Hydrolase
total genus 78
structure length 243
sequence length 244
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2009-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3fv7A00
4RVAA 2Y2PA 5U47A 5A92A 4MLLA 2FFFB 3P09A 1I5QA 3DWKA 3BFDA 4QB8A 4OPZA 1PZOA 5F83A 3HLDA 4QHCA 3CZDA 1GA0A 2WYXA 2XR0A 3M6HA 2EX8A 1XP4A 3QHYA 4OPRA 3WS2A 2WGWB 5I94A 1M6KA 3MXSA 4R4RA 3ZG8B 2QPNA 2XH9A 3UN7A 5BOHA 4OPQA 4JPMA 5GLAA 1N9BA 4E3KA 4E6WA 1M40A 1NZOA 4GKUA 5A90A 1CEFA 1OMEA 4OP8A 3PBTA 3C7VA 1ERQA 1PW8A 3M2JA 3AGEA 4GZBA 4OOYA 2XGNA 2ZC7A 3LY3A 1XKZA 5EE8A 3LO7A 3VSLA 4PM6A 1H8ZA 4S2PA 1ONGA 3RJUA 4OLGA 3TOIA 3A3IA 4X69A 2ZM0A 4UA9A 5EUAA 3VFHA 4DF6A 5HAQA 4O7DA 4BLMA 2ZQ7A 1L0DA 1ESIA 4K0XA 4JXWA 3SS3A 3VOZA 3HLEA 3BM6A 4KG5A 4OQ0A 5CECA 2IWDA 4LV3A 1W5DA 1E3UA 3BECA 2WZZA 2WKIA 1ZG6A 4N1HA 4MNRA 3Q82A 3VSKA 4OPYA 4KZ7A 5E2FA 2XD1A 4XXRA 1EWZA 5EVIA 1WE4A 3N8RA 1ONHA 1DJAA 1JWZA 2BG1A 3PAEA 1SDEA 2XDMA 4N1XA 4LV0A 1AXBA 4NK3A 3NC8A 4U3TA 4P0MA 1NXYA 4JXVA 4RA7A 2G2UA 1NYMA 4NETA 4UAAA 3C4PA 5J8XA 1J9MA 3GR2A 4QY6A 4S2OA 4PMAA 1C3BA 2R9WA 1K6SA 4OP5A 4OVDA 4X6TA 1KE4A 1LL5A 4KG2A 1MBLA 2P9VA 3ZVWA 2E8IA 2Q9NA 3VMAA 4H8RA 2JCHA 4BD0A 4EV4A 4E3MA 3PAGA 2HDQA 4WEJA 1DJCA 4GN2A 1ES3A 1CI8A 3S1YA 1BLHA 1JWVA 2XK1A 4HBUA 1K57A 3Q7VB 1LLBA 1W7FA 2J8YA 1ES4A 5GLDA 3A3DA 4S2LA 3VFFA 1L0FA 4A5RA 3FZCA 1LI0A 3IWOA 1JTGA 4S2NA 3O3VA 2Y2LA 4WEKA 1XA7A 4MBFA 1K55A 3ZHHA 4P6BA 2VGJA 4OQHA 4WZ5C 1K4EA 2HPBA 3UPNA 2XQZA 4L0LA 1W8QA 3BEBA 2XFSA 2V2FF 3RXXA 2GDNA 1ES5A 3WS4A 3VP0A 5DF9A 1SHVA 4GNUA 4IVKA 1YLYA 4MBHA 5DF7A 5KMWA 1JVJA 2B5RA 3ZCZA 1YMXA 1BSGA 2Y91A 2X01A 3ZG9B 3DWZA 4HESA 3VP4A 5F82A 5FI2A 1FSYA 4WMCA 2RL3A 2EX2A 4JKTA 1YM1A 2ZQ8A 1XPBA 2PBYA 4LV2A 1XGIA 1DJBA 2QZ6A 2RCXA 3UO9A 3IWQA 1YLPA 4P87A 4KZBA 5M19A 5EOOA 1N4OA 1XX2A 2XD5A 4JLFA 3GSGA 4ZAMA 5FSRA 4EBPA 3MFDA 3OPPA 3OZHA 3MZEA 3ZNYA 1E3UD 1GA9A 5HW3A 4IBRA 1MKIA 2Y2JA 3IXHA 4KG6A 1PZPA 4PPRA 4S2KA 1K56A 5FQKA 3BYDA 2WKEA 1DY6A 3V3RA 1BT5A 3SS4A 2HDRA 3MZFA 1MXOA 4KZ3A 4PM7A 2UWXA 4U0XA 2J9PA 3V5MA 4DXCA 2J7VA 5E2HA 2OLVA 2J9OA 3A3EA 3UPOA 2WGVA 5CRFA 3AGDA 3TSGA 2ZJ9A 5L2FA 1NRFA 2WGIA 1K4FA 4WZ4A 1VQQA 5HX9A 2C5WB 4OONA 2Q9MA 3Q1FA 1XGJA 4UA7A 4QU3A 2Z2MB 1HVBA 3LY4A 1U60A 3W8KA 3IF6C 3BFFA 3IHAA 4JF6A 3TG9A 4BD1A 3CJMA 4ZDXA 3IT9A 2Y2QA 5G18A 5FAPA 1W8YA 1ESUA 4YINA 3G35A 4ZTKA 1PI4A 4WELA 1QMFA 4Y0OA 4E3OA 3PBRA 1JWPA 5FI7A 1NJ4A 4N92A 3DTMA 2X02A 3SH9A 1FSWA 2Y2MA 2ZC6B 3WS0A 1MWRA 2BLSA 5CXWA 2HP9A 1GCEA 1PWCA 5CGSA 1BUEA 2Y2GA 2ZQ9A 4MEZA 1YLJA 5CGXA 4LV1A 3W4PA 1K54C 3IF6B 5E2EA 5FI6A 4ZJ3A 1IYSA 2HDUA 5CERA 1KE0A 3MZDA 1L0EA 4K0WA 4E3NA 3NDGA 1I2WA 4DDSA 2R9XA 5DTKA 3V39A 1HTZA 1ALQA 2Y2OA 4GB7A 4WMCD 3C4OA 4BL3A 4FSFA 1G6AA 1WYCA 2DCFA 3A3FA 3ZDJA 4ZJ2A 3N7WA 1QMEA 4M3KA 3IH8A 3UPPA 2PU4A 4K91A 1YMSA 5AQ9A 2WZXA 2IWCA 4N9KA 1FOFA 3UDIA 3HUMA 4OKPA 4B4ZA 4PM9A 3BFGA 4IEDA 4DE3A 2A3UA 3UNWA 1BULA 4BQMA 1ZC2A 5CTMA 3QNCA 5CHUA 3FKWA 3GMWA 3OCNA 5CGWA 3PBSA 2WADA 4HBTA 2A49A 3A3JA 1YT4A 2Y2NA 4BJPA 1FR1A 3JYIA 1IKGA 1ES2A 3C7UA 5DF8A 1KE3A 2V20A 3O88A 4EUZA 4DDYA 3O86A 5JYOA 5EECA 1RCJA 3ZG0A 1JTDA 5TGFA 3UE0A 3G2ZA 4P85A 1MWUA 1XXMA 2ZQAA 3ZNTA 5DVAA 1L2SA 4PM5A 4R3BA 3ISGA 1KDWA 3N4IA 3ZFZA 3ZVTA 3FKVA 4DRTA 2WGWA 1MPLA 2WUQA 2Y2HA 4FH4A 1I2SA 1HZOA 2HP5A 4CJNA 3W4QA 1YLTA 4JF5A 4Y7PA 1LI9A 5DTSA 4X56A 1NYYA 4JF4A 5CEBA 3SOIA 5GHXA 2EX9A 5EVIC 4OOLA 4FH2A 1EI5A 1TDLA 4FCFA 3DW0A 4JBFA 1IKIA 4XUXA 4E3IA 4DE1A 4DXBA 3N8LA 1K38A 2ZM8A 3SH8A 1FCOA 1H8YA 1L0GA 1MWSA 1GHMA 1WYBA 5TFQA 3OPLA 5GHZA 1KVMA 2Y4AA 2ZC4B 3BLMA 4QD4A 5FDHA 1EROA 3BFCA 2XF3A 1KGGA 3HLWA 3OPHA 4R0QA 5F1GA 1ZKJA 3EQVA 3IHBA 3HBRA 4R3JA 3SH7A 3WRTA 1PWDA 3MXRA 4WBGA 5CTNA 5F1FA 5EVIB 4R23A 5FAOA 5FQIA 2C6WB 4B88A 5EVID 4FD8A 3ZG7B 5FATA 2OSUA 3M6BA 3LCEA 3HUNA 3HREA 1K57C 4KZ8A 3W4OA 2ZC5B 1KGEA 5DTTA 1BLSA 3NI9A 2EFUA 3VP2A 1MY8A 3ZG5A 1FCMA 1Q2QA 3ITBA 4GD6A 1PW1A 1KDSA 1K55C 1HD8A 1MWTA 2V1ZA 4Y0TA 5AQBA 5EOEA 3OCLA 1IYPA 1NZUA 2P9VB 3S22A 2ZC3B 4XUZA 1PI5A 3NY4A 4OQGA 2G2WA 4QJGA 3WWXA 2EXBA 2JC7A 3HLGA 1IEMA 4S2IA 4WM9A 3N8SA 4X53A 5IHVA 3ZGAB 3Q7VA 5FASA 1GHIA 2JBFA 3IXGA 2P74A 4PM8A 3FWLA 5M1AA 5M18A 1NY0A 1VM1A 3V3SA 4GD8A 4BL2A 4S2JA 5KSHA 4QY5A 3B3XA 2EXAA 2OV5A 5E43A 5FA7A 1PWGA 5GHYA 1YLZA 5AQ7A 4YFMA 1IELA 3AGFA 3G32A 3UY6A 2EX6A 3UE3A 3D4FA 4Y0UA 1E4DA 3IQAA 4N9LA 5HARA 2XEPA 4GOGA 1O07A 3MKFA 5GLCA 1TDGA 1FCNA 3IH9A 4IVIA 3IXDA 3HL9A 2WKHA 3I7JA 1RGYA 4DKIA 3GRJA 1ERMA 1BZAA 5TR7A 2Y59A 4WZ5A 1PIOA 1BTLA 5EPHA 3MKEA 4CPKA 4E6XA 2ZLYA 2DNSA 1XA1A 3QNBA 3WRZA 3GTCA 4MBKA 3UE1A 2Z2LB 3MBZA 1SCWA 3VOYA 5A91A 3IF5A 1SDNA 1CK3A 4DE2A 2OLUA 1Y54A 1S6RA 3E2LA 2H0YA 2PU2A 4U0TA 3FV7A 2HDSA 3S4XA 1K56D 1YQSA 2H10A 4S2MA 1G68A 4EQIA 5JYPA 2X71A 4RYEA 5FAQA 4EWFA 3ITAA 4X68A 1K25A 4Z9QA 5HAIA 3RXWA 1IYOA 1KVLA 5FQMA 4DE0A 3BRMA 3WS1A 3G31A 2Y2IA 3CG5A 3PBQA 3V50A 4E3JA 5AQAA 2QMIA 1KGFA 4ID4A 1BLCA 1H5XA 4KZ6A 1RGZA 3IWIA 4LCLA 2ZMAA 4KENB 2H5SA 4OLDA 4C6YA 5KZHA 3VP1A 2ZQDA 5HAPA 1S0WA 3HLFA 2WK0A 5KSCA 5E2GA 3Q7ZA 4LENA 5FQJA 4OQIA 1CI9A 3Q81A 3IXBA 1CEGA 3LEZA 3HLBA 3GQZA 4UHUA 5CHJA 3PBOA 3UDXA 4JXSA 3FYZA 4JXGA 2H0TA 3HLCA 4GDNA 3VP3A 2XLNA 3WS5A 2Y55A 2VGKA 1TVFA 4KZ9A 2HP6A 4GDBA 4KQQA 1LL9A 4KQOA 4EBLA 3G4PA 4D2OA 4RX3A 5HFOA 2JE5A 3BFEA 3G34A 5CHMA 4OOMA 1FR6A 3G2YA 1GHPA 3NCKA 3IF6A 4ZJ1A 1RP5A 1Z6FA 5GL9A 5CEDA 2I72A 2EFXA 3P98A 4C3QA 1SKFA 3NDEA 1E25A 1Q2PA 2FFYA 1YLWA 2CC1A 2WAFA 3CMZA 2IWBA 4C75A 3SS5A 2DRWA 3E2KA 2Y2KA 3N6IA 4RX2A 4R1GA 1O7EA 3OPRA 5EVLA 3M2KA 1FQGA 3GV9A 4R4SA 4X55A 4IBXA 3G30A 4Q8IA 1K54A 5GLBA 1PYYA 4ZBEA 5FQ9A 5HL1A 2XFTA 1W79A 3BLSA 3GVBA 4KQRA 4WYYA 3Q07A 4S2NC 5D3OA 3EQUA 2WAEA 1IYQA 4OH0A 3PTEA 4LCMA 3HVFA 3HUOA 4F94A 1K6RA 4KZ4A 4KZ5A 5FQQA 4KZAA 4E3LA 4HEFA 4B4XA 5A93A 3O87A 4EBNA 3UDFA 4UA6A 1BLPA 3PBNA 3NIAA 2ZM2A 2ZQCA 4BENA 1TEMA 1ZG4A 3C5AA 3NBLA 3OC2A 1LHYA 2ZD8A
chains in the Genus database with same CATH superfamily
1LL8A 5A92A 1YSPA 2FFFB 3P09A 3TJZC 3MJQA 3CZDA 2WYXA 2XR0A 2EX8A 1XP4A 3WS2A 5I94A 5BOHA 4R4RA 2QPNA 2QKPA 2XH9A 3NOPC 1NZOA 1OMEA 3PBTA 3M2JA 4OOYA 2XGNA 2VGLM 2ZC7A 1XKZA 3LY3A 5EE8A 1OPXA 5K5BA 4OLGA 3A3IA 2ZM0A 5HAQA 3UB5P 3LICA 1L0DA 4K0XA 3BQAA 4LV3A 1W5DA 3BECA 1ZG6A 3CUEA 4XXRA 2V1BA 5EVIA 1WE4A 3N8RA 3PAEA 2PD7A 5L09A 3P7NA 4P0MA 1NXYA 4GS9A 4UAAA 5L8MA 3IX4A 1J9MA 4BMWA 4F3LB 1K6SA 4OVDA 1H0MA 1KE4A 2P9VA 2E8IA 3VMAA 2NUPC 4BD0A 4GN2A 1NLZA 2XK1A 1W7FA 4S2LA 4A5RA 1LI0A 3IWOA 1JTGA 4JGOA 4WEKA 1XA7A 1K55A 4P6BA 2VGJA 4WZ5C 4O8GA 3UPNA 4L0LA 1CF0A 2V8CA 3RXXA 2GDNA 4IUHA 3WS4A 3W2ZA 5KMWA 3ZCZA 1BSGA 2W1TA 2Y91A 1FSYA 2RL3A 4X1LA 4JKTA 2ZQ8A 3BW6A 4KZBA 5EOOA 1N4OA 4JLFA 1GA9A 4IBRA 1MKIA 3IXHA 4KG6A 3F1OA 3BYDA 2WKEA 1BT5A 2HDRA 1MXOA 4MDZA 3NOTC 2J7VA 3A3EA 2J9OA 5CRFA 1S67L 2ZJ9A 4IUKA 5HSQA 5J3WA 4OONA 2Q9MA 4QU3A 1ACFA 3LY4A 1U60A 5IU1A 3IHAA 4BD1A 3CJMA 5FAPA 4UQIM 2JKRI 4DMZA 1TS8A 2XROA 4N92A 2X02A 3SH9A 5I5LA 1MWRA 5CXWA 3CWFA 4G3VA 1S1YA 2Y2GA 2ZQ9A 3LGOA 4LV1A 3IF6B 4ZJ3A 2JHEA 2EWWA 1L0EA 4K0WA 4E3NA 4Q0HA 4DDSA 3LIFA 5DTKA 1HTZA 4FTXA 1WYCA 3T1XA 2PU4A 1WA9A 2WZXA 3MF0A 5J7EA 3UDIA 4EEUA 4IEDA 4DE3A 1BULA 1ZC2A 3QNCA 2Z6CA 3GMWA 3HCYA 3OCNA 3PBSA 1F98A 3R4KA 3V67A 1KE3A 2V20A 3QP2A 5EECA 2NUTC 3ZG0A 2J80A 2ZQAA 5DVAA 4WUJA 3ISGA 1H8MA 3N4IA 3L7HA 1MPLA 4CJNA 2HP5A 4JF5A 1XJ3A 1NYYA 1F9IA 3SOIA 5GHXA 4FCFA 4E3IA 4JBFA 4DE1A 1K38A 2ZM8A 3CLOA 1FCOA 1H8YA 1MWSA 3NHQA 2HV1A 1KVMA 3B47A 3BLMA 1EROA 3FG8A 5F1GA 1D7EA 3IBJA 1ZKJA 3IHBA 2YKFA 3WRTA 1PWDA 3MXRA 5CTNA 5F1FA 3CITA 5EVIB 2C6WB 3LYXA 5HWVA 1GSWA 1K57C 4GS9B 1Q2QA 4GD6A 1HD8A 1MWTA 5AQBA 4NXGA 3TE8A 2P9VB 3S22A 2ZC3B 4Y15A 4R38A 4XUZA 2G2WA 4MN6A 5HD3A 2EXBA 2AVXA 4HHDA 4S2IA 4WM9A 4X53A 5FASA 3Q7VA 1GHIA 4PM8A 1NY0A 3OOVA 4NXFA 4H6JA 2MJ6A 2EXAA 3T1RA 3TRCA 5E43A 1SZVA 1PWGA 1MZUA 5FDSA 1YLZA 4YFMA 3UY6A 1W63M 2ZBBA 5HARA 4GOGA 2W1TB 3F1NA 2ACGA 2GZAA 5G4YA 2EWVA 3GRJA 5TR7A 2Y59A 5EVEA 4WZ5A 2OAQ1 2HZ5A 4E6XA 3MKEA 3ZYTA 3QNBA 3UB8A 3GTCA 3UE1A 2Z2LB 3E4OA 2O9AA 1XFQA 1NRJA 2Z6DA 1CK3A 4GW9A 1Y54A 4JGQA 2HDSA 3F1OB 2H10A 5JYPA 2JKRM 5FAQA 3ITAA 3C8CA 1K25A 4HOIA 5FQMA 4WN5A 3PBQA 3V50A 2QMIA 3UMDA 3VP1A 5KSCA 3Q7ZA 5DFYA 2VJWA 1CEGA 3HLBA 3UDXA 4JXGA 3HLCA 2Y79A 2Y55A 4GDBA 1LL9A 3IX3A 4KQOA 1G6OA 5CHMA 3G2YA 4ZJ1A 1N9LA 3D3OA 2EFXA 3P98A 3NDEA 1OTEA 2WAFA 2W0NA 4Y3IA 2IWBA 3SS5A 3E2KA 3N6IA 4R1GA 5EVLA 1FQGA 3GV9A 2XA7S 4BBUA 4Q8IA 4ZBEA 5F68A 5D3OA 4WYYA 3KX0X 3HUOA 4KZ4A 4HEFA 4EBNA 3T4QA 2ZM2A 4BENA 3C5AA 2VA0A 3OC2A 5U47A 2GNXA 3EGXC 4MLLA 1I5QA 1PZOA 3HLDA 2ZMVA 1GA0A 3M6HA 3QHYA 1M6KA 3LIBA 5GLAA 1DP6A 1XJ2A 1PW8A 1SKOA 3VSLA 4PM6A 4S2PA 1ONGA 5DJUA 4EESA 3LIAA 4X69A 4BLMA 2ZQ7A 4X25A 1ESIA 4JXWA 3HLEA 5CECA 3LFVA 4YWZA 3CAXA 5LBRA 3R7WB 3Q82A 4KZ7A 4LRZE 1JWZA 1SDEA 4LV0A 1AXBA 3QP4A 4NK3A 4R6LA 5AVEA 2G2UA 5J8XA 1LSWA 4QY6A 2LB9A 4PMAA 5FEGA 4OP5A 5DKKA 4X6TA 4O01A 4H8RA 2JCHA 3ULFA 5EM1A 2W27A 4EV4A 2HDQA 1DJCA 1ES3A 4Y5FA 1JWVA 1OTIA 1K57A 3Q7VB 1LLBA 5GLDA 4QWOA 2OWJA 4H6JB 5IS1A 3O3VA 2Y2LA 3MXQA 1OTBA 4OQHA 3RTYA 2O9CA 3IBRA 1W8QA 2XFSA 1T1CA 2LB5A 1SHVA 1W63Q 3FC7A 1YLYA 4YNRA 3NULA 5TJJA 3F1NB 4II7A 2X01A 3ZG9B 4HESA 4WMCA 2PAVP 3PYPA 1XPBA 2PBYA 2QZ6A 5M19A 1GSXA 2XD5A 2QHKA 3OZHA 2B95A 1K0KA 1PZPA 2J3TD 4PPRA 4S2KA 4I39A 1K56A 2PYPA 1DY6A 3V3RA 3SS4A 4KZ3A 4PM7A 4PHTA 4U0XA 1NWZA 2OLVA 4I38A 3UPOA 3KSFA 2A24A 3T12B 2WGIA 4HNBA 1XGJA 2Z2MB 3BFFA 4ZDXA 2HJEA 1TS6A 4YINA 4WF0A 1QMFA 3WS0A 2XA7M 2HP9A 1GCEA 1PWCA 1BUEA 3OBFA 4FOFA 3W4PA 4EXOA 5HD5A 2HDUA 5HWWA 2H28A 2P04A 2R9XA 4EEPA 2PT7A 4GB7A 4WMCD 1BYWA 4ZJ2A 1YAXA 3QP8A 3H82A 1FOFA 3HUMA 4FUWA 4B4ZA 3BFGA 2UV0E 5FEFA 3ICYA 4BQMA 4LPZA 1OTDA 2WADA 1YT4A 1Y4OA 2Y2NA 3T1QB 4BJPA 1ES2A 5DF8A 4HI4A 4BBVA 3T50A 3MFXA 1RCJA 3G2ZA 1XXMA 3ZNTA 4PM5A 4DRTA 2VV8A 2WGWA 2WUQA 2Y2HA 3KO6A 3W4QA 3LR5A 4Y7PA 3BQ8A 5DTSA 4GJ4A 3OLOA 1SKOB 1KOUA 3O5YA 3DW0A 1IKIA 4DXBA 5F69A 1L0GA 2M7UA 1GHMA 3JPUA 3OPLA 1T18A 4CQHA 4GHIA 2D02A 2XF3A 1KGGA 4R3JA 3HBRA 5DJTA 2P7JA 5EV0A 4B88A 5EVID 3ZG7B 2OSUA 3LCEA 3HUNA 3W4OA 1KGEA 1BLSA 3NI9A 3E4PA 3ITBA 1KDSA 1NZUA 1T1BA 2QYBA 1PI5A 4OQGA 4PAUA 1PFLA 3WWXA 1YKDA 3HLGA 3T1SA 3PXPA 2V8FA 4NXEA 3DTKA 3FWLA 1VM1A 3V3SA 1AWIA 4QY5A 3B3XA 4IJGA 1D1JA 5GHYA 2OOLA 1IELA 3AGFA 3G32A 4Y0UA 3U4LP 4N9LA 2PRFA 4KQDA 4EUVA 1FCNA 3IH9A 2WKHA 1P0ZA 1RGYA 3I7JA 4EU0A 2PHYA 5EPHA 3WRZA 3CPTA 4MBKA 3VOYA 4CLCA 1Z09A 3IF5A 2H0YA 2PU2A 3FV7A 3S4XA 3LR3A 1G68A 1IYOA 1OT6A 5HPIA 1KVLA 4DE0A 2Y2IA 4G3KA 1LSVA 5AQAA 2A24B 4E3JA 4ID4A 1H5XA 4KZ6A 3IWIA 4LCLA 4KENB 3HLFA 4B9OA 3A0SA 1CI9A 3Q81A 3IXBA 3VV4A 3LEZA 2KOIA 3FYZA 4GDNA 3VP3A 5HZHA 2VGKA 4KZ9A 4HH3A 2HP6A 4I5SA 4RX3A 5HFOA 1FR6A 2V1AA 3FPVA 5GL9A 3L9KA 1UGUA 1Q2PA 1YLWA 1PNEA 2Y2KA 4RX2A 1F2KA 4X55A 4IBXA 3H82B 4D60A 5GLBA 5HL1A 3KSGA 1UWNX 2XFTA 3GVBA 4HP4A 4OH0A 2VLGA 1K6RA 4KZ5A 5FQQA 4KZAA 2L1MA 3O87A 1TF1A 2K7SA 3PBNA 1TEMA 1LHYA 2ZD8A 4LRXC 3T4KA 3VE3A 4RVAA 2Y2PA 3UMEA 2W3FA 3DWKA 4MN5A 3BFDA 4OPZA 2JKTI 3LI9A 5F83A 4IHQA 4OPRA 2WGWB 3ZG8B 4OPQA 4JPMA 4E3KA 4E6WA 1M40A 5CX7A 4GKUA 5A90A 1CEFA 4OP8A 3S7PA 3AGEA 4EERA 3LO7A 1H8ZA 2PYRA 2HJ9C 3TOIA 3VFHA 4DF6A 4UA9A 4O7DA 2KX6A 3SZTA 3SS3A 4R3AA 5F6AA 3BM6A 4OQ0A 2PR6A 4GHIB 1E3UA 2WZZA 2FH5A 4N1HA 4MNRA 1XJ4A 3VSKA 4OPYA 1STZA 3BY8A 2XD1A 1DJAA 2BG1A 2XDMA 4N1XA 4RA7A 4JXVA 1HLUP 1NYMA 2GX5A 3GR2A 3CI6A 3E4QA 4S2OA 1D06A 1MBLA 2G7UA 4CLCE 4E3MA 3LR4A 4I3AA 3PAGA 4WEJA 4HBUA 1ES4A 2HF6A 3A3DA 3VFFA 3LI8A 4S2NA 3ZHHA 4MBFA 1GSVA 2XQZA 3F1PA 3BEBA 3UB7A 4EW7A 5DF9A 4IVKA 4MBHA 1YMXA 2V9AA 3DWZA 3VP4A 5F82A 2B02A 1XGIA 1DJBA 2RCXA 5HDCA 3UO9A 1YLPA 2GJ3A 3PR6A 4P87A 3CPTB 1XX2A 4ZAMA 5FSRA 1N9NA 3ZNYA 4CLCB 1E3UD 3QP6A 2Y2JA 3K3CA 4MCWA 1MC0A 3MZFA 2VGLS 2CMNA 2UWXA 2J9PA 5E2HA 2O0YA 5F5YA 3AGDA 5L2FA 4WZ4A 1K4FA 5HX9A 2C5WB 3Q1FA 1TS7A 3W8KA 4B93A 1IFQA 4JF6A 3TG9A 2PBDP 2QJ7A 2Y2QA 5G18A 1ESUA 4GCZA 4ZTKA 2INWA 4Y0OA 4E3OA 5FI7A 1DP8A 3DTEA 1FSWA 2Y2MA 2ZC6B 4MEZA 4O0PA 5E2EA 5FI6A 2E8JA 1KE0A 3MZDA 3NDGA 1I2WA 2L4RA 4Y2FA 2Y2OA 4P6ZS 3C4OA 4BL3A 4FSFA 2DCFA 3ZDJA 2JKGA 3N7WA 4M3KA 3IH8A 4K91A 1YMSA 5AQ9A 2IWCA 2JKFA 2VK3A 1ODVA 3MQOA 4PM9A 2JKTM 2PDRA 1V9ZA 3FPWA 4K08A 4HIAA 3FKWA 2QJ5A 5CGWA 3LIDA 4HBTA 2A49A 1FR1A 3JYIA 4ETXA 3C7UA 3O88A 3O86A 5JYOA 4M4XA 2WKQA 1L2SA 4R3BA 4ETZA 1KDWA 3ZFZA 3ZVTA 4FH4A 1I2SA 1HZOA 4CLCC 1YLTA 4X56A 5CEBA 2EX9A 5KIZA 4OOLA 4ESPA 1EI5A 1TDLA 3N8LA 1VETA 3SH8A 1PRQA 1WYBA 3B42A 5GHZA 2ZC4B 5FDHA 3BFCA 4I3JA 3OPHA 3SH7A 3BY9A 1OJGA 3C30A 5FQIA 5DKLA 5FATA 3HREA 4KZ8A 3S7OA 2ZC5B 2XSSA 1MY8A 2W3EA 3ZG5A 1FCMA 3BWLA 1PW1A 4DJ2A 2V1ZA 5TBMA 4Y0TA 5EOEA 3UE6A 4Q0IA 3RFBA 5AVFA 2JC7A 4BWIA 3KSIA 3N8SA 5IHVA 1ZHHB 2PD8A 4GD8A 5KSHA 4S2JA 3KYQA 3F1PB 3DBAA 5EFWA 4ARZA 3D4FA 3IQAA 2XEPA 1O07A 3H9WA 5GLCA 4EQ1A 1TDGA 4DKIA 2FZ0A 1ERMA 1BZAA 2JN7A 1XFNA 1YPRA 1PIOA 1BTLA 2ZLYA 3KYZA 2DNSA 1XA1A 2XRNA 3MBZA 4E04A 1SCWA 3JVVA 3SW1A 5A91A 1CJFA 3EEAA 4UEYA 4PKYG 2OLUA 3E2LA 3T4SA 1K56D 1YQSA 4EQIA 4RYEA 2KDKA 3RH8B 4X68A 1S66L 1DRMA 3RXWA 3BRMA 3G31A 3CG5A 4G3WA 4NG2A 1RGZA 2OAP1 2ZMAA 4C6YA 5KZHA 2WK0A 4LENA 5FQJA 4OQIA 4P6ZM 3GQZA 3PBOA 4ME4A 2H0TA 1YSQA 2J3WA 4MN7A 1FILA 4EBLA 3G4PA 4D2OA 1J3WA 2JE5A 3G34A 2WKPA 4L9GA 3NJAA 4OOMA 2ZMFA 1GHPA 3NCKA 3BJNA 1RP5A 3QP5A 3KYEA 1S4SA 2FFYA 2CC1A 1N9OA 3CMZA 1V9YA 2VEAA 4EETB 2M1CA 3OPRA 4HH2A 2L0WA 3M2KA 5HPFA 5FQ9A 4KQRA 3Q07A 4S2NC 2I9VA 3EQUA 2WAEA 3T4LA 1IYQA 3PTEA 2ZL1A 4LCMA 3HVFA 3KSHA 3LR0A 2VV6A 4B4XA 5A93A 3UDFA 1BLPA 3NIAA 1ZG4A 3NBLA 1CQAA 2B18A 2VKSA 3MS6A 3T4OA 4QB8A 4JGRA 2V0UA 5L10A 4QHCA 1Y28A 3MXSA 3UN7A 1N9BA 1EW0A 3C7VA 1ERQA 4GZBA 2KLIA 3RJUA 3CHWP 5EUAA 1VETB 3MR0A 2R78A 3VOZA 4KG5A 3MQ0A 4GLQA 2IWDA 2WKIA 5E2FA 1EWZA 2W3DA 1ONHA 3U2AA 3G6OA 4AFIA 3NC8A 4U3TA 1P9RA 4NETA 3C4PA 4BBTA 4NXBA 3TW8A 3NECA 4Y17A 1C3BA 2R9WA 3A0VA 5TBMB 3UB9A 1LL5A 4KG2A 3ZVWA 2Q9NA 4Q0JA 2D01A 1CI8A 3S1YA 1BLHA 1VHMA 2J8YA 2VV7A 1L0FA 3FZCA 1S1ZA 5HL6A 1TD5A 1OT9A 1K4EA 2HPBA 2V2FF 1ZTUA 1ES5A 4LFUA 3VP0A 4GNUA 4ARZB 1OTAA 5AJGA 5DF7A 1JVJA 2B5RA 1P97A 2J3TC 2EX2A 1YM1A 3H7WA 4LV2A 4WL9A 5EM0A 3IWQA 2VX8A 3D72A 3GSGA 2ZOHA 4XT2A 4EBPA 3MFDA 3OPPA 1MKMA 4LLOB 3MZEA 4CLCD 5HW3A 3R7WA 1VEUA 2ZOIA 5FQKA 3VOLA 2V0WA 3IS2A 4ZRRA 3V5MA 4DXCA 2PR5A 2WGVA 3TSGA 1XJ6A 3MQQA 1NRFA 1VQQA 5A8BA 3VE4A 2M7VA 4UA7A 1X0OA 1HVBA 4NKPA 4L9EA 4R70A 4HJ6A 3IF6C 3K2NA 3IT9A 3JVUA 1W8YA 1T19A 4LGWA 3G35A 1PI4A 4RQ9A 4WELA 3PBRA 1JWPA 1NJ4A 2OWHA 3DTMA 1F5MA 4HJ3A 2BLSA 3NOUC 5CGSA 1YLJA 5CGXA 1P9WA 3EGDC 1K54C 5CERA 1IYSA 1T1AA 3GECA 1FIKA 1VB6A 1G28A 3V39A 4QPRA 1ALQA 1G6AA 4LRYC 3A3FA 3DTIA 2Y8HA 3HJKA 1QMEA 3UPPA 5FL3A 4N9KA 1A0KA 4HY8A 2BTFP 1UWPX 4OKPA 2ZL1B 2A3UA 3UNWA 5CTMA 5CHUA 4KUKA 1L3LA 3P01A 2HGVA 3A3JA 3GDIA 1IKGA 3LUQA 4EUZA 4DDYA 2K31A 2DMWA 1JTDA 5TGFA 3UE0A 4P85A 1MWUA 3FKVA 3S7QA 3QP1A 1LI9A 2IA2A 1JNUA 4PKYA 4JF4A 3CUEC 5EVIC 4FH2A 3S7NA 4XUXA 5TFQA 2Y4AA 4QD4A 2VZWA 3HLWA 4R0QA 3E98A 3EQVA 3HJIA 4WBGA 3LEQA 4R23A 5FAOA 5HWTA 4FD8A 5C5KA 3M6BA 2O9BA 2O99A 3EOIA 2W3HA 5DTTA 2EFUA 4MMNA 1IOUA 3VP2A 4F3LA 1K55C 3PHYA 3OCLA 1IYPA 2K2NA 1TS0A 2EA9A 3NY4A 4HJ4A 4QJGA 1IEMA 3ZGAB 3A0RA 2P08A 2JBFA 3IXGA 2P74A 5M1AA 5M18A 3MSHA 1OJ5A 4BL2A 5HDDA 3DAVA 2OV5A 5FA7A 4L9FA 5AQ7A 2EX6A 3UE3A 1E4DA 3C38A 5HDSA 3MKFA 4IVIA 2A2LA 3IXDA 3HL9A 3H7WB 4WLAA 2Q0OA 3C2WA 5G4ZA 4CPKA 4XT2B 4KUOA 5DFXA 1SDNA 4X1MA 4DE2A 1S6RA 1VEUB 4U0TA 4HQAA 4S2MA 4DN0A 2X71A 4EWFA 3IX8A 3IS2B 4Z9QA 3D9YA 4HP9A 5HAIA 4DJ3A 3WS1A 4NEED 1KGFA 2BASA 5MC7A 1BLCA 1DP9A 3MMHA 2H5SA 4JGPA 4OLDA 4Z1WA 2ZQDA 5HAPA 1S0WA 2W3GA 5IT5A 5E2GA 2YKHA 1G5UA 1S4RA 5CHJA 4UHUA 4JXSA 2QWSA 2XLNA 3WS5A 1NLYA 1TVFA 4KQQA 1H3QA 3BFEA 3IF6A 1Z6FA 5CEDA 2I72A 4C3QA 1SKFA 4Y13A 4I3IA 1E25A 3T4TA 4UQIS 3K3DA 4C75A 2DRWA 1LSXA 2W1RA 1O7EA 3T4JA 2WKRA 4R4SA 3G30A 4YOFA 1K54A 1PYYA 1W79A 3BLSA 3E0YA 3ZQ5A 3UB6A 5J4EA 4F94A 5L07A 4E3LA 4UA6A 3EWKA 3EEHA 2ZQCA 3LIEA 3B33A 5FI2A 1LT0A
chains in the Genus database with same CATH topology
4RVAA 2Y2PA 5U47A 5A92A 4MLLA 2FFFB 3P09A 1I5QA 3DWKA 3BFDA 4QB8A 4OPZA 1PZOA 5F83A 3HLDA 4QHCA 3CZDA 1GA0A 2WYXA 2XR0A 3M6HA 2EX8A 1XP4A 3QHYA 4OPRA 3WS2A 2WGWB 5I94A 1M6KA 3MXSA 4R4RA 3ZG8B 2QPNA 2XH9A 3UN7A 5BOHA 4OPQA 4JPMA 5GLAA 1N9BA 4E3KA 4E6WA 1M40A 1NZOA 4GKUA 5A90A 1CEFA 1OMEA 4OP8A 3PBTA 3C7VA 1ERQA 1PW8A 3M2JA 3AGEA 4GZBA 4OOYA 2XGNA 2ZC7A 3LY3A 1XKZA 5EE8A 3LO7A 3VSLA 4PM6A 1H8ZA 4S2PA 1ONGA 3RJUA 4OLGA 3TOIA 3A3IA 4X69A 2ZM0A 4UA9A 5EUAA 3VFHA 4DF6A 5HAQA 4O7DA 4BLMA 2ZQ7A 1L0DA 1ESIA 4K0XA 4JXWA 3SS3A 3VOZA 3HLEA 3BM6A 4KG5A 4OQ0A 5CECA 2IWDA 4LV3A 1W5DA 1E3UA 3BECA 2WZZA 2WKIA 1ZG6A 4N1HA 4MNRA 3Q82A 3VSKA 4OPYA 4KZ7A 5E2FA 2XD1A 4XXRA 1EWZA 5EVIA 1WE4A 3N8RA 1ONHA 1DJAA 1JWZA 2BG1A 3PAEA 1SDEA 2XDMA 4N1XA 4LV0A 1AXBA 4NK3A 3NC8A 4U3TA 4P0MA 1NXYA 4JXVA 4RA7A 2G2UA 1NYMA 4NETA 4UAAA 3C4PA 5J8XA 1J9MA 3GR2A 4QY6A 4S2OA 4PMAA 1C3BA 2R9WA 1K6SA 4OP5A 4OVDA 4X6TA 1KE4A 1LL5A 4KG2A 1MBLA 2P9VA 3ZVWA 2E8IA 2Q9NA 3VMAA 4H8RA 2JCHA 4BD0A 4EV4A 4E3MA 3PAGA 2HDQA 4WEJA 1DJCA 4GN2A 1ES3A 1CI8A 3S1YA 1BLHA 1JWVA 2XK1A 4HBUA 1K57A 3Q7VB 1LLBA 1W7FA 2J8YA 1ES4A 5GLDA 3A3DA 4S2LA 3VFFA 1L0FA 4A5RA 3FZCA 1LI0A 3IWOA 1JTGA 4S2NA 3O3VA 2Y2LA 4WEKA 1XA7A 4MBFA 1K55A 3ZHHA 4P6BA 2VGJA 4OQHA 4WZ5C 1K4EA 2HPBA 3UPNA 2XQZA 4L0LA 1W8QA 3BEBA 2XFSA 2V2FF 3RXXA 2GDNA 1ES5A 3WS4A 3VP0A 5DF9A 1SHVA 4GNUA 4IVKA 1YLYA 4MBHA 5DF7A 5KMWA 1JVJA 2B5RA 3ZCZA 1YMXA 1BSGA 2Y91A 2X01A 3ZG9B 3DWZA 4HESA 3VP4A 5F82A 5FI2A 1FSYA 4WMCA 2RL3A 2EX2A 4JKTA 1YM1A 2ZQ8A 1XPBA 2PBYA 4LV2A 1XGIA 1DJBA 2QZ6A 2RCXA 3UO9A 3IWQA 1YLPA 4P87A 4KZBA 5M19A 5EOOA 1N4OA 1XX2A 2XD5A 4JLFA 3GSGA 4ZAMA 5FSRA 4EBPA 3MFDA 3OPPA 3OZHA 3MZEA 3ZNYA 1E3UD 1GA9A 5HW3A 4IBRA 1MKIA 2Y2JA 3IXHA 4KG6A 1PZPA 4PPRA 4S2KA 1K56A 5FQKA 3BYDA 2WKEA 1DY6A 3V3RA 1BT5A 3SS4A 2HDRA 3MZFA 1MXOA 4KZ3A 4PM7A 2UWXA 4U0XA 2J9PA 3V5MA 4DXCA 2J7VA 5E2HA 2OLVA 2J9OA 3A3EA 3UPOA 2WGVA 5CRFA 3AGDA 3TSGA 2ZJ9A 5L2FA 1NRFA 2WGIA 1K4FA 4WZ4A 1VQQA 5HX9A 2C5WB 4OONA 2Q9MA 3Q1FA 1XGJA 4UA7A 4QU3A 2Z2MB 1HVBA 3LY4A 1U60A 3W8KA 3IF6C 3BFFA 3IHAA 4JF6A 3TG9A 4BD1A 3CJMA 4ZDXA 3IT9A 2Y2QA 5G18A 5FAPA 1W8YA 1ESUA 4YINA 3G35A 4ZTKA 1PI4A 4WELA 1QMFA 4Y0OA 4E3OA 3PBRA 1JWPA 5FI7A 1NJ4A 4N92A 3DTMA 2X02A 3SH9A 1FSWA 2Y2MA 2ZC6B 3WS0A 1MWRA 2BLSA 5CXWA 2HP9A 1GCEA 1PWCA 5CGSA 1BUEA 2Y2GA 2ZQ9A 4MEZA 1YLJA 5CGXA 4LV1A 3W4PA 1K54C 3IF6B 5E2EA 5FI6A 4ZJ3A 1IYSA 2HDUA 5CERA 1KE0A 3MZDA 1L0EA 4K0WA 4E3NA 3NDGA 1I2WA 4DDSA 2R9XA 5DTKA 3V39A 1HTZA 1ALQA 2Y2OA 4GB7A 4WMCD 3C4OA 4BL3A 4FSFA 1G6AA 1WYCA 2DCFA 3A3FA 3ZDJA 4ZJ2A 3N7WA 1QMEA 4M3KA 3IH8A 3UPPA 2PU4A 4K91A 1YMSA 5AQ9A 2WZXA 2IWCA 4N9KA 1FOFA 3UDIA 3HUMA 4OKPA 4B4ZA 4PM9A 3BFGA 4IEDA 4DE3A 2A3UA 3UNWA 1BULA 4BQMA 1ZC2A 5CTMA 3QNCA 5CHUA 3FKWA 3GMWA 3OCNA 5CGWA 3PBSA 2WADA 4HBTA 2A49A 3A3JA 1YT4A 2Y2NA 4BJPA 1FR1A 3JYIA 1IKGA 1ES2A 3C7UA 5DF8A 1KE3A 2V20A 3O88A 4EUZA 4DDYA 3O86A 5JYOA 5EECA 1RCJA 3ZG0A 1JTDA 5TGFA 3UE0A 3G2ZA 4P85A 1MWUA 1XXMA 2ZQAA 3ZNTA 5DVAA 1L2SA 4PM5A 4R3BA 3ISGA 1KDWA 3N4IA 3ZFZA 3ZVTA 3FKVA 4DRTA 2WGWA 1MPLA 2WUQA 2Y2HA 4FH4A 1I2SA 1HZOA 2HP5A 4CJNA 3W4QA 1YLTA 4JF5A 4Y7PA 1LI9A 5DTSA 4X56A 1NYYA 4JF4A 5CEBA 3SOIA 5GHXA 2EX9A 5EVIC 4OOLA 4FH2A 1EI5A 1TDLA 4FCFA 3DW0A 4JBFA 1IKIA 4XUXA 4E3IA 4DE1A 4DXBA 3N8LA 1K38A 2ZM8A 3SH8A 1FCOA 1H8YA 1L0GA 1MWSA 1GHMA 1WYBA 5TFQA 3OPLA 5GHZA 1KVMA 2Y4AA 2ZC4B 3BLMA 4QD4A 5FDHA 1EROA 3BFCA 2XF3A 1KGGA 3HLWA 3OPHA 4R0QA 5F1GA 1ZKJA 3EQVA 3IHBA 3HBRA 4R3JA 3SH7A 3WRTA 1PWDA 3MXRA 4WBGA 5CTNA 5F1FA 5EVIB 4R23A 5FAOA 5FQIA 2C6WB 4B88A 5EVID 4FD8A 3ZG7B 5FATA 2OSUA 3M6BA 3LCEA 3HUNA 3HREA 1K57C 4KZ8A 3W4OA 2ZC5B 1KGEA 5DTTA 1BLSA 3NI9A 2EFUA 3VP2A 1MY8A 3ZG5A 1FCMA 1Q2QA 3ITBA 4GD6A 1PW1A 1KDSA 1K55C 1HD8A 1MWTA 2V1ZA 4Y0TA 5AQBA 5EOEA 3OCLA 1IYPA 1NZUA 2P9VB 3S22A 2ZC3B 4XUZA 1PI5A 3NY4A 4OQGA 2G2WA 4QJGA 3WWXA 2EXBA 2JC7A 3HLGA 1IEMA 4S2IA 4WM9A 3N8SA 4X53A 5IHVA 3ZGAB 3Q7VA 5FASA 1GHIA 2JBFA 3IXGA 2P74A 4PM8A 3FWLA 5M1AA 5M18A 1NY0A 1VM1A 3V3SA 4GD8A 4BL2A 4S2JA 5KSHA 4QY5A 3B3XA 2EXAA 2OV5A 5E43A 5FA7A 1PWGA 5GHYA 1YLZA 5AQ7A 4YFMA 1IELA 3AGFA 3G32A 3UY6A 2EX6A 3UE3A 3D4FA 4Y0UA 1E4DA 3IQAA 4N9LA 5HARA 2XEPA 4GOGA 1O07A 3MKFA 5GLCA 1TDGA 1FCNA 3IH9A 4IVIA 3IXDA 3HL9A 2WKHA 3I7JA 1RGYA 4DKIA 3GRJA 1ERMA 1BZAA 5TR7A 2Y59A 4WZ5A 1PIOA 1BTLA 5EPHA 3MKEA 4CPKA 4E6XA 2ZLYA 2DNSA 1XA1A 3QNBA 3WRZA 3GTCA 4MBKA 3UE1A 2Z2LB 3MBZA 1SCWA 3VOYA 5A91A 3IF5A 1SDNA 1CK3A 4DE2A 2OLUA 1Y54A 1S6RA 3E2LA 2H0YA 2PU2A 4U0TA 3FV7A 2HDSA 3S4XA 1K56D 1YQSA 2H10A 4S2MA 1G68A 4EQIA 5JYPA 2X71A 4RYEA 5FAQA 4EWFA 3ITAA 4X68A 1K25A 4Z9QA 5HAIA 3RXWA 1IYOA 1KVLA 5FQMA 4DE0A 3BRMA 3WS1A 3G31A 2Y2IA 3CG5A 3PBQA 3V50A 4E3JA 5AQAA 2QMIA 1KGFA 4ID4A 1BLCA 1H5XA 4KZ6A 1RGZA 3IWIA 4LCLA 2ZMAA 4KENB 2H5SA 4OLDA 4C6YA 5KZHA 3VP1A 2ZQDA 5HAPA 1S0WA 3HLFA 2WK0A 5KSCA 5E2GA 3Q7ZA 4LENA 5FQJA 4OQIA 1CI9A 3Q81A 3IXBA 1CEGA 3LEZA 3HLBA 3GQZA 4UHUA 5CHJA 3PBOA 3UDXA 4JXSA 3FYZA 4JXGA 2H0TA 3HLCA 4GDNA 3VP3A 2XLNA 3WS5A 2Y55A 2VGKA 1TVFA 4KZ9A 2HP6A 4GDBA 4KQQA 1LL9A 4KQOA 4EBLA 3G4PA 4D2OA 4RX3A 5HFOA 2JE5A 3BFEA 3G34A 5CHMA 4OOMA 1FR6A 3G2YA 1GHPA 3NCKA 3IF6A 4ZJ1A 1RP5A 1Z6FA 5GL9A 5CEDA 2I72A 2EFXA 3P98A 4C3QA 1SKFA 3NDEA 1E25A 1Q2PA 2FFYA 1YLWA 2CC1A 2WAFA 3CMZA 2IWBA 4C75A 3SS5A 2DRWA 3E2KA 2Y2KA 3N6IA 4RX2A 4R1GA 1O7EA 3OPRA 5EVLA 3M2KA 1FQGA 3GV9A 4R4SA 4X55A 4IBXA 3G30A 4Q8IA 1K54A 5GLBA 1PYYA 4ZBEA 5FQ9A 5HL1A 2XFTA 1W79A 3BLSA 3GVBA 4KQRA 4WYYA 3Q07A 4S2NC 5D3OA 3EQUA 2WAEA 1IYQA 4OH0A 3PTEA 4LCMA 3HVFA 3HUOA 4F94A 1K6RA 4KZ4A 4KZ5A 5FQQA 4KZAA 4E3LA 4HEFA 4B4XA 5A93A 3O87A 4EBNA 3UDFA 4UA6A 1BLPA 3PBNA 3NIAA 2ZM2A 2ZQCA 4BENA 1TEMA 1ZG4A 3C5AA 3NBLA 3OC2A 1LHYA 2ZD8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RVA A;  2Y2P A;  5U47 A;  5A92 A;  4MLL A;  2FFF B;  3P09 A;  1I5Q A;  3DWK A;  3BFD A;  4QB8 A;  4OPZ A;  1PZO A;  5F83 A;  3HLD A;  4QHC A;  3CZD A;  1GA0 A;  2WYX A;  2XR0 A;  3M6H A;  2EX8 A;  1XP4 A;  3QHY A;  4OPR A;  3WS2 A;  2WGW B;  5I94 A;  1M6K A;  3MXS A;  4R4R A;  3ZG8 B;  2QPN A;  2XH9 A;  3UN7 A;  5BOH A;  4OPQ A;  4JPM A;  5GLA A;  1N9B A;  4E3K A;  4E6W A;  1M40 A;  1NZO A;  4GKU A;  5A90 A;  1CEF A;  1OME A;  4OP8 A;  3PBT A;  3C7V A;  1ERQ A;  1PW8 A;  3M2J A;  3AGE A;  4GZB A;  4OOY A;  2XGN A;  2ZC7 A;  3LY3 A;  1XKZ A;  5EE8 A;  3LO7 A;  3VSL A;  4PM6 A;  1H8Z A;  4S2P A;  1ONG A;  3RJU A;  4OLG A;  3TOI A;  3A3I A;  4X69 A;  2ZM0 A;  4UA9 A;  5EUA A;  3VFH A;  4DF6 A;  5HAQ A;  4O7D A;  4BLM A;  2ZQ7 A;  1L0D A;  1ESI A;  4K0X A;  4JXW A;  3SS3 A;  3VOZ A;  3HLE A;  3BM6 A;  4KG5 A;  4OQ0 A;  5CEC A;  2IWD A;  4LV3 A;  1W5D A;  1E3U A;  3BEC A;  2WZZ A;  2WKI A;  1ZG6 A;  4N1H A;  4MNR A;  3Q82 A;  3VSK A;  4OPY A;  4KZ7 A;  5E2F A;  2XD1 A;  4XXR A;  1EWZ A;  5EVI A;  1WE4 A;  3N8R A;  1ONH A;  1DJA A;  1JWZ A;  2BG1 A;  3PAE A;  1SDE A;  2XDM A;  4N1X A;  4LV0 A;  1AXB A;  4NK3 A;  3NC8 A;  4U3T A;  4P0M A;  1NXY A;  4JXV A;  4RA7 A;  2G2U A;  1NYM A;  4NET A;  4UAA A;  3C4P A;  5J8X A;  1J9M A;  3GR2 A;  4QY6 A;  4S2O A;  4PMA A;  1C3B A;  2R9W A;  1K6S A;  4OP5 A;  4OVD A;  4X6T A;  1KE4 A;  1LL5 A;  4KG2 A;  1MBL A;  2P9V A;  3ZVW A;  2E8I A;  2Q9N A;  3VMA A;  4H8R A;  2JCH A;  4BD0 A;  4EV4 A;  4E3M A;  3PAG A;  2HDQ A;  4WEJ A;  1DJC A;  4GN2 A;  1ES3 A;  1CI8 A;  3S1Y A;  1BLH A;  1JWV A;  2XK1 A;  4HBU A;  1K57 A;  3Q7V B;  1LLB A;  1W7F A;  2J8Y A;  1ES4 A;  5GLD A;  3A3D A;  4S2L A;  3VFF A;  1L0F A;  4A5R A;  3FZC A;  1LI0 A;  3IWO A;  1JTG A;  4S2N A;  3O3V A;  2Y2L A;  4WEK A;  1XA7 A;  4MBF A;  1K55 A;  3ZHH A;  4P6B A;  2VGJ A;  4OQH A;  4WZ5 C;  1K4E A;  2HPB A;  3UPN A;  2XQZ A;  4L0L A;  1W8Q A;  3BEB A;  2XFS A;  2V2F F;  3RXX A;  2GDN A;  1ES5 A;  3WS4 A;  3VP0 A;  5DF9 A;  1SHV A;  4GNU A;  4IVK A;  1YLY A;  4MBH A;  5DF7 A;  5KMW A;  1JVJ A;  2B5R A;  3ZCZ A;  1YMX A;  1BSG A;  2Y91 A;  2X01 A;  3ZG9 B;  3DWZ A;  4HES A;  3VP4 A;  5F82 A;  5FI2 A;  1FSY A;  4WMC A;  2RL3 A;  2EX2 A;  4JKT A;  1YM1 A;  2ZQ8 A;  1XPB A;  2PBY A;  4LV2 A;  1XGI A;  1DJB A;  2QZ6 A;  2RCX A;  3UO9 A;  3IWQ A;  1YLP A;  4P87 A;  4KZB A;  5M19 A;  5EOO A;  1N4O A;  1XX2 A;  2XD5 A;  4JLF A;  3GSG A;  4ZAM A;  5FSR A;  4EBP A;  3MFD A;  3OPP A;  3OZH A;  3MZE A;  3ZNY A;  1E3U D;  1GA9 A;  5HW3 A;  4IBR A;  1MKI A;  2Y2J A;  3IXH A;  4KG6 A;  1PZP A;  4PPR A;  4S2K A;  1K56 A;  5FQK A;  3BYD A;  2WKE A;  1DY6 A;  3V3R A;  1BT5 A;  3SS4 A;  2HDR A;  3MZF A;  1MXO A;  4KZ3 A;  4PM7 A;  2UWX A;  4U0X A;  2J9P A;  3V5M A;  4DXC A;  2J7V A;  5E2H A;  2OLV A;  2J9O A;  3A3E A;  3UPO A;  2WGV A;  5CRF A;  3AGD A;  3TSG A;  2ZJ9 A;  5L2F A;  1NRF A;  2WGI A;  1K4F A;  4WZ4 A;  1VQQ A;  5HX9 A;  2C5W B;  4OON A;  2Q9M A;  3Q1F A;  1XGJ A;  4UA7 A;  4QU3 A;  2Z2M B;  1HVB A;  3LY4 A;  1U60 A;  3W8K A;  3IF6 C;  3BFF A;  3IHA A;  4JF6 A;  3TG9 A;  4BD1 A;  3CJM A;  4ZDX A;  3IT9 A;  2Y2Q A;  5G18 A;  5FAP A;  1W8Y A;  1ESU A;  4YIN A;  3G35 A;  4ZTK A;  1PI4 A;  4WEL A;  1QMF A;  4Y0O A;  4E3O A;  3PBR A;  1JWP A;  5FI7 A;  1NJ4 A;  4N92 A;  3DTM A;  2X02 A;  3SH9 A;  1FSW A;  2Y2M A;  2ZC6 B;  3WS0 A;  1MWR A;  2BLS A;  5CXW A;  2HP9 A;  1GCE A;  1PWC A;  5CGS A;  1BUE A;  2Y2G A;  2ZQ9 A;  4MEZ A;  1YLJ A;  5CGX A;  4LV1 A;  3W4P A;  1K54 C;  3IF6 B;  5E2E A;  5FI6 A;  4ZJ3 A;  1IYS A;  2HDU A;  5CER A;  1KE0 A;  3MZD A;  1L0E A;  4K0W A;  4E3N A;  3NDG A;  1I2W A;  4DDS A;  2R9X A;  5DTK A;  3V39 A;  1HTZ A;  1ALQ A;  2Y2O A;  4GB7 A;  4WMC D;  3C4O A;  4BL3 A;  4FSF A;  1G6A A;  1WYC A;  2DCF A;  3A3F A;  3ZDJ A;  4ZJ2 A;  3N7W A;  1QME A;  4M3K A;  3IH8 A;  3UPP A;  2PU4 A;  4K91 A;  1YMS A;  5AQ9 A;  2WZX A;  2IWC A;  4N9K A;  1FOF A;  3UDI A;  3HUM A;  4OKP A;  4B4Z A;  4PM9 A;  3BFG A;  4IED A;  4DE3 A;  2A3U A;  3UNW A;  1BUL A;  4BQM A;  1ZC2 A;  5CTM A;  3QNC A;  5CHU A;  3FKW A;  3GMW A;  3OCN A;  5CGW A;  3PBS A;  2WAD A;  4HBT A;  2A49 A;  3A3J A;  1YT4 A;  2Y2N A;  4BJP A;  1FR1 A;  3JYI A;  1IKG A;  1ES2 A;  3C7U A;  5DF8 A;  1KE3 A;  2V20 A;  3O88 A;  4EUZ A;  4DDY A;  3O86 A;  5JYO A;  5EEC A;  1RCJ A;  3ZG0 A;  1JTD A;  5TGF A;  3UE0 A;  3G2Z A;  4P85 A;  1MWU A;  1XXM A;  2ZQA A;  3ZNT A;  5DVA A;  1L2S A;  4PM5 A;  4R3B A;  3ISG A;  1KDW A;  3N4I A;  3ZFZ A;  3ZVT A;  3FKV A;  4DRT A;  2WGW A;  1MPL A;  2WUQ A;  2Y2H A;  4FH4 A;  1I2S A;  1HZO A;  2HP5 A;  4CJN A;  3W4Q A;  1YLT A;  4JF5 A;  4Y7P A;  1LI9 A;  5DTS A;  4X56 A;  1NYY A;  4JF4 A;  5CEB A;  3SOI A;  5GHX A;  2EX9 A;  5EVI C;  4OOL A;  4FH2 A;  1EI5 A;  1TDL A;  4FCF A;  3DW0 A;  4JBF A;  1IKI A;  4XUX A;  4E3I A;  4DE1 A;  4DXB A;  3N8L A;  1K38 A;  2ZM8 A;  3SH8 A;  1FCO A;  1H8Y A;  1L0G A;  1MWS A;  1GHM A;  1WYB A;  5TFQ A;  3OPL A;  5GHZ A;  1KVM A;  2Y4A A;  2ZC4 B;  3BLM A;  4QD4 A;  5FDH A;  1ERO A;  3BFC A;  2XF3 A;  1KGG A;  3HLW A;  3OPH A;  4R0Q A;  5F1G A;  1ZKJ A;  3EQV A;  3IHB A;  3HBR A;  4R3J A;  3SH7 A;  3WRT A;  1PWD A;  3MXR A;  4WBG A;  5CTN A;  5F1F A;  5EVI B;  4R23 A;  5FAO A;  5FQI A;  2C6W B;  4B88 A;  5EVI D;  4FD8 A;  3ZG7 B;  5FAT A;  2OSU A;  3M6B A;  3LCE A;  3HUN A;  3HRE A;  1K57 C;  4KZ8 A;  3W4O A;  2ZC5 B;  1KGE A;  5DTT A;  1BLS A;  3NI9 A;  2EFU A;  3VP2 A;  1MY8 A;  3ZG5 A;  1FCM A;  1Q2Q A;  3ITB A;  4GD6 A;  1PW1 A;  1KDS A;  1K55 C;  1HD8 A;  1MWT A;  2V1Z A;  4Y0T A;  5AQB A;  5EOE A;  3OCL A;  1IYP A;  1NZU A;  2P9V B;  3S22 A;  2ZC3 B;  4XUZ A;  1PI5 A;  3NY4 A;  4OQG A;  2G2W A;  4QJG A;  3WWX A;  2EXB A;  2JC7 A;  3HLG A;  1IEM A;  4S2I A;  4WM9 A;  3N8S A;  4X53 A;  5IHV A;  3ZGA B;  3Q7V A;  5FAS A;  1GHI A;  2JBF A;  3IXG A;  2P74 A;  4PM8 A;  3FWL A;  5M1A A;  5M18 A;  1NY0 A;  1VM1 A;  3V3S A;  4GD8 A;  4BL2 A;  4S2J A;  5KSH A;  4QY5 A;  3B3X A;  2EXA A;  2OV5 A;  5E43 A;  5FA7 A;  1PWG A;  5GHY A;  1YLZ A;  5AQ7 A;  4YFM A;  1IEL A;  3AGF A;  3G32 A;  3UY6 A;  2EX6 A;  3UE3 A;  3D4F A;  4Y0U A;  1E4D A;  3IQA A;  4N9L A;  5HAR A;  2XEP A;  4GOG A;  1O07 A;  3MKF A;  5GLC A;  1TDG A;  1FCN A;  3IH9 A;  4IVI A;  3IXD A;  3HL9 A;  2WKH A;  3I7J A;  1RGY A;  4DKI A;  3GRJ A;  1ERM A;  1BZA A;  5TR7 A;  2Y59 A;  4WZ5 A;  1PIO A;  1BTL A;  5EPH A;  3MKE A;  4CPK A;  4E6X A;  2ZLY A;  2DNS A;  1XA1 A;  3QNB A;  3WRZ A;  3GTC A;  4MBK A;  3UE1 A;  2Z2L B;  3MBZ A;  1SCW A;  3VOY A;  5A91 A;  3IF5 A;  1SDN A;  1CK3 A;  4DE2 A;  2OLU A;  1Y54 A;  1S6R A;  3E2L A;  2H0Y A;  2PU2 A;  4U0T A;  3FV7 A;  2HDS A;  3S4X A;  1K56 D;  1YQS A;  2H10 A;  4S2M A;  1G68 A;  4EQI A;  5JYP A;  2X71 A;  4RYE A;  5FAQ A;  4EWF A;  3ITA A;  4X68 A;  1K25 A;  4Z9Q A;  5HAI A;  3RXW A;  1IYO A;  1KVL A;  5FQM A;  4DE0 A;  3BRM A;  3WS1 A;  3G31 A;  2Y2I A;  3CG5 A;  3PBQ A;  3V50 A;  4E3J A;  5AQA A;  2QMI A;  1KGF A;  4ID4 A;  1BLC A;  1H5X A;  4KZ6 A;  1RGZ A;  3IWI A;  4LCL A;  2ZMA A;  4KEN B;  2H5S A;  4OLD A;  4C6Y A;  5KZH A;  3VP1 A;  2ZQD A;  5HAP A;  1S0W A;  3HLF A;  2WK0 A;  5KSC A;  5E2G A;  3Q7Z A;  4LEN A;  5FQJ A;  4OQI A;  1CI9 A;  3Q81 A;  3IXB A;  1CEG A;  3LEZ A;  3HLB A;  3GQZ A;  4UHU A;  5CHJ A;  3PBO A;  3UDX A;  4JXS A;  3FYZ A;  4JXG A;  2H0T A;  3HLC A;  4GDN A;  3VP3 A;  2XLN A;  3WS5 A;  2Y55 A;  2VGK A;  1TVF A;  4KZ9 A;  2HP6 A;  4GDB A;  4KQQ A;  1LL9 A;  4KQO A;  4EBL A;  3G4P A;  4D2O A;  4RX3 A;  5HFO A;  2JE5 A;  3BFE A;  3G34 A;  5CHM A;  4OOM A;  1FR6 A;  3G2Y A;  1GHP A;  3NCK A;  3IF6 A;  4ZJ1 A;  1RP5 A;  1Z6F A;  5GL9 A;  5CED A;  2I72 A;  2EFX A;  3P98 A;  4C3Q A;  1SKF A;  3NDE A;  1E25 A;  1Q2P A;  2FFY A;  1YLW A;  2CC1 A;  2WAF A;  3CMZ A;  2IWB A;  4C75 A;  3SS5 A;  2DRW A;  3E2K A;  2Y2K A;  3N6I A;  4RX2 A;  4R1G A;  1O7E A;  3OPR A;  5EVL A;  3M2K A;  1FQG A;  3GV9 A;  4R4S A;  4X55 A;  4IBX A;  3G30 A;  4Q8I A;  1K54 A;  5GLB A;  1PYY A;  4ZBE A;  5FQ9 A;  5HL1 A;  2XFT A;  1W79 A;  3BLS A;  3GVB A;  4KQR A;  4WYY A;  3Q07 A;  4S2N C;  5D3O A;  3EQU A;  2WAE A;  1IYQ A;  4OH0 A;  3PTE A;  4LCM A;  3HVF A;  3HUO A;  4F94 A;  1K6R A;  4KZ4 A;  4KZ5 A;  5FQQ A;  4KZA A;  4E3L A;  4HEF A;  4B4X A;  5A93 A;  3O87 A;  4EBN A;  3UDF A;  4UA6 A;  1BLP A;  3PBN A;  3NIA A;  2ZM2 A;  2ZQC A;  4BEN A;  1TEM A;  1ZG4 A;  3C5A A;  3NBL A;  3OC2 A;  1LHY A;  2ZD8 A; 
#chains in the Genus database with same CATH topology
 1LL8 A;  5A92 A;  1YSP A;  2FFF B;  3P09 A;  3TJZ C;  3MJQ A;  3CZD A;  2WYX A;  2XR0 A;  2EX8 A;  1XP4 A;  3WS2 A;  5I94 A;  5BOH A;  4R4R A;  2QPN A;  2QKP A;  2XH9 A;  3NOP C;  1NZO A;  1OME A;  3PBT A;  3M2J A;  4OOY A;  2XGN A;  2VGL M;  2ZC7 A;  1XKZ A;  3LY3 A;  5EE8 A;  1OPX A;  5K5B A;  4OLG A;  3A3I A;  2ZM0 A;  5HAQ A;  3UB5 P;  3LIC A;  1L0D A;  4K0X A;  3BQA A;  4LV3 A;  1W5D A;  3BEC A;  1ZG6 A;  3CUE A;  4XXR A;  2V1B A;  5EVI A;  1WE4 A;  3N8R A;  3PAE A;  2PD7 A;  5L09 A;  3P7N A;  4P0M A;  1NXY A;  4GS9 A;  4UAA A;  5L8M A;  3IX4 A;  1J9M A;  4BMW A;  4F3L B;  1K6S A;  4OVD A;  1H0M A;  1KE4 A;  2P9V A;  2E8I A;  3VMA A;  2NUP C;  4BD0 A;  4GN2 A;  1NLZ A;  2XK1 A;  1W7F A;  4S2L A;  4A5R A;  1LI0 A;  3IWO A;  1JTG A;  4JGO A;  4WEK A;  1XA7 A;  1K55 A;  4P6B A;  2VGJ A;  4WZ5 C;  4O8G A;  3UPN A;  4L0L A;  1CF0 A;  2V8C A;  3RXX A;  2GDN A;  4IUH A;  3WS4 A;  3W2Z A;  5KMW A;  3ZCZ A;  1BSG A;  2W1T A;  2Y91 A;  1FSY A;  2RL3 A;  4X1L A;  4JKT A;  2ZQ8 A;  3BW6 A;  4KZB A;  5EOO A;  1N4O A;  4JLF A;  1GA9 A;  4IBR A;  1MKI A;  3IXH A;  4KG6 A;  3F1O A;  3BYD A;  2WKE A;  1BT5 A;  2HDR A;  1MXO A;  4MDZ A;  3NOT C;  2J7V A;  3A3E A;  2J9O A;  5CRF A;  1S67 L;  2ZJ9 A;  4IUK A;  5HSQ A;  5J3W A;  4OON A;  2Q9M A;  4QU3 A;  1ACF A;  3LY4 A;  1U60 A;  5IU1 A;  3IHA A;  4BD1 A;  3CJM A;  5FAP A;  4UQI M;  2JKR I;  4DMZ A;  1TS8 A;  2XRO A;  4N92 A;  2X02 A;  3SH9 A;  5I5L A;  1MWR A;  5CXW A;  3CWF A;  4G3V A;  1S1Y A;  2Y2G A;  2ZQ9 A;  3LGO A;  4LV1 A;  3IF6 B;  4ZJ3 A;  2JHE A;  2EWW A;  1L0E A;  4K0W A;  4E3N A;  4Q0H A;  4DDS A;  3LIF A;  5DTK A;  1HTZ A;  4FTX A;  1WYC A;  3T1X A;  2PU4 A;  1WA9 A;  2WZX A;  3MF0 A;  5J7E A;  3UDI A;  4EEU A;  4IED A;  4DE3 A;  1BUL A;  1ZC2 A;  3QNC A;  2Z6C A;  3GMW A;  3HCY A;  3OCN A;  3PBS A;  1F98 A;  3R4K A;  3V67 A;  1KE3 A;  2V20 A;  3QP2 A;  5EEC A;  2NUT C;  3ZG0 A;  2J80 A;  2ZQA A;  5DVA A;  4WUJ A;  3ISG A;  1H8M A;  3N4I A;  3L7H A;  1MPL A;  4CJN A;  2HP5 A;  4JF5 A;  1XJ3 A;  1NYY A;  1F9I A;  3SOI A;  5GHX A;  4FCF A;  4E3I A;  4JBF A;  4DE1 A;  1K38 A;  2ZM8 A;  3CLO A;  1FCO A;  1H8Y A;  1MWS A;  3NHQ A;  2HV1 A;  1KVM A;  3B47 A;  3BLM A;  1ERO A;  3FG8 A;  5F1G A;  1D7E A;  3IBJ A;  1ZKJ A;  3IHB A;  2YKF A;  3WRT A;  1PWD A;  3MXR A;  5CTN A;  5F1F A;  3CIT A;  5EVI B;  2C6W B;  3LYX A;  5HWV A;  1GSW A;  1K57 C;  4GS9 B;  1Q2Q A;  4GD6 A;  1HD8 A;  1MWT A;  5AQB A;  4NXG A;  3TE8 A;  2P9V B;  3S22 A;  2ZC3 B;  4Y15 A;  4R38 A;  4XUZ A;  2G2W A;  4MN6 A;  5HD3 A;  2EXB A;  2AVX A;  4HHD A;  4S2I A;  4WM9 A;  4X53 A;  5FAS A;  3Q7V A;  1GHI A;  4PM8 A;  1NY0 A;  3OOV A;  4NXF A;  4H6J A;  2MJ6 A;  2EXA A;  3T1R A;  3TRC A;  5E43 A;  1SZV A;  1PWG A;  1MZU A;  5FDS A;  1YLZ A;  4YFM A;  3UY6 A;  1W63 M;  2ZBB A;  5HAR A;  4GOG A;  2W1T B;  3F1N A;  2ACG A;  2GZA A;  5G4Y A;  2EWV A;  3GRJ A;  5TR7 A;  2Y59 A;  5EVE A;  4WZ5 A;  2OAQ 1;  2HZ5 A;  4E6X A;  3MKE A;  3ZYT A;  3QNB A;  3UB8 A;  3GTC A;  3UE1 A;  2Z2L B;  3E4O A;  2O9A A;  1XFQ A;  1NRJ A;  2Z6D A;  1CK3 A;  4GW9 A;  1Y54 A;  4JGQ A;  2HDS A;  3F1O B;  2H10 A;  5JYP A;  2JKR M;  5FAQ A;  3ITA A;  3C8C A;  1K25 A;  4HOI A;  5FQM A;  4WN5 A;  3PBQ A;  3V50 A;  2QMI A;  3UMD A;  3VP1 A;  5KSC A;  3Q7Z A;  5DFY A;  2VJW A;  1CEG A;  3HLB A;  3UDX A;  4JXG A;  3HLC A;  2Y79 A;  2Y55 A;  4GDB A;  1LL9 A;  3IX3 A;  4KQO A;  1G6O A;  5CHM A;  3G2Y A;  4ZJ1 A;  1N9L A;  3D3O A;  2EFX A;  3P98 A;  3NDE A;  1OTE A;  2WAF A;  2W0N A;  4Y3I A;  2IWB A;  3SS5 A;  3E2K A;  3N6I A;  4R1G A;  5EVL A;  1FQG A;  3GV9 A;  2XA7 S;  4BBU A;  4Q8I A;  4ZBE A;  5F68 A;  5D3O A;  4WYY A;  3KX0 X;  3HUO A;  4KZ4 A;  4HEF A;  4EBN A;  3T4Q A;  2ZM2 A;  4BEN A;  3C5A A;  2VA0 A;  3OC2 A;  5U47 A;  2GNX A;  3EGX C;  4MLL A;  1I5Q A;  1PZO A;  3HLD A;  2ZMV A;  1GA0 A;  3M6H A;  3QHY A;  1M6K A;  3LIB A;  5GLA A;  1DP6 A;  1XJ2 A;  1PW8 A;  1SKO A;  3VSL A;  4PM6 A;  4S2P A;  1ONG A;  5DJU A;  4EES A;  3LIA A;  4X69 A;  4BLM A;  2ZQ7 A;  4X25 A;  1ESI A;  4JXW A;  3HLE A;  5CEC A;  3LFV A;  4YWZ A;  3CAX A;  5LBR A;  3R7W B;  3Q82 A;  4KZ7 A;  4LRZ E;  1JWZ A;  1SDE A;  4LV0 A;  1AXB A;  3QP4 A;  4NK3 A;  4R6L A;  5AVE A;  2G2U A;  5J8X A;  1LSW A;  4QY6 A;  2LB9 A;  4PMA A;  5FEG A;  4OP5 A;  5DKK A;  4X6T A;  4O01 A;  4H8R A;  2JCH A;  3ULF A;  5EM1 A;  2W27 A;  4EV4 A;  2HDQ A;  1DJC A;  1ES3 A;  4Y5F A;  1JWV A;  1OTI A;  1K57 A;  3Q7V B;  1LLB A;  5GLD A;  4QWO A;  2OWJ A;  4H6J B;  5IS1 A;  3O3V A;  2Y2L A;  3MXQ A;  1OTB A;  4OQH A;  3RTY A;  2O9C A;  3IBR A;  1W8Q A;  2XFS A;  1T1C A;  2LB5 A;  1SHV A;  1W63 Q;  3FC7 A;  1YLY A;  4YNR A;  3NUL A;  5TJJ A;  3F1N B;  4II7 A;  2X01 A;  3ZG9 B;  4HES A;  4WMC A;  2PAV P;  3PYP A;  1XPB A;  2PBY A;  2QZ6 A;  5M19 A;  1GSX A;  2XD5 A;  2QHK A;  3OZH A;  2B95 A;  1K0K A;  1PZP A;  2J3T D;  4PPR A;  4S2K A;  4I39 A;  1K56 A;  2PYP A;  1DY6 A;  3V3R A;  3SS4 A;  4KZ3 A;  4PM7 A;  4PHT A;  4U0X A;  1NWZ A;  2OLV A;  4I38 A;  3UPO A;  3KSF A;  2A24 A;  3T12 B;  2WGI A;  4HNB A;  1XGJ A;  2Z2M B;  3BFF A;  4ZDX A;  2HJE A;  1TS6 A;  4YIN A;  4WF0 A;  1QMF A;  3WS0 A;  2XA7 M;  2HP9 A;  1GCE A;  1PWC A;  1BUE A;  3OBF A;  4FOF A;  3W4P A;  4EXO A;  5HD5 A;  2HDU A;  5HWW A;  2H28 A;  2P04 A;  2R9X A;  4EEP A;  2PT7 A;  4GB7 A;  4WMC D;  1BYW A;  4ZJ2 A;  1YAX A;  3QP8 A;  3H82 A;  1FOF A;  3HUM A;  4FUW A;  4B4Z A;  3BFG A;  2UV0 E;  5FEF A;  3ICY A;  4BQM A;  4LPZ A;  1OTD A;  2WAD A;  1YT4 A;  1Y4O A;  2Y2N A;  3T1Q B;  4BJP A;  1ES2 A;  5DF8 A;  4HI4 A;  4BBV A;  3T50 A;  3MFX A;  1RCJ A;  3G2Z A;  1XXM A;  3ZNT A;  4PM5 A;  4DRT A;  2VV8 A;  2WGW A;  2WUQ A;  2Y2H A;  3KO6 A;  3W4Q A;  3LR5 A;  4Y7P A;  3BQ8 A;  5DTS A;  4GJ4 A;  3OLO A;  1SKO B;  1KOU A;  3O5Y A;  3DW0 A;  1IKI A;  4DXB A;  5F69 A;  1L0G A;  2M7U A;  1GHM A;  3JPU A;  3OPL A;  1T18 A;  4CQH A;  4GHI A;  2D02 A;  2XF3 A;  1KGG A;  4R3J A;  3HBR A;  5DJT A;  2P7J A;  5EV0 A;  4B88 A;  5EVI D;  3ZG7 B;  2OSU A;  3LCE A;  3HUN A;  3W4O A;  1KGE A;  1BLS A;  3NI9 A;  3E4P A;  3ITB A;  1KDS A;  1NZU A;  1T1B A;  2QYB A;  1PI5 A;  4OQG A;  4PAU A;  1PFL A;  3WWX A;  1YKD A;  3HLG A;  3T1S A;  3PXP A;  2V8F A;  4NXE A;  3DTK A;  3FWL A;  1VM1 A;  3V3S A;  1AWI A;  4QY5 A;  3B3X A;  4IJG A;  1D1J A;  5GHY A;  2OOL A;  1IEL A;  3AGF A;  3G32 A;  4Y0U A;  3U4L P;  4N9L A;  2PRF A;  4KQD A;  4EUV A;  1FCN A;  3IH9 A;  2WKH A;  1P0Z A;  1RGY A;  3I7J A;  4EU0 A;  2PHY A;  5EPH A;  3WRZ A;  3CPT A;  4MBK A;  3VOY A;  4CLC A;  1Z09 A;  3IF5 A;  2H0Y A;  2PU2 A;  3FV7 A;  3S4X A;  3LR3 A;  1G68 A;  1IYO A;  1OT6 A;  5HPI A;  1KVL A;  4DE0 A;  2Y2I A;  4G3K A;  1LSV A;  5AQA A;  2A24 B;  4E3J A;  4ID4 A;  1H5X A;  4KZ6 A;  3IWI A;  4LCL A;  4KEN B;  3HLF A;  4B9O A;  3A0S A;  1CI9 A;  3Q81 A;  3IXB A;  3VV4 A;  3LEZ A;  2KOI A;  3FYZ A;  4GDN A;  3VP3 A;  5HZH A;  2VGK A;  4KZ9 A;  4HH3 A;  2HP6 A;  4I5S A;  4RX3 A;  5HFO A;  1FR6 A;  2V1A A;  3FPV A;  5GL9 A;  3L9K A;  1UGU A;  1Q2P A;  1YLW A;  1PNE A;  2Y2K A;  4RX2 A;  1F2K A;  4X55 A;  4IBX A;  3H82 B;  4D60 A;  5GLB A;  5HL1 A;  3KSG A;  1UWN X;  2XFT A;  3GVB A;  4HP4 A;  4OH0 A;  2VLG A;  1K6R A;  4KZ5 A;  5FQQ A;  4KZA A;  2L1M A;  3O87 A;  1TF1 A;  2K7S A;  3PBN A;  1TEM A;  1LHY A;  2ZD8 A;  4LRX C;  3T4K A;  3VE3 A;  4RVA A;  2Y2P A;  3UME A;  2W3F A;  3DWK A;  4MN5 A;  3BFD A;  4OPZ A;  2JKT I;  3LI9 A;  5F83 A;  4IHQ A;  4OPR A;  2WGW B;  3ZG8 B;  4OPQ A;  4JPM A;  4E3K A;  4E6W A;  1M40 A;  5CX7 A;  4GKU A;  5A90 A;  1CEF A;  4OP8 A;  3S7P A;  3AGE A;  4EER A;  3LO7 A;  1H8Z A;  2PYR A;  2HJ9 C;  3TOI A;  3VFH A;  4DF6 A;  4UA9 A;  4O7D A;  2KX6 A;  3SZT A;  3SS3 A;  4R3A A;  5F6A A;  3BM6 A;  4OQ0 A;  2PR6 A;  4GHI B;  1E3U A;  2WZZ A;  2FH5 A;  4N1H A;  4MNR A;  1XJ4 A;  3VSK A;  4OPY A;  1STZ A;  3BY8 A;  2XD1 A;  1DJA A;  2BG1 A;  2XDM A;  4N1X A;  4RA7 A;  4JXV A;  1HLU P;  1NYM A;  2GX5 A;  3GR2 A;  3CI6 A;  3E4Q A;  4S2O A;  1D06 A;  1MBL A;  2G7U A;  4CLC E;  4E3M A;  3LR4 A;  4I3A A;  3PAG A;  4WEJ A;  4HBU A;  1ES4 A;  2HF6 A;  3A3D A;  3VFF A;  3LI8 A;  4S2N A;  3ZHH A;  4MBF A;  1GSV A;  2XQZ A;  3F1P A;  3BEB A;  3UB7 A;  4EW7 A;  5DF9 A;  4IVK A;  4MBH A;  1YMX A;  2V9A A;  3DWZ A;  3VP4 A;  5F82 A;  2B02 A;  1XGI A;  1DJB A;  2RCX A;  5HDC A;  3UO9 A;  1YLP A;  2GJ3 A;  3PR6 A;  4P87 A;  3CPT B;  1XX2 A;  4ZAM A;  5FSR A;  1N9N A;  3ZNY A;  4CLC B;  1E3U D;  3QP6 A;  2Y2J A;  3K3C A;  4MCW A;  1MC0 A;  3MZF A;  2VGL S;  2CMN A;  2UWX A;  2J9P A;  5E2H A;  2O0Y A;  5F5Y A;  3AGD A;  5L2F A;  4WZ4 A;  1K4F A;  5HX9 A;  2C5W B;  3Q1F A;  1TS7 A;  3W8K A;  4B93 A;  1IFQ A;  4JF6 A;  3TG9 A;  2PBD P;  2QJ7 A;  2Y2Q A;  5G18 A;  1ESU A;  4GCZ A;  4ZTK A;  2INW A;  4Y0O A;  4E3O A;  5FI7 A;  1DP8 A;  3DTE A;  1FSW A;  2Y2M A;  2ZC6 B;  4MEZ A;  4O0P A;  5E2E A;  5FI6 A;  2E8J A;  1KE0 A;  3MZD A;  3NDG A;  1I2W A;  2L4R A;  4Y2F A;  2Y2O A;  4P6Z S;  3C4O A;  4BL3 A;  4FSF A;  2DCF A;  3ZDJ A;  2JKG A;  3N7W A;  4M3K A;  3IH8 A;  4K91 A;  1YMS A;  5AQ9 A;  2IWC A;  2JKF A;  2VK3 A;  1ODV A;  3MQO A;  4PM9 A;  2JKT M;  2PDR A;  1V9Z A;  3FPW A;  4K08 A;  4HIA A;  3FKW A;  2QJ5 A;  5CGW A;  3LID A;  4HBT A;  2A49 A;  1FR1 A;  3JYI A;  4ETX A;  3C7U A;  3O88 A;  3O86 A;  5JYO A;  4M4X A;  2WKQ A;  1L2S A;  4R3B A;  4ETZ A;  1KDW A;  3ZFZ A;  3ZVT A;  4FH4 A;  1I2S A;  1HZO A;  4CLC C;  1YLT A;  4X56 A;  5CEB A;  2EX9 A;  5KIZ A;  4OOL A;  4ESP A;  1EI5 A;  1TDL A;  3N8L A;  1VET A;  3SH8 A;  1PRQ A;  1WYB A;  3B42 A;  5GHZ A;  2ZC4 B;  5FDH A;  3BFC A;  4I3J A;  3OPH A;  3SH7 A;  3BY9 A;  1OJG A;  3C30 A;  5FQI A;  5DKL A;  5FAT A;  3HRE A;  4KZ8 A;  3S7O A;  2ZC5 B;  2XSS A;  1MY8 A;  2W3E A;  3ZG5 A;  1FCM A;  3BWL A;  1PW1 A;  4DJ2 A;  2V1Z A;  5TBM A;  4Y0T A;  5EOE A;  3UE6 A;  4Q0I A;  3RFB A;  5AVF A;  2JC7 A;  4BWI A;  3KSI A;  3N8S A;  5IHV A;  1ZHH B;  2PD8 A;  4GD8 A;  5KSH A;  4S2J A;  3KYQ A;  3F1P B;  3DBA A;  5EFW A;  4ARZ A;  3D4F A;  3IQA A;  2XEP A;  1O07 A;  3H9W A;  5GLC A;  4EQ1 A;  1TDG A;  4DKI A;  2FZ0 A;  1ERM A;  1BZA A;  2JN7 A;  1XFN A;  1YPR A;  1PIO A;  1BTL A;  2ZLY A;  3KYZ A;  2DNS A;  1XA1 A;  2XRN A;  3MBZ A;  4E04 A;  1SCW A;  3JVV A;  3SW1 A;  5A91 A;  1CJF A;  3EEA A;  4UEY A;  4PKY G;  2OLU A;  3E2L A;  3T4S A;  1K56 D;  1YQS A;  4EQI A;  4RYE A;  2KDK A;  3RH8 B;  4X68 A;  1S66 L;  1DRM A;  3RXW A;  3BRM A;  3G31 A;  3CG5 A;  4G3W A;  4NG2 A;  1RGZ A;  2OAP 1;  2ZMA A;  4C6Y A;  5KZH A;  2WK0 A;  4LEN A;  5FQJ A;  4OQI A;  4P6Z M;  3GQZ A;  3PBO A;  4ME4 A;  2H0T A;  1YSQ A;  2J3W A;  4MN7 A;  1FIL A;  4EBL A;  3G4P A;  4D2O A;  1J3W A;  2JE5 A;  3G34 A;  2WKP A;  4L9G A;  3NJA A;  4OOM A;  2ZMF A;  1GHP A;  3NCK A;  3BJN A;  1RP5 A;  3QP5 A;  3KYE A;  1S4S A;  2FFY A;  2CC1 A;  1N9O A;  3CMZ A;  1V9Y A;  2VEA A;  4EET B;  2M1C A;  3OPR A;  4HH2 A;  2L0W A;  3M2K A;  5HPF A;  5FQ9 A;  4KQR A;  3Q07 A;  4S2N C;  2I9V A;  3EQU A;  2WAE A;  3T4L A;  1IYQ A;  3PTE A;  2ZL1 A;  4LCM A;  3HVF A;  3KSH A;  3LR0 A;  2VV6 A;  4B4X A;  5A93 A;  3UDF A;  1BLP A;  3NIA A;  1ZG4 A;  3NBL A;  1CQA A;  2B18 A;  2VKS A;  3MS6 A;  3T4O A;  4QB8 A;  4JGR A;  2V0U A;  5L10 A;  4QHC A;  1Y28 A;  3MXS A;  3UN7 A;  1N9B A;  1EW0 A;  3C7V A;  1ERQ A;  4GZB A;  2KLI A;  3RJU A;  3CHW P;  5EUA A;  1VET B;  3MR0 A;  2R78 A;  3VOZ A;  4KG5 A;  3MQ0 A;  4GLQ A;  2IWD A;  2WKI A;  5E2F A;  1EWZ A;  2W3D A;  1ONH A;  3U2A A;  3G6O A;  4AFI A;  3NC8 A;  4U3T A;  1P9R A;  4NET A;  3C4P A;  4BBT A;  4NXB A;  3TW8 A;  3NEC A;  4Y17 A;  1C3B A;  2R9W A;  3A0V A;  5TBM B;  3UB9 A;  1LL5 A;  4KG2 A;  3ZVW A;  2Q9N A;  4Q0J A;  2D01 A;  1CI8 A;  3S1Y A;  1BLH A;  1VHM A;  2J8Y A;  2VV7 A;  1L0F A;  3FZC A;  1S1Z A;  5HL6 A;  1TD5 A;  1OT9 A;  1K4E A;  2HPB A;  2V2F F;  1ZTU A;  1ES5 A;  4LFU A;  3VP0 A;  4GNU A;  4ARZ B;  1OTA A;  5AJG A;  5DF7 A;  1JVJ A;  2B5R A;  1P97 A;  2J3T C;  2EX2 A;  1YM1 A;  3H7W A;  4LV2 A;  4WL9 A;  5EM0 A;  3IWQ A;  2VX8 A;  3D72 A;  3GSG A;  2ZOH A;  4XT2 A;  4EBP A;  3MFD A;  3OPP A;  1MKM A;  4LLO B;  3MZE A;  4CLC D;  5HW3 A;  3R7W A;  1VEU A;  2ZOI A;  5FQK A;  3VOL A;  2V0W A;  3IS2 A;  4ZRR A;  3V5M A;  4DXC A;  2PR5 A;  2WGV A;  3TSG A;  1XJ6 A;  3MQQ A;  1NRF A;  1VQQ A;  5A8B A;  3VE4 A;  2M7V A;  4UA7 A;  1X0O A;  1HVB A;  4NKP A;  4L9E A;  4R70 A;  4HJ6 A;  3IF6 C;  3K2N A;  3IT9 A;  3JVU A;  1W8Y A;  1T19 A;  4LGW A;  3G35 A;  1PI4 A;  4RQ9 A;  4WEL A;  3PBR A;  1JWP A;  1NJ4 A;  2OWH A;  3DTM A;  1F5M A;  4HJ3 A;  2BLS A;  3NOU C;  5CGS A;  1YLJ A;  5CGX A;  1P9W A;  3EGD C;  1K54 C;  5CER A;  1IYS A;  1T1A A;  3GEC A;  1FIK A;  1VB6 A;  1G28 A;  3V39 A;  4QPR A;  1ALQ A;  1G6A A;  4LRY C;  3A3F A;  3DTI A;  2Y8H A;  3HJK A;  1QME A;  3UPP A;  5FL3 A;  4N9K A;  1A0K A;  4HY8 A;  2BTF P;  1UWP X;  4OKP A;  2ZL1 B;  2A3U A;  3UNW A;  5CTM A;  5CHU A;  4KUK A;  1L3L A;  3P01 A;  2HGV A;  3A3J A;  3GDI A;  1IKG A;  3LUQ A;  4EUZ A;  4DDY A;  2K31 A;  2DMW A;  1JTD A;  5TGF A;  3UE0 A;  4P85 A;  1MWU A;  3FKV A;  3S7Q A;  3QP1 A;  1LI9 A;  2IA2 A;  1JNU A;  4PKY A;  4JF4 A;  3CUE C;  5EVI C;  4FH2 A;  3S7N A;  4XUX A;  5TFQ A;  2Y4A A;  4QD4 A;  2VZW A;  3HLW A;  4R0Q A;  3E98 A;  3EQV A;  3HJI A;  4WBG A;  3LEQ A;  4R23 A;  5FAO A;  5HWT A;  4FD8 A;  5C5K A;  3M6B A;  2O9B A;  2O99 A;  3EOI A;  2W3H A;  5DTT A;  2EFU A;  4MMN A;  1IOU A;  3VP2 A;  4F3L A;  1K55 C;  3PHY A;  3OCL A;  1IYP A;  2K2N A;  1TS0 A;  2EA9 A;  3NY4 A;  4HJ4 A;  4QJG A;  1IEM A;  3ZGA B;  3A0R A;  2P08 A;  2JBF A;  3IXG A;  2P74 A;  5M1A A;  5M18 A;  3MSH A;  1OJ5 A;  4BL2 A;  5HDD A;  3DAV A;  2OV5 A;  5FA7 A;  4L9F A;  5AQ7 A;  2EX6 A;  3UE3 A;  1E4D A;  3C38 A;  5HDS A;  3MKF A;  4IVI A;  2A2L A;  3IXD A;  3HL9 A;  3H7W B;  4WLA A;  2Q0O A;  3C2W A;  5G4Z A;  4CPK A;  4XT2 B;  4KUO A;  5DFX A;  1SDN A;  4X1M A;  4DE2 A;  1S6R A;  1VEU B;  4U0T A;  4HQA A;  4S2M A;  4DN0 A;  2X71 A;  4EWF A;  3IX8 A;  3IS2 B;  4Z9Q A;  3D9Y A;  4HP9 A;  5HAI A;  4DJ3 A;  3WS1 A;  4NEE D;  1KGF A;  2BAS A;  5MC7 A;  1BLC A;  1DP9 A;  3MMH A;  2H5S A;  4JGP A;  4OLD A;  4Z1W A;  2ZQD A;  5HAP A;  1S0W A;  2W3G A;  5IT5 A;  5E2G A;  2YKH A;  1G5U A;  1S4R A;  5CHJ A;  4UHU A;  4JXS A;  2QWS A;  2XLN A;  3WS5 A;  1NLY A;  1TVF A;  4KQQ A;  1H3Q A;  3BFE A;  3IF6 A;  1Z6F A;  5CED A;  2I72 A;  4C3Q A;  1SKF A;  4Y13 A;  4I3I A;  1E25 A;  3T4T A;  4UQI S;  3K3D A;  4C75 A;  2DRW A;  1LSX A;  2W1R A;  1O7E A;  3T4J A;  2WKR A;  4R4S A;  3G30 A;  4YOF A;  1K54 A;  1PYY A;  1W79 A;  3BLS A;  3E0Y A;  3ZQ5 A;  3UB6 A;  5J4E A;  4F94 A;  5L07 A;  4E3L A;  4UA6 A;  3EWK A;  3EEH A;  2ZQC A;  3LIE A;  3B33 A;  5FI2 A;  1LT0 A; 
#chains in the Genus database with same CATH homology
 4RVA A;  2Y2P A;  5U47 A;  5A92 A;  4MLL A;  2FFF B;  3P09 A;  1I5Q A;  3DWK A;  3BFD A;  4QB8 A;  4OPZ A;  1PZO A;  5F83 A;  3HLD A;  4QHC A;  3CZD A;  1GA0 A;  2WYX A;  2XR0 A;  3M6H A;  2EX8 A;  1XP4 A;  3QHY A;  4OPR A;  3WS2 A;  2WGW B;  5I94 A;  1M6K A;  3MXS A;  4R4R A;  3ZG8 B;  2QPN A;  2XH9 A;  3UN7 A;  5BOH A;  4OPQ A;  4JPM A;  5GLA A;  1N9B A;  4E3K A;  4E6W A;  1M40 A;  1NZO A;  4GKU A;  5A90 A;  1CEF A;  1OME A;  4OP8 A;  3PBT A;  3C7V A;  1ERQ A;  1PW8 A;  3M2J A;  3AGE A;  4GZB A;  4OOY A;  2XGN A;  2ZC7 A;  3LY3 A;  1XKZ A;  5EE8 A;  3LO7 A;  3VSL A;  4PM6 A;  1H8Z A;  4S2P A;  1ONG A;  3RJU A;  4OLG A;  3TOI A;  3A3I A;  4X69 A;  2ZM0 A;  4UA9 A;  5EUA A;  3VFH A;  4DF6 A;  5HAQ A;  4O7D A;  4BLM A;  2ZQ7 A;  1L0D A;  1ESI A;  4K0X A;  4JXW A;  3SS3 A;  3VOZ A;  3HLE A;  3BM6 A;  4KG5 A;  4OQ0 A;  5CEC A;  2IWD A;  4LV3 A;  1W5D A;  1E3U A;  3BEC A;  2WZZ A;  2WKI A;  1ZG6 A;  4N1H A;  4MNR A;  3Q82 A;  3VSK A;  4OPY A;  4KZ7 A;  5E2F A;  2XD1 A;  4XXR A;  1EWZ A;  5EVI A;  1WE4 A;  3N8R A;  1ONH A;  1DJA A;  1JWZ A;  2BG1 A;  3PAE A;  1SDE A;  2XDM A;  4N1X A;  4LV0 A;  1AXB A;  4NK3 A;  3NC8 A;  4U3T A;  4P0M A;  1NXY A;  4JXV A;  4RA7 A;  2G2U A;  1NYM A;  4NET A;  4UAA A;  3C4P A;  5J8X A;  1J9M A;  3GR2 A;  4QY6 A;  4S2O A;  4PMA A;  1C3B A;  2R9W A;  1K6S A;  4OP5 A;  4OVD A;  4X6T A;  1KE4 A;  1LL5 A;  4KG2 A;  1MBL A;  2P9V A;  3ZVW A;  2E8I A;  2Q9N A;  3VMA A;  4H8R A;  2JCH A;  4BD0 A;  4EV4 A;  4E3M A;  3PAG A;  2HDQ A;  4WEJ A;  1DJC A;  4GN2 A;  1ES3 A;  1CI8 A;  3S1Y A;  1BLH A;  1JWV A;  2XK1 A;  4HBU A;  1K57 A;  3Q7V B;  1LLB A;  1W7F A;  2J8Y A;  1ES4 A;  5GLD A;  3A3D A;  4S2L A;  3VFF A;  1L0F A;  4A5R A;  3FZC A;  1LI0 A;  3IWO A;  1JTG A;  4S2N A;  3O3V A;  2Y2L A;  4WEK A;  1XA7 A;  4MBF A;  1K55 A;  3ZHH A;  4P6B A;  2VGJ A;  4OQH A;  4WZ5 C;  1K4E A;  2HPB A;  3UPN A;  2XQZ A;  4L0L A;  1W8Q A;  3BEB A;  2XFS A;  2V2F F;  3RXX A;  2GDN A;  1ES5 A;  3WS4 A;  3VP0 A;  5DF9 A;  1SHV A;  4GNU A;  4IVK A;  1YLY A;  4MBH A;  5DF7 A;  5KMW A;  1JVJ A;  2B5R A;  3ZCZ A;  1YMX A;  1BSG A;  2Y91 A;  2X01 A;  3ZG9 B;  3DWZ A;  4HES A;  3VP4 A;  5F82 A;  5FI2 A;  1FSY A;  4WMC A;  2RL3 A;  2EX2 A;  4JKT A;  1YM1 A;  2ZQ8 A;  1XPB A;  2PBY A;  4LV2 A;  1XGI A;  1DJB A;  2QZ6 A;  2RCX A;  3UO9 A;  3IWQ A;  1YLP A;  4P87 A;  4KZB A;  5M19 A;  5EOO A;  1N4O A;  1XX2 A;  2XD5 A;  4JLF A;  3GSG A;  4ZAM A;  5FSR A;  4EBP A;  3MFD A;  3OPP A;  3OZH A;  3MZE A;  3ZNY A;  1E3U D;  1GA9 A;  5HW3 A;  4IBR A;  1MKI A;  2Y2J A;  3IXH A;  4KG6 A;  1PZP A;  4PPR A;  4S2K A;  1K56 A;  5FQK A;  3BYD A;  2WKE A;  1DY6 A;  3V3R A;  1BT5 A;  3SS4 A;  2HDR A;  3MZF A;  1MXO A;  4KZ3 A;  4PM7 A;  2UWX A;  4U0X A;  2J9P A;  3V5M A;  4DXC A;  2J7V A;  5E2H A;  2OLV A;  2J9O A;  3A3E A;  3UPO A;  2WGV A;  5CRF A;  3AGD A;  3TSG A;  2ZJ9 A;  5L2F A;  1NRF A;  2WGI A;  1K4F A;  4WZ4 A;  1VQQ A;  5HX9 A;  2C5W B;  4OON A;  2Q9M A;  3Q1F A;  1XGJ A;  4UA7 A;  4QU3 A;  2Z2M B;  1HVB A;  3LY4 A;  1U60 A;  3W8K A;  3IF6 C;  3BFF A;  3IHA A;  4JF6 A;  3TG9 A;  4BD1 A;  3CJM A;  4ZDX A;  3IT9 A;  2Y2Q A;  5G18 A;  5FAP A;  1W8Y A;  1ESU A;  4YIN A;  3G35 A;  4ZTK A;  1PI4 A;  4WEL A;  1QMF A;  4Y0O A;  4E3O A;  3PBR A;  1JWP A;  5FI7 A;  1NJ4 A;  4N92 A;  3DTM A;  2X02 A;  3SH9 A;  1FSW A;  2Y2M A;  2ZC6 B;  3WS0 A;  1MWR A;  2BLS A;  5CXW A;  2HP9 A;  1GCE A;  1PWC A;  5CGS A;  1BUE A;  2Y2G A;  2ZQ9 A;  4MEZ A;  1YLJ A;  5CGX A;  4LV1 A;  3W4P A;  1K54 C;  3IF6 B;  5E2E A;  5FI6 A;  4ZJ3 A;  1IYS A;  2HDU A;  5CER A;  1KE0 A;  3MZD A;  1L0E A;  4K0W A;  4E3N A;  3NDG A;  1I2W A;  4DDS A;  2R9X A;  5DTK A;  3V39 A;  1HTZ A;  1ALQ A;  2Y2O A;  4GB7 A;  4WMC D;  3C4O A;  4BL3 A;  4FSF A;  1G6A A;  1WYC A;  2DCF A;  3A3F A;  3ZDJ A;  4ZJ2 A;  3N7W A;  1QME A;  4M3K A;  3IH8 A;  3UPP A;  2PU4 A;  4K91 A;  1YMS A;  5AQ9 A;  2WZX A;  2IWC A;  4N9K A;  1FOF A;  3UDI A;  3HUM A;  4OKP A;  4B4Z A;  4PM9 A;  3BFG A;  4IED A;  4DE3 A;  2A3U A;  3UNW A;  1BUL A;  4BQM A;  1ZC2 A;  5CTM A;  3QNC A;  5CHU A;  3FKW A;  3GMW A;  3OCN A;  5CGW A;  3PBS A;  2WAD A;  4HBT A;  2A49 A;  3A3J A;  1YT4 A;  2Y2N A;  4BJP A;  1FR1 A;  3JYI A;  1IKG A;  1ES2 A;  3C7U A;  5DF8 A;  1KE3 A;  2V20 A;  3O88 A;  4EUZ A;  4DDY A;  3O86 A;  5JYO A;  5EEC A;  1RCJ A;  3ZG0 A;  1JTD A;  5TGF A;  3UE0 A;  3G2Z A;  4P85 A;  1MWU A;  1XXM A;  2ZQA A;  3ZNT A;  5DVA A;  1L2S A;  4PM5 A;  4R3B A;  3ISG A;  1KDW A;  3N4I A;  3ZFZ A;  3ZVT A;  3FKV A;  4DRT A;  2WGW A;  1MPL A;  2WUQ A;  2Y2H A;  4FH4 A;  1I2S A;  1HZO A;  2HP5 A;  4CJN A;  3W4Q A;  1YLT A;  4JF5 A;  4Y7P A;  1LI9 A;  5DTS A;  4X56 A;  1NYY A;  4JF4 A;  5CEB A;  3SOI A;  5GHX A;  2EX9 A;  5EVI C;  4OOL A;  4FH2 A;  1EI5 A;  1TDL A;  4FCF A;  3DW0 A;  4JBF A;  1IKI A;  4XUX A;  4E3I A;  4DE1 A;  4DXB A;  3N8L A;  1K38 A;  2ZM8 A;  3SH8 A;  1FCO A;  1H8Y A;  1L0G A;  1MWS A;  1GHM A;  1WYB A;  5TFQ A;  3OPL A;  5GHZ A;  1KVM A;  2Y4A A;  2ZC4 B;  3BLM A;  4QD4 A;  5FDH A;  1ERO A;  3BFC A;  2XF3 A;  1KGG A;  3HLW A;  3OPH A;  4R0Q A;  5F1G A;  1ZKJ A;  3EQV A;  3IHB A;  3HBR A;  4R3J A;  3SH7 A;  3WRT A;  1PWD A;  3MXR A;  4WBG A;  5CTN A;  5F1F A;  5EVI B;  4R23 A;  5FAO A;  5FQI A;  2C6W B;  4B88 A;  5EVI D;  4FD8 A;  3ZG7 B;  5FAT A;  2OSU A;  3M6B A;  3LCE A;  3HUN A;  3HRE A;  1K57 C;  4KZ8 A;  3W4O A;  2ZC5 B;  1KGE A;  5DTT A;  1BLS A;  3NI9 A;  2EFU A;  3VP2 A;  1MY8 A;  3ZG5 A;  1FCM A;  1Q2Q A;  3ITB A;  4GD6 A;  1PW1 A;  1KDS A;  1K55 C;  1HD8 A;  1MWT A;  2V1Z A;  4Y0T A;  5AQB A;  5EOE A;  3OCL A;  1IYP A;  1NZU A;  2P9V B;  3S22 A;  2ZC3 B;  4XUZ A;  1PI5 A;  3NY4 A;  4OQG A;  2G2W A;  4QJG A;  3WWX A;  2EXB A;  2JC7 A;  3HLG A;  1IEM A;  4S2I A;  4WM9 A;  3N8S A;  4X53 A;  5IHV A;  3ZGA B;  3Q7V A;  5FAS A;  1GHI A;  2JBF A;  3IXG A;  2P74 A;  4PM8 A;  3FWL A;  5M1A A;  5M18 A;  1NY0 A;  1VM1 A;  3V3S A;  4GD8 A;  4BL2 A;  4S2J A;  5KSH A;  4QY5 A;  3B3X A;  2EXA A;  2OV5 A;  5E43 A;  5FA7 A;  1PWG A;  5GHY A;  1YLZ A;  5AQ7 A;  4YFM A;  1IEL A;  3AGF A;  3G32 A;  3UY6 A;  2EX6 A;  3UE3 A;  3D4F A;  4Y0U A;  1E4D A;  3IQA A;  4N9L A;  5HAR A;  2XEP A;  4GOG A;  1O07 A;  3MKF A;  5GLC A;  1TDG A;  1FCN A;  3IH9 A;  4IVI A;  3IXD A;  3HL9 A;  2WKH A;  3I7J A;  1RGY A;  4DKI A;  3GRJ A;  1ERM A;  1BZA A;  5TR7 A;  2Y59 A;  4WZ5 A;  1PIO A;  1BTL A;  5EPH A;  3MKE A;  4CPK A;  4E6X A;  2ZLY A;  2DNS A;  1XA1 A;  3QNB A;  3WRZ A;  3GTC A;  4MBK A;  3UE1 A;  2Z2L B;  3MBZ A;  1SCW A;  3VOY A;  5A91 A;  3IF5 A;  1SDN A;  1CK3 A;  4DE2 A;  2OLU A;  1Y54 A;  1S6R A;  3E2L A;  2H0Y A;  2PU2 A;  4U0T A;  3FV7 A;  2HDS A;  3S4X A;  1K56 D;  1YQS A;  2H10 A;  4S2M A;  1G68 A;  4EQI A;  5JYP A;  2X71 A;  4RYE A;  5FAQ A;  4EWF A;  3ITA A;  4X68 A;  1K25 A;  4Z9Q A;  5HAI A;  3RXW A;  1IYO A;  1KVL A;  5FQM A;  4DE0 A;  3BRM A;  3WS1 A;  3G31 A;  2Y2I A;  3CG5 A;  3PBQ A;  3V50 A;  4E3J A;  5AQA A;  2QMI A;  1KGF A;  4ID4 A;  1BLC A;  1H5X A;  4KZ6 A;  1RGZ A;  3IWI A;  4LCL A;  2ZMA A;  4KEN B;  2H5S A;  4OLD A;  4C6Y A;  5KZH A;  3VP1 A;  2ZQD A;  5HAP A;  1S0W A;  3HLF A;  2WK0 A;  5KSC A;  5E2G A;  3Q7Z A;  4LEN A;  5FQJ A;  4OQI A;  1CI9 A;  3Q81 A;  3IXB A;  1CEG A;  3LEZ A;  3HLB A;  3GQZ A;  4UHU A;  5CHJ A;  3PBO A;  3UDX A;  4JXS A;  3FYZ A;  4JXG A;  2H0T A;  3HLC A;  4GDN A;  3VP3 A;  2XLN A;  3WS5 A;  2Y55 A;  2VGK A;  1TVF A;  4KZ9 A;  2HP6 A;  4GDB A;  4KQQ A;  1LL9 A;  4KQO A;  4EBL A;  3G4P A;  4D2O A;  4RX3 A;  5HFO A;  2JE5 A;  3BFE A;  3G34 A;  5CHM A;  4OOM A;  1FR6 A;  3G2Y A;  1GHP A;  3NCK A;  3IF6 A;  4ZJ1 A;  1RP5 A;  1Z6F A;  5GL9 A;  5CED A;  2I72 A;  2EFX A;  3P98 A;  4C3Q A;  1SKF A;  3NDE A;  1E25 A;  1Q2P A;  2FFY A;  1YLW A;  2CC1 A;  2WAF A;  3CMZ A;  2IWB A;  4C75 A;  3SS5 A;  2DRW A;  3E2K A;  2Y2K A;  3N6I A;  4RX2 A;  4R1G A;  1O7E A;  3OPR A;  5EVL A;  3M2K A;  1FQG A;  3GV9 A;  4R4S A;  4X55 A;  4IBX A;  3G30 A;  4Q8I A;  1K54 A;  5GLB A;  1PYY A;  4ZBE A;  5FQ9 A;  5HL1 A;  2XFT A;  1W79 A;  3BLS A;  3GVB A;  4KQR A;  4WYY A;  3Q07 A;  4S2N C;  5D3O A;  3EQU A;  2WAE A;  1IYQ A;  4OH0 A;  3PTE A;  4LCM A;  3HVF A;  3HUO A;  4F94 A;  1K6R A;  4KZ4 A;  4KZ5 A;  5FQQ A;  4KZA A;  4E3L A;  4HEF A;  4B4X A;  5A93 A;  3O87 A;  4EBN A;  3UDF A;  4UA6 A;  1BLP A;  3PBN A;  3NIA A;  2ZM2 A;  2ZQC A;  4BEN A;  1TEM A;  1ZG4 A;  3C5A A;  3NBL A;  3OC2 A;  1LHY A;  2ZD8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...