1G28A

Structure of a flavin-binding domain, lov2, from the chimeric phytochrome/phototropin photoreceptor phy3
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
104
structure length
104
Chain Sequence
KSFVITDPRLPDNPIIFASDRFLELTEYTREEVLGNNCRFLQGRGTDRKAVQLIRDAVKEQRDVTVQVLNYTKGGRAFWNLFHLQVMRDENGDVQYFIGVQQEM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PHY3 PROTEIN
publication title Structure of a flavin-binding plant photoreceptor domain: insights into light-mediated signal transduction
pubmed doi rcsb
source organism Adiantum capillus-veneris
molecule tags Signaling protein, electron transport
total genus 29
structure length 104
sequence length 104
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-10-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1g28A00
4WLAA 2PYPA 5HWTA 1BYWA 3T50A 2JHEA 2W27A 4GW9A 3CLOA 4HJ6A 4GHIA 4L9FA 5F5YA 2L4RA 3VE3A 4RQ9A 3F1PA 3A0VA 3UB9A 2BASA 5HDCA 2QJ7A 1XJ4A 4YWZA 1TS6A 4EEPA 4JGQA 3B33A 1XFNA 3F1NA 2J80A 2VV6A 4LLOB 1S67L 5F69A 2WKPA 3NHQA 5DJTA 2CMNA 4L9EA 4DJ3A 1DP9A 4BBTA 2L1MA 4EESA 4XT2B 4JGOA 3MXQA 3MR0A 4GS9A 1GSXA 1T19A 2V1AA 2PD8A 4NXFA 1P0ZA 4L9GA 3H7WB 1T1BA 2ZOIA 4PKYA 5HDDA 3KX0X 2GJ3A 3LIDA 4H6JB 4BBUA 4WUJA 1N9NA 3OLOA 2OWJA 1S4RA 4GHIB 4HJ4A 4HQAA 4LRXC 3F1OA 3F1PB 4MN5A 4EQ1A 2VV7A 4I3IA 5J4EA 2I9VA 3H82A 3F1NB 1OTAA 3BWLA 2VLGA 1T18A 3RTYA 4HH2A 1V9YA 1X0OA 2QJ5A 4NXGA 3D72A 4WF0A 3A0RA 1GSWA 1OTBA 1S1YA 1UGUA 2V0UA 4K08A 5G4YA 4F3LA 4R6LA 2OWHA 2L0WA 3GDIA 4MN6A 4HIAA 3LIAA 4HNBA 3H9WA 2A24A 3UB7A 2WKRA 4KUOA 2PDRA 5DKLA 3PYPA 4DJ2A 1DP8A 1LT0A 1T1AA 5AVEA 3C2WA 4LRZE 4BBVA 2QWSA 1EW0A 3BY8A 3IS2A 1MZUA 4EW7A 1TS0A 3NOTC 4WN5A 3F1OB 1OT9A 3FC7A 1D7EA 2V1BA 4M4XA 4I5SA 1N9LA 5HWWA 3LIBA 3H82B 3CWFA 1JNUA 3HJKA 2ZOHA 3MJQA 5KIZA 3E4OA 5J3WA 3K3CA 3MQQA 1S4SA 4JGRA 1OTDA 1ODVA 1DRMA 3MFXA 4R38A 1F9IA 3UE6A 2M1CA 1T1CA 5A8BA 1TS7A 3LICA 5F68A 1OT6A 1DP6A 3LI8A 1XFQA 5HZHA 2VEAA 1XJ6A 1TS8A 1KOUA 1VB6A 4HI4A 4XT2A 3LUQA 4EETB 1XJ3A 3IBRA 5I5LA 2PR6A 4HJ3A 1OJGA 3UMDA 3EEHA 3HJIA 3IS2B 1OTIA 5AVFA 3GECA 3SW1A 1LSVA 2WKQA 4H6JA 3MQOA 5TBMA 4GS9B 3ICYA 3EWKA 2P7JA 3RH8B 3PHYA 3E4PA 5HD3A 2QHKA 2PYRA 2Z6DA 4EERA 2D02A 5IU1A 4JGPA 1LSXA 1F98A 5DJUA 1V9ZA 2OOLA 2KDKA 1LSWA 1UWPX 2ZBBA 3LYXA 1OJ5A 3UMEA 4E04A 4PKYG 4HOIA 5HWVA 1XJ2A 3UB6A 3BY9A 3ULFA 3P7NA 4HHDA 4KUKA 3LIFA 2EA9A 2K7SA 1UWNX 5IS1A 3CAXA 2KX6A 2HV1A 4HH3A 1GSVA 3LIEA 1LL8A 2PHYA 2INWA 2R78A 1D06A 4GCZA 4B9OA 2PR5A 3NJAA 4NXBA 2YKFA 4EXOA 4WL9A 2D01A 2H28A 5HDSA 2QKPA 4NXEA 3VOLA 2PD7A 4HY8A 4I38A 3A0SA 2JN7A 4LPZA 2VV8A 1P97A 1WA9A 3K3DA 4I3JA 4HP9A 2W0NA 3C8CA 5J7EA 4F3LB 3E4QA 3NOUC 2YKHA 1S1ZA 5TBMB 1Y28A 2A24B 5F6AA 3ZQ5A 3LI9A 5HSQA 4I39A 1OTEA 2B02A 4I3AA 4LRYC 5G4ZA 1NWZA 3NOPC 2Z6CA 1G28A 4R70A 4KQDA 4R3AA 4EEUA 5EFWA 4HP4A 1N9OA 3VE4A 3H7WA 1S66L 2V9AA 3G6OA 5DKKA 2V0WA 5HD5A 3UB8A 3FG8A
chains in the Genus database with same CATH superfamily
1KE4A 2PYPA 5HWTA 4IBXA 4Z9QA 5FAPA 3C4OA 2H0YA 1KE3A 2Y2OA 1YSPA 4GW9A 1GA9A 4ZJ3A 2V2FF 4DN0A 4ETZA 3EEAA 4GHIA 4NG2A 1HTZA 4PM7A 5FQMA 4C75A 3GQZA 5F5YA 1BSGA 3BFCA 1W8YA 4O7DA 4WEJA 2BASA 3PBOA 5EVEA 3OOVA 5CEBA 4BWIA 5C5KA 3G31A 3B33A 1IYSA 4LGWA 3F1NA 3QP8A 2Z2MB 1D1JA 2IA2A 2GDNA 4IUKA 3PAGA 4LLOB 4P6BA 4S2LA 1S67L 2M7UA 3G30A 3IX8A 1LI0A 4JF5A 3W4QA 1HVBA 3LR0A 1DP9A 3EGDC 3T4JA 4XT2B 4Y5FA 3IXGA 4ZDXA 3PBSA 1FOFA 2HGVA 4KG5A 2W1RA 1L2SA 1GSXA 2V1ZA 3M2KA 4UQIS 1GA0A 3RXWA 2PD8A 1J9MA 4NXFA 4U0XA 2QMIA 4PM6A 1NYMA 3WS4A 1PZOA 5M19A 5HDDA 3MBZA 4WMCA 2Y2QA 3T4QA 4MEZA 5HL6A 5FQQA 4HBTA 4PM9A 3BYDA 1GHPA 5FQ9A 4JF6A 1YKDA 4D60A 1K6SA 1NZUA 2P08A 1FQGA 3MMHA 4LV1A 3F1OA 3F1PB 3VOYA 2XFSA 5FDSA 2UWXA 2H0TA 2HPBA 4KQRA 1DJAA 3V39A 2I9VA 2FFYA 4HBUA 1FR1A 4KQOA 4CLCC 3A3IA 3DAVA 2QZ6A 3FPVA 4IUHA 3SZTA 4QY6A 2V8FA 2QJ5A 3T1RA 1S6RA 3IH9A 3IF6B 5KSCA 1SDNA 2Y2LA 2J7VA 2AVXA 4WF0A 3A0RA 4LENA 1GSWA 4QD4A 1OTBA 2OV5A 4BL2A 4OQ0A 3NDGA 3Q82A 5LBRA 3KSGA 3C7UA 4WBGA 1G68A 1PW8A 4WEKA 2J3TC 2A24A 3BFGA 5L09A 1PFLA 1IFQA 1XA7A 2O99A 1KGGA 5I94A 5DKLA 2X71A 2HP6A 1LT0A 2ZQ8A 2EFUA 4WELA 3Q81A 1Q2PA 3BJNA 1Y54A 1E3UD 3BECA 3IS2A 2ZQDA 5EVID 4EW7A 2XD5A 4X69A 1NYYA 1QMFA 4R0QA 3ZFZA 1VM1A 3WWXA 3OPHA 1D7EA 5GLDA 2DRWA 1L0EA 5TR7A 1XPBA 1PZPA 1IOUA 2P04A 4OQGA 4BD0A 4FH2A 3KSFA 5HFOA 3WS5A 4DMZA 3LIBA 1JNUA 4RX2A 2P74A 4L0LA 2H10A 2JC7A 4QU3A 1KGEA 2IWBA 3EQUA 2ZC5B 1S4SA 3N7WA 4R3BA 3CJMA 5CEDA 4JGRA 2W3FA 1ODVA 3V3SA 3SOIA 1F9IA 1MWSA 4KZ9A 1T1CA 1W79A 4EWFA 5GLBA 1OMEA 5A8BA 1CQAA 1TS7A 2XDMA 1GHIA 1DP6A 5FDHA 5E2EA 5CGXA 3R7WA 2Q0OA 1IYOA 4C3QA 3MQ0A 4JPMA 1YLYA 1TS8A 4HI4A 1VB6A 3LUQA 4EETB 3LO7A 1LLBA 4MDZA 3NI9A 2IWCA 2V8CA 3NC8A 3IBRA 3M6BA 1FCMA 4S2OA 2XEPA 3EEHA 5FATA 2ZJ9A 2J8YA 5AVFA 3MFDA 3ZCZA 1Q2QA 2WKQA 4X55A 4A5RA 3SH7A 4EQIA 1JTDA 2P7JA 3PHYA 2XF3A 4JF4A 3WRTA 4EERA 1RP5A 4RYEA 4MNRA 1M6KA 3CPTB 1V9ZA 3LGOA 3UB5P 3UE0A 4CPKA 3DTIA 1YM1A 4MBKA 1K57C 3IX3A 3OCNA 1PWGA 3NDEA 1IKGA 4X1LA 4IVKA 1YAXA 2QPNA 5A91A 1XJ2A 3UE1A 3UB6A 2EXBA 2W3DA 3CG5A 3P7NA 4KUKA 2FFFB 1YLTA 2XD1A 1W7FA 2K7SA 2RCXA 3R4KA 3CMZA 2PBYA 2J3WA 3LIEA 2Y2IA 1MXOA 2E8JA 3AGFA 2G2WA 1FSYA 4EUZA 1ACFA 3NJAA 4NXBA 2YKFA 4EXOA 4WL9A 3ZVWA 4LV0A 3FWLA 2QKPA 3VOLA 4X25A 4I38A 1JWZA 1SKFA 2JN7A 4WYYA 1E25A 1P97A 1WA9A 5CXWA 4JXVA 1TF1A 2Z2LB 4BQMA 4F3LB 3NOUC 3TOIA 3OPRA 5TBMB 4IEDA 1XP4A 4IVIA 3HLBA 4LRYC 5FI6A 3NOPC 1G28A 4WZ5C 3VP1A 4R3AA 3FV7A 1KVLA 1SZVA 5TFQA 2EWWA 4KZBA 3IXHA 2ZMFA 1S66L 4CJNA 2VZWA 2WYXA 5HD5A 5A92A 3DWKA 3VFFA 5CHMA 4ZRRA 3T1XA 1PNEA 3IQAA 1BYWA 2JHEA 4CLCB 3Q7VB 3LEQA 1YLWA 3DWZA 2VKSA 4K0XA 4S2IA 2EX9A 4G3VA 4FD8A 4OPRA 4RVAA 2OSUA 4R1GA 1NLZA 4OVDA 4L9FA 2L4RA 4S2KA 1FIKA 4RQ9A 5HDCA 2QJ7A 4GZBA 2R9WA 2ZL1A 1L0DA 2A2LA 1PI5A 4EEPA 4JGQA 4P87A 5EVIB 4O01A 2ZC7A 1VETB 1ZG4A 4Q0HA 4QPRA 5F69A 4Y0TA 2WKPA 3NHQA 3T4SA 3V67A 4XUXA 5DJTA 2CMNA 2WKHA 4L9EA 3GMWA 4BBTA 3S7PA 1JVJA 2OLVA 3PAEA 2ZLYA 3GSGA 3Q7ZA 3HLCA 4GS9A 1EWZA 2V1AA 4GNUA 3SS3A 3MKEA 4GLQA 4X6TA 3S7NA 3H7WB 4BD1A 2J9PA 5FSRA 3IF5A 1VHMA 5E43A 3LIDA 3UPPA 3M2JA 1MPLA 3VP2A 1N9NA 1H8YA 2P9VA 4GHIB 4HJ4A 3MS6A 4P0MA 3ZNYA 3SH8A 4MN7A 2JKTM 3JYIA 5GLAA 4EQ1A 4X1MA 1I2WA 1YMXA 3BEBA 5EV0A 4N1HA 3BQ8A 3H82A 3RXXA 1CK3A 3AGDA 1MKIA 1NRJA 1K4FA 3F1NB 2WK0A 4KZ5A 4OONA 3BWLA 1X0OA 4OPYA 3D9YA 4ZJ1A 4PM5A 4S2NC 4EV4A 2HP5A 2V0UA 3CHWP 1A0KA 5G4YA 3GDIA 4UHUA 3HBRA 3LIAA 4HNBA 3H9WA 2EX6A 1HZOA 3I7JA 3UB7A 2HJ9C 2PDRA 1TDGA 4GDBA 1YQSA 4DJ2A 3S4XA 1DP8A 2JE5A 4RX3A 4WZ4A 1SKOA 4GDNA 4LRZE 3MXRA 4BBVA 3ZVTA 3WS2A 1EW0A 3QNBA 4OOMA 3UDXA 3BFEA 5GHYA 4CQHA 1BLHA 4ARZB 3ZHHA 2PBDP 1TS0A 2GNXA 5JYPA 3NOTC 1KDWA 5L8MA 4KQQA 4U0TA 3F1OB 1H8ZA 4RA7A 3CITA 3UPNA 3RFBA 2V1BA 1CJFA 4GN2A 4M4XA 2O9BA 3B47A 4G3WA 3SS4A 2RL3A 3L9KA 3T4LA 4BENA 3GRJA 3MJQA 3E4OA 2H5SA 5J3WA 5J8XA 5EUAA 1K57A 1XGJA 5F83A 3PXPA 1WYCA 3CI6A 4IJGA 4R38A 1ZKJA 2Y2JA 3Q07A 1P9WA 4Y15A 1PWDA 3UE3A 4OH0A 3FZCA 1QMEA 4KZ3A 3QP5A 4PMAA 4R4RA 3LI8A 1XFQA 3B42A 3WRZA 1XJ6A 4XT2A 4OQIA 1DJBA 5A90A 5CGWA 3L7HA 1PYYA 4HJ3A 5G18A 3PR6A 1W63Q 2JKGA 4E3MA 3IS2B 3VSKA 4Y0OA 4S2PA 1S0WA 4G3KA 3B3XA 3ZDJA 4ME4A 4EBPA 4CLCD 3V50A 2Y2GA 4R4SA 3EWKA 5EPHA 5HD3A 4JLFA 2WZZA 3UNWA 5IU1A 5U47A 1NJ4A 3GTCA 4BJPA 5DJUA 2OOLA 1STZA 2VA0A 3SS5A 2KDKA 1LSWA 3QP4A 2VX8A 4N9KA 2ACGA 5EOOA 3T1SA 3O3VA 1ESIA 3UMEA 1KDSA 5TGFA 2Y2PA 4PKYG 4HOIA 2NUTC 3KYEA 4WZ5A 4DDYA 4QJGA 5HARA 2J3TD 4HHDA 3LIFA 1UWNX 2HDUA 3CAXA 5IS1A 3S7OA 4UEYA 2ZM8A 1LL8A 5D3OA 2R78A 3R7WB 4K91A 1D06A 2ZM2A 4GKUA 4GCZA 3HUMA 1FCOA 4KG6A 4Y13A 3C38A 1K25A 2PR5A 1NXYA 3O87A 2KOIA 5EOEA 5HDSA 4MCWA 3EOIA 5EE8A 2K2NA 2HDSA 2PD7A 1O7EA 2ZC6B 4Q0IA 3HVFA 2QYBA 3K2NA 3FKVA 3VP3A 2W0NA 5J7EA 3TJZC 5DTSA 3E4QA 5DF9A 2YKHA 3HUOA 1Z6FA 2ZMAA 5F6AA 3ZQ5A 3LI9A 1ALQA 4LCLA 1PI4A 3KYQA 2B02A 4I3AA 2J9OA 1AXBA 3BLSA 4MBHA 4R70A 5CGSA 1ZTUA 4EEUA 5EFWA 3VMAA 4OPZA 3HLWA 3Q1FA 4GOGA 1ZG6A 1IKIA 1K38A 3VE4A 3W2ZA 4B88A 2V9AA 2V0WA 5FASA 3LFVA 4ZJ2A 4JXGA 4WLAA 2A3UA 3T50A 5E2HA 2V20A 2ZQ9A 2W27A 3CLOA 1K56A 1RGYA 1BZAA 5EECA 2E8IA 4OQHA 1ES4A 5FA7A 4JXWA 3VOZA 2VGLS 4Y2FA 3UDIA 2WAFA 3UB9A 3UPOA 4XXRA 2VGLM 5FQKA 4YWZA 1JWPA 1TS6A 3MXSA 2XQZA 3V3RA 5GLCA 1XFNA 4QHCA 2J80A 2OAQ1 4WMCD 1BLPA 5L2FA 4GJ4A 5DVAA 3FPWA 2B18A 3HLGA 2Q9MA 1F2KA 1IEMA 2HP9A 1N9BA 3P01A 5F1FA 5DF8A 4B4ZA 1LI9A 1MWTA 4Y0UA 3MR0A 3PTEA 1ONGA 2XGNA 3O86A 3U4LP 4D2OA 4KZ6A 4S2NA 2C5WB 1XGIA 5KSHA 2JKRI 1P0ZA 3NY4A 2XR0A 3TG9A 5HX9A 3QHYA 2ZOIA 1FSWA 4OOLA 4BMWA 1TD5A 3KX0X 2XFTA 4H6JB 3S22A 4EUVA 5DFYA 5EM1A 4JKTA 1W63M 3OLOA 1BULA 1S4RA 1IYPA 4LV2A 1ESUA 5E2FA 3HUNA 1H3QA 3ITBA 1ERMA 2WGWA 3ZG5A 3IT9A 4LRXC 1HLUP 4OKPA 1J3WA 1L0FA 2VV7A 4GD6A 4I3IA 2ZL1B 4KENB 3N6IA 2GX5A 1LHYA 2O9AA 4U3TA 1VEUB 1TEMA 5J4EA 5FAQA 1JTGA 1M40A 2JKTI 3IF6C 2K31A 5DTTA 3N8RA 2ZC4B 4KZ7A 1Y4OA 3PBTA 3S1YA 1K4EA 3RTYA 1V9YA 2WKIA 4NXGA 3MZDA 3GR2A 3D72A 1L0GA 2G7UA 2KLIA 3MKFA 3OCLA 4NK3A 1S1YA 4F3LA 1K6RA 4PPRA 4MN6A 1PIOA 2XLNA 5CTNA 2WKRA 4KUOA 3BM6A 2CC1A 2OAP1 2GZAA 3W8KA 4E6XA 3PYPA 1G5UA 1VQQA 3IHBA 3KSIA 5DF7A 3E0YA 5AVEA 4DE1A 3E98A 2HZ5A 3ZGAB 3OPLA 2XROA 4YFMA 3UO9A 3C30A 2P9VB 4LCMA 2HDRA 1MZUA 4OPQA 3VSLA 3QP2A 4HEFA 4ETXA 4WN5A 2BLSA 3FC7A 2VJWA 5CHUA 5GL9A 3Q7VA 2OLUA 2EX2A 4ZTKA 2W3EA 3ZG7B 2ZQ7A 1N9LA 5CRFA 2DCFA 1HD8A 5HWWA 3H82B 3RJUA 3CWFA 4O8GA 4DRTA 2ZOHA 5KZHA 3K3CA 2XA7S 3CZDA 3MQQA 1E3UA 3MSHA 2XA7M 4E3LA 4N1XA 3NIAA 4E3OA 5AQ9A 3M6HA 3KYZA 3U2AA 3UE6A 2M1CA 3KO6A 5GHZA 3N4IA 1NZOA 4Q0JA 1YMSA 3LICA 5CX7A 5F68A 3FYZA 1OT6A 2W3GA 5FEGA 5DFXA 3G35A 5A93A 2NUPC 4NEED 4ZBEA 5HZHA 1JWVA 2VEAA 3MF0A 5FL3A 2JKFA 1ES3A 3ZYTA 5FI2A 1AWIA 4FH4A 1YT4A 1SKOB 5IHVA 5I5LA 4JXSA 1RGZA 4S2MA 3A3JA 3DW0A 3TW8A 4O0PA 3HJIA 2WGIA 3MZFA 1OTIA 3GECA 4E6WA 3SW1A 2W1TA 1LSVA 5CECA 2XRNA 4DE3A 3NECA 3C7VA 3VP0A 4XUZA 2VGKA 3MZEA 3MQOA 3ICYA 4PAUA 3RH8B 2I72A 3BLMA 2QHKA 1NRFA 1GCEA 2X02A 1NLYA 1E4DA 4JGPA 3A3EA 3LCEA 5FI7A 2WKEA 1UWPX 2ZBBA 1F5MA 3D3OA 3LYXA 4FTXA 4B93A 1OJ5A 3JVUA 1O07A 2HDQA 4E04A 1PW1A 1BLSA 3OC2A 5HWVA 1ONHA 4P85A 3OZHA 4MMNA 2PT7A 2EA9A 2X01A 3HLFA 3S7QA 1K54A 1I2SA 1KE0A 3P09A 5AQAA 3P98A 2PHYA 3EGXC 3IWIA 2PRFA 3GVBA 4R23A 1C3BA 2DNSA 4B9OA 5DTKA 2UV0E 5CTMA 2ZC3B 5HAQA 2EWVA 1CI8A 3BW6A 4HY8A 2FZ0A 1RCJA 1H0MA 4NETA 2PAVP 4NKPA 4UQIM 1KGFA 2VV8A 1N4OA 2ZD8A 4IHQA 1H5XA 4I3JA 4S2JA 4HP9A 1BTLA 4K0WA 3C8CA 1IYQA 1PWCA 3GV9A 2O0YA 5FQJA 3VV4A 1S1ZA 3QP1A 4KG2A 1Y28A 2A24B 3NULA 5HSQA 4QY5A 3IWOA 3OPPA 2W3HA 1K55A 2IWDA 2ZM0A 5G4ZA 4ARZA 1NWZA 1CEFA 3PBQA 1SDEA 3G2ZA 4KQDA 3G34A 3A3DA 4IBRA 4HP4A 3NBLA 1EROA 1MKMA 2HF6A 1ERQA 1N9OA 3WS0A 1XXMA 2B95A 2HJEA 3G6OA 4KZAA 3UB8A 3D4FA 2Y55A 3G32A 5E2GA 4KZ4A 1YPRA 3T1QB 5HAPA 5CHJA 3O88A 2Q9NA 3N8LA 4X56A 3G2YA 5JYOA 4HJ6A 3DBAA 4HESA 2ZQAA 1CF0A 4FCFA 5HW3A 3VE3A 3TSGA 4OP5A 2Y8HA 3F1PA 5AJGA 2Y2MA 3A0VA 3UY6A 1H8MA 1BT5A 3T4OA 2DMWA 4DE2A 5EVIC 1XJ4A 4BL3A 2WGVA 3CUEC 3WS1A 2VV6A 4DXCA 4E3NA 2LB9A 1CI9A 1YLPA 2Y59A 3IF6A 5FQIA 2B5RA 3VFHA 3LR4A 4DJ3A 2L1MA 4EESA 4JGOA 2XSSA 3MXQA 4FOFA 2WZXA 1W5DA 4B4XA 4KZ8A 1TVFA 1T19A 2Y79A 1ZC2A 5HAIA 5IT5A 4L9GA 2FH5A 3T4KA 4ESPA 3BFDA 1MWRA 5M18A 1T1BA 4PKYA 3IH8A 5F1GA 2ZMVA 2GJ3A 4UA6A 4DDSA 4BBUA 4DXBA 5FEFA 4E3JA 2WADA 5AQBA 1ES5A 4WUJA 3T4TA 2OWJA 3UN7A 3IBJA 3NCKA 4HQAA 3G4PA 4GD8A 4UA7A 3TE8A 3C5AA 4EBLA 5M1AA 1WYBA 2XK1A 3BQAA 4MN5A 2EXAA 5EVLA 1EI5A 3ZG0A 4N9LA 3QNCA 1K54C 2VGJA 4OOYA 3LR5A 5L07A 1K0KA 1OTAA 2Y4AA 3JPUA 2BTFP 2VLGA 1T18A 3ISGA 4Y3IA 4HH2A 2WAEA 1YLZA 4H8RA 4F94A 3OBFA 1FILA 3HCYA 1LL5A 3ITAA 1UGUA 3KSHA 3AGEA 2WUQA 5HPFA 4DF6A 4K08A 1BLCA 4DKIA 4R6LA 2OWHA 5FAOA 3ZG8B 1BUEA 2L0WA 5BOHA 4ID4A 4HIAA 2C6WB 3DTEA 3T12B 4LFUA 1T1AA 3C2WA 1MWUA 1XA1A 3SH9A 5L10A 1NY0A 1K55C 4Y17A 2QWSA 2R9XA 5EM0A 1SHVA 3BY8A 3E2LA 3ZG9B 2LB5A 2WGWB 2PU2A 2Y2KA 2JCHA 3IXDA 1L3LA 1OT9A 3DTMA 2PU4A 2BG1A 4I5SA 3CPTA 1CEGA 3E2KA 4UAAA 3LEZA 3HJKA 5KIZA 3N8SA 4PM8A 4E3KA 3BRMA 3A3FA 1G6AA 4R3JA 1OTDA 4QB8A 1DRMA 3MFXA 3O5YA 1TDLA 4WM9A 4EBNA 3DTKA 4OLGA 1FR6A 4Q8IA 5GHXA 4Z1WA 3VP4A 5HL1A 2MJ6A 4DE0A 2A49A 1KOUA 5MC7A 1YSQA 1XKZA 1FCNA 4C6YA 1MBLA 1XJ3A 3EQVA 1I5QA 2EFXA 2PR6A 4X53A 1OJGA 3UMDA 4AFIA 4PHTA 1LL9A 2VK3A 2Y2NA 4FUWA 4H6JA 5TBMA 4GS9B 1P9RA 3ZNTA 3E4PA 4E3IA 1MC0A 3HREA 2PYRA 2Z6DA 2D02A 1LSXA 1F98A 3LR3A 4OLDA 2EX8A 1ZHHB 4EU0A 3FKWA 1GHMA 1ES2A 1KVMA 2Y91A 3HL9A 1G6OA 3BY9A 3ULFA 4LV3A 1VEUA 1Z09A 2Y2HA 5KMWA 2KX6A 2XH9A 2HV1A 4HH3A 5CERA 4YINA 1GSVA 4CLCA 1IELA 4Y7PA 2JBFA 2INWA 5F82A 4GB7A 4OP8A 2JKRM 4CLCE 4P6ZS 2M7VA 3W4PA 4YNRA 2D01A 3HLDA 4P6ZM 2H28A 3PBRA 3JVVA 4NXEA 3A0SA 3IX4A 4II7A 5AQ7A 4LPZA 5EVIA 1DY6A 3K3DA 4BLMA 2W1TB 3LY3A 3BFFA 3CUEA 1W8QA 3PBNA 1OPXA 1VETA 2G2UA 4N92A 4MLLA 4QWOA 3LY4A 1MY8A 2O9CA 1K56D 1PRQA 1SCWA 3V5MA 4I39A 5HPIA 1DJCA 1OTEA 4ZAMA 2Z6CA 3C4PA 4UA9A 4M3KA 3UDFA 3IHAA 4MBFA 1U60A 5TJJA 3IWQA 4YOFA 3W4OA 4FSFA 3QP6A 2ZQCA 1XX2A 1YLJA 3HLEA 3H7WA 5K5BA 5DKKA 4X68A 3IXBA 4JBFA 3TRCA 1WE4A 3FG8A
chains in the Genus database with same CATH topology
4WLAA 2PYPA 5HWTA 1BYWA 3T50A 2JHEA 4CLCB 1YSPA 2W27A 4GW9A 3CLOA 4HJ6A 2VKSA 4G3VA 4DN0A 4ETZA 3EEAA 4GHIA 3DBAA 1NLZA 4L9FA 5F5YA 2L4RA 3VE3A 2VGLS 4RQ9A 4Y2FA 2Y8HA 3F1PA 4WEJA 5AJGA 3A0VA 1H8MA 3UB9A 2BASA 5HDCA 2QJ7A 2VGLM 3PBOA 3T4OA 2DMWA 2A2LA 1XJ4A 3OOVA 4YWZA 4BWIA 1TS6A 5C5KA 4EEPA 4JGQA 3CUEC 3B33A 1XFNA 3F1NA 2J80A 2OAQ1 2VV6A 2IA2A 4O01A 4IUKA 4LLOB 4GJ4A 2LB9A 1S67L 2M7UA 3FPWA 4Q0HA 4QPRA 2B18A 5F69A 2WKPA 3NHQA 3T4SA 3V67A 5DJTA 2CMNA 3LR4A 4L9EA 3LR0A 3P01A 4DJ3A 1DP9A 3S7PA 2L1MA 3EGDC 3T4JA 4BBTA 4XT2B 4JGOA 2XSSA 4Y5FA 3MXQA 4FOFA 3PBSA 3MR0A 2HGVA 2W1RA 4GS9A 1GSXA 4UQIS 1T19A 2V1AA 5KSHA 2PD8A 2Y79A 4NXFA 2JKRI 1P0ZA 5IT5A 4GLQA 4L9GA 2FH5A 3T4KA 3S7NA 3H7WB 1T1BA 2ZOIA 4PKYA 5HDDA 4OOLA 4BMWA 2ZMVA 1TD5A 1VHMA 3KX0X 3T4QA 2GJ3A 3LIDA 4H6JB 4BBUA 4EUVA 5HL6A 5DFYA 4WUJA 3T4TA 1N9NA 1W63M 3OLOA 2OWJA 1S4RA 4GHIB 1YKDA 4HJ4A 3IBJA 1H3QA 4HQAA 2P08A 4LRXC 3MMHA 3TE8A 3F1OA 4MN7A 3F1PB 2JKTM 3BQAA 4MN5A 4EQ1A 2VV7A 4I3IA 2GX5A 2O9AA 5J4EA 2I9VA 3BQ8A 3H82A 3LR5A 1NRJA 4KQOA 4CLCC 3F1NB 1OTAA 2JKTI 3FPVA 2K31A 4IUHA 3BWLA 2VLGA 1T18A 3PBTA 4Y3IA 3RTYA 4HH2A 1V9YA 1X0OA 2QJ5A 4NXGA 3D72A 2G7UA 4WF0A 2KLIA 3OBFA 3A0RA 3OCLA 1GSWA 3HCYA 1OTBA 1S1YA 1UGUA 3KSHA 2V0UA 5HPFA 5LBRA 3KSGA 4K08A 5G4YA 4F3LA 4R6LA 2OWHA 2L0WA 3GDIA 4MN6A 4HIAA 3LIAA 4HNBA 3H9WA 4WEKA 2J3TC 2A24A 3UB7A 2WKRA 1IFQA 2HJ9C 2O99A 4KUOA 2PDRA 5DKLA 2OAP1 2GZAA 3PYPA 4DJ2A 1DP8A 1LT0A 3KSIA 1T1AA 4WELA 3E0YA 5AVEA 3C2WA 3E98A 4LRZE 3BJNA 2XROA 4BBVA 2QWSA 1EW0A 4OOMA 3C30A 4CQHA 3BY8A 3IS2A 1MZUA 2LB5A 4ARZB 4EW7A 1TS0A 2GNXA 3NOTC 5L8MA 4ETXA 4WN5A 3F1OB 1OT9A 3FC7A 2VJWA 3CITA 1D7EA 3RFBA 2V1BA 2W3EA 4M4XA 1IOUA 2O9BA 2P04A 3B47A 4G3WA 1N9LA 4I5SA 3KSFA 4DMZA 5HWWA 3LIBA 3H82B 3CWFA 1JNUA 3HJKA 4L0LA 4O8GA 3T4LA 2ZOHA 3MJQA 5KIZA 3E4OA 5J3WA 3K3CA 2XA7S 3EQUA 3MQQA 1S4SA 2XA7M 3PXPA 4JGRA 1OTDA 2W3FA 1ODVA 3CI6A 1DRMA 4IJGA 3MFXA 4R38A 1F9IA 3O5YA 3KYZA 3U2AA 3UE6A 2M1CA 3KO6A 1P9WA 1T1CA 4Q0JA 5A8BA 3UE3A 1TS7A 3LICA 5CX7A 5F68A 1OT6A 1DP6A 2W3GA 4Z1WA 3R7WA 5DFXA 3LI8A 2NUPC 1XFQA 4NEED 3MQ0A 5HZHA 2MJ6A 3B42A 2VEAA 1XJ6A 1TS8A 1KOUA 1VB6A 3MF0A 4HI4A 3LUQA 4XT2A 5FL3A 4EETB 1YSQA 3ZYTA 5MC7A 4MDZA 1XJ3A 3EQVA 3IBRA 5I5LA 2PR6A 4HJ3A 1OJGA 4O0PA 3TW8A 3EEHA 3UMDA 3PR6A 4AFIA 1W63Q 3HJIA 4PHTA 3IS2B 1OTIA 5AVFA 3GECA 4G3KA 3SW1A 2W1TA 1LSVA 2WKQA 2XRNA 4ME4A 4CLCD 4H6JA 3MQOA 5TBMA 4GS9B 1P9RA 3ICYA 3EWKA 2P7JA 4PAUA 3RH8B 3PHYA 3E4PA 5HD3A 1MC0A 2QHKA 2PYRA 2Z6DA 4EERA 1NLYA 2D02A 5IU1A 4JGPA 4BJPA 1LSXA 1F98A 5DJUA 3LR3A 1V9ZA 2OOLA 1STZA 2VA0A 2KDKA 1LSWA 2VX8A 1UWPX 2ZBBA 1ZHHB 4EU0A 1F5MA 3OCNA 3D3OA 3LYXA 4B93A 1OJ5A 3JVUA 3UMEA 1YAXA 4E04A 4PKYG 4HOIA 3OC2A 2NUTC 5HWVA 1XJ2A 3UB6A 1G6OA 3BY9A 3ULFA 2W3DA 3P7NA 2J3TD 4HHDA 4KUKA 3LIFA 4MMNA 2PT7A 2EA9A 2K7SA 1UWNX 3R4KA 5IS1A 3CAXA 3S7OA 3S7QA 4UEYA 2KX6A 2J3WA 2HV1A 4HH3A 4CLCA 1GSVA 3LIEA 1LL8A 2PHYA 2INWA 3EGXC 2R78A 3R7WB 1D06A 4GCZA 4B9OA 2JKRM 4CLCE 4P6ZS 2M7VA 3C38A 2PR5A 3NJAA 4NXBA 4YNRA 2YKFA 4EXOA 4WL9A 2D01A 2KOIA 2H28A 4P6ZM 5HDSA 3PBRA 3JVVA 2QKPA 4MCWA 3EOIA 4NXEA 2EWVA 2K2NA 3VOLA 3BW6A 2PD7A 4HY8A 4I38A 2FZ0A 3A0SA 4II7A 2JN7A 4NKPA 4UQIM 4Q0IA 4LPZA 2VV8A 2QYBA 3K2NA 1P97A 1WA9A 4IHQA 3K3DA 4I3JA 1TF1A 4HP9A 2W1TB 2W0NA 3C8CA 3CUEA 5J7EA 3PBNA 3TJZC 1OPXA 4F3LB 2O0YA 3E4QA 3NOUC 5DF9A 3VV4A 2YKHA 1S1ZA 5TBMB 1Y28A 2A24B 5F6AA 2O9CA 3ZQ5A 3LI9A 5HSQA 4I39A 5HPIA 1OTEA 2B02A 3KYQA 4I3AA 2W3HA 4LRYC 5G4ZA 4ARZA 1NWZA 3NOPC 2Z6CA 1G28A 4R70A 3PBQA 4EESA 4KQDA 1ZTUA 4R3AA 4EEUA 5EFWA 5TJJA 4HP4A 2EWWA 4YOFA 1MKMA 4FSFA 2HF6A 1N9OA 3VE4A 3H7WA 2ZMFA 3W2ZA 1S66L 5K5BA 2V9AA 2HJEA 3G6OA 2VZWA 2V0WA 5DKKA 5HD5A 3LFVA 3UB8A 4ZRRA 3TRCA 3FG8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WLA A;  2PYP A;  5HWT A;  1BYW A;  3T50 A;  2JHE A;  2W27 A;  4GW9 A;  3CLO A;  4HJ6 A;  4GHI A;  4L9F A;  5F5Y A;  2L4R A;  3VE3 A;  4RQ9 A;  3F1P A;  3A0V A;  3UB9 A;  2BAS A;  5HDC A;  2QJ7 A;  1XJ4 A;  4YWZ A;  1TS6 A;  4EEP A;  4JGQ A;  3B33 A;  1XFN A;  3F1N A;  2J80 A;  2VV6 A;  4LLO B;  1S67 L;  5F69 A;  2WKP A;  3NHQ A;  5DJT A;  2CMN A;  4L9E A;  4DJ3 A;  1DP9 A;  4BBT A;  2L1M A;  4EES A;  4XT2 B;  4JGO A;  3MXQ A;  3MR0 A;  4GS9 A;  1GSX A;  1T19 A;  2V1A A;  2PD8 A;  4NXF A;  1P0Z A;  4L9G A;  3H7W B;  1T1B A;  2ZOI A;  4PKY A;  5HDD A;  3KX0 X;  2GJ3 A;  3LID A;  4H6J B;  4BBU A;  4WUJ A;  1N9N A;  3OLO A;  2OWJ A;  1S4R A;  4GHI B;  4HJ4 A;  4HQA A;  4LRX C;  3F1O A;  3F1P B;  4MN5 A;  4EQ1 A;  2VV7 A;  4I3I A;  5J4E A;  2I9V A;  3H82 A;  3F1N B;  1OTA A;  3BWL A;  2VLG A;  1T18 A;  3RTY A;  4HH2 A;  1V9Y A;  1X0O A;  2QJ5 A;  4NXG A;  3D72 A;  4WF0 A;  3A0R A;  1GSW A;  1OTB A;  1S1Y A;  1UGU A;  2V0U A;  4K08 A;  5G4Y A;  4F3L A;  4R6L A;  2OWH A;  2L0W A;  3GDI A;  4MN6 A;  4HIA A;  3LIA A;  4HNB A;  3H9W A;  2A24 A;  3UB7 A;  2WKR A;  4KUO A;  2PDR A;  5DKL A;  3PYP A;  4DJ2 A;  1DP8 A;  1LT0 A;  1T1A A;  5AVE A;  3C2W A;  4LRZ E;  4BBV A;  2QWS A;  1EW0 A;  3BY8 A;  3IS2 A;  1MZU A;  4EW7 A;  1TS0 A;  3NOT C;  4WN5 A;  3F1O B;  1OT9 A;  3FC7 A;  1D7E A;  2V1B A;  4M4X A;  4I5S A;  1N9L A;  5HWW A;  3LIB A;  3H82 B;  3CWF A;  1JNU A;  3HJK A;  2ZOH A;  3MJQ A;  5KIZ A;  3E4O A;  5J3W A;  3K3C A;  3MQQ A;  1S4S A;  4JGR A;  1OTD A;  1ODV A;  1DRM A;  3MFX A;  4R38 A;  1F9I A;  3UE6 A;  2M1C A;  1T1C A;  5A8B A;  1TS7 A;  3LIC A;  5F68 A;  1OT6 A;  1DP6 A;  3LI8 A;  1XFQ A;  5HZH A;  2VEA A;  1XJ6 A;  1TS8 A;  1KOU A;  1VB6 A;  4HI4 A;  4XT2 A;  3LUQ A;  4EET B;  1XJ3 A;  3IBR A;  5I5L A;  2PR6 A;  4HJ3 A;  1OJG A;  3UMD A;  3EEH A;  3HJI A;  3IS2 B;  1OTI A;  5AVF A;  3GEC A;  3SW1 A;  1LSV A;  2WKQ A;  4H6J A;  3MQO A;  5TBM A;  4GS9 B;  3ICY A;  3EWK A;  2P7J A;  3RH8 B;  3PHY A;  3E4P A;  5HD3 A;  2QHK A;  2PYR A;  2Z6D A;  4EER A;  2D02 A;  5IU1 A;  4JGP A;  1LSX A;  1F98 A;  5DJU A;  1V9Z A;  2OOL A;  2KDK A;  1LSW A;  1UWP X;  2ZBB A;  3LYX A;  1OJ5 A;  3UME A;  4E04 A;  4PKY G;  4HOI A;  5HWV A;  1XJ2 A;  3UB6 A;  3BY9 A;  3ULF A;  3P7N A;  4HHD A;  4KUK A;  3LIF A;  2EA9 A;  2K7S A;  1UWN X;  5IS1 A;  3CAX A;  2KX6 A;  2HV1 A;  4HH3 A;  1GSV A;  3LIE A;  1LL8 A;  2PHY A;  2INW A;  2R78 A;  1D06 A;  4GCZ A;  4B9O A;  2PR5 A;  3NJA A;  4NXB A;  2YKF A;  4EXO A;  4WL9 A;  2D01 A;  2H28 A;  5HDS A;  2QKP A;  4NXE A;  3VOL A;  2PD7 A;  4HY8 A;  4I38 A;  3A0S A;  2JN7 A;  4LPZ A;  2VV8 A;  1P97 A;  1WA9 A;  3K3D A;  4I3J A;  4HP9 A;  2W0N A;  3C8C A;  5J7E A;  4F3L B;  3E4Q A;  3NOU C;  2YKH A;  1S1Z A;  5TBM B;  1Y28 A;  2A24 B;  5F6A A;  3ZQ5 A;  3LI9 A;  5HSQ A;  4I39 A;  1OTE A;  2B02 A;  4I3A A;  4LRY C;  5G4Z A;  1NWZ A;  3NOP C;  2Z6C A;  1G28 A;  4R70 A;  4KQD A;  4R3A A;  4EEU A;  5EFW A;  4HP4 A;  1N9O A;  3VE4 A;  3H7W A;  1S66 L;  2V9A A;  3G6O A;  5DKK A;  2V0W A;  5HD5 A;  3UB8 A;  3FG8 A; 
#chains in the Genus database with same CATH topology
 1KE4 A;  2PYP A;  5HWT A;  4IBX A;  4Z9Q A;  5FAP A;  3C4O A;  2H0Y A;  1KE3 A;  2Y2O A;  1YSP A;  4GW9 A;  1GA9 A;  4ZJ3 A;  2V2F F;  4DN0 A;  4ETZ A;  3EEA A;  4GHI A;  4NG2 A;  1HTZ A;  4PM7 A;  5FQM A;  4C75 A;  3GQZ A;  5F5Y A;  1BSG A;  3BFC A;  1W8Y A;  4O7D A;  4WEJ A;  2BAS A;  3PBO A;  5EVE A;  3OOV A;  5CEB A;  4BWI A;  5C5K A;  3G31 A;  3B33 A;  1IYS A;  4LGW A;  3F1N A;  3QP8 A;  2Z2M B;  1D1J A;  2IA2 A;  2GDN A;  4IUK A;  3PAG A;  4LLO B;  4P6B A;  4S2L A;  1S67 L;  2M7U A;  3G30 A;  3IX8 A;  1LI0 A;  4JF5 A;  3W4Q A;  1HVB A;  3LR0 A;  1DP9 A;  3EGD C;  3T4J A;  4XT2 B;  4Y5F A;  3IXG A;  4ZDX A;  3PBS A;  1FOF A;  2HGV A;  4KG5 A;  2W1R A;  1L2S A;  1GSX A;  2V1Z A;  3M2K A;  4UQI S;  1GA0 A;  3RXW A;  2PD8 A;  1J9M A;  4NXF A;  4U0X A;  2QMI A;  4PM6 A;  1NYM A;  3WS4 A;  1PZO A;  5M19 A;  5HDD A;  3MBZ A;  4WMC A;  2Y2Q A;  3T4Q A;  4MEZ A;  5HL6 A;  5FQQ A;  4HBT A;  4PM9 A;  3BYD A;  1GHP A;  5FQ9 A;  4JF6 A;  1YKD A;  4D60 A;  1K6S A;  1NZU A;  2P08 A;  1FQG A;  3MMH A;  4LV1 A;  3F1O A;  3F1P B;  3VOY A;  2XFS A;  5FDS A;  2UWX A;  2H0T A;  2HPB A;  4KQR A;  1DJA A;  3V39 A;  2I9V A;  2FFY A;  4HBU A;  1FR1 A;  4KQO A;  4CLC C;  3A3I A;  3DAV A;  2QZ6 A;  3FPV A;  4IUH A;  3SZT A;  4QY6 A;  2V8F A;  2QJ5 A;  3T1R A;  1S6R A;  3IH9 A;  3IF6 B;  5KSC A;  1SDN A;  2Y2L A;  2J7V A;  2AVX A;  4WF0 A;  3A0R A;  4LEN A;  1GSW A;  4QD4 A;  1OTB A;  2OV5 A;  4BL2 A;  4OQ0 A;  3NDG A;  3Q82 A;  5LBR A;  3KSG A;  3C7U A;  4WBG A;  1G68 A;  1PW8 A;  4WEK A;  2J3T C;  2A24 A;  3BFG A;  5L09 A;  1PFL A;  1IFQ A;  1XA7 A;  2O99 A;  1KGG A;  5I94 A;  5DKL A;  2X71 A;  2HP6 A;  1LT0 A;  2ZQ8 A;  2EFU A;  4WEL A;  3Q81 A;  1Q2P A;  3BJN A;  1Y54 A;  1E3U D;  3BEC A;  3IS2 A;  2ZQD A;  5EVI D;  4EW7 A;  2XD5 A;  4X69 A;  1NYY A;  1QMF A;  4R0Q A;  3ZFZ A;  1VM1 A;  3WWX A;  3OPH A;  1D7E A;  5GLD A;  2DRW A;  1L0E A;  5TR7 A;  1XPB A;  1PZP A;  1IOU A;  2P04 A;  4OQG A;  4BD0 A;  4FH2 A;  3KSF A;  5HFO A;  3WS5 A;  4DMZ A;  3LIB A;  1JNU A;  4RX2 A;  2P74 A;  4L0L A;  2H10 A;  2JC7 A;  4QU3 A;  1KGE A;  2IWB A;  3EQU A;  2ZC5 B;  1S4S A;  3N7W A;  4R3B A;  3CJM A;  5CED A;  4JGR A;  2W3F A;  1ODV A;  3V3S A;  3SOI A;  1F9I A;  1MWS A;  4KZ9 A;  1T1C A;  1W79 A;  4EWF A;  5GLB A;  1OME A;  5A8B A;  1CQA A;  1TS7 A;  2XDM A;  1GHI A;  1DP6 A;  5FDH A;  5E2E A;  5CGX A;  3R7W A;  2Q0O A;  1IYO A;  4C3Q A;  3MQ0 A;  4JPM A;  1YLY A;  1TS8 A;  4HI4 A;  1VB6 A;  3LUQ A;  4EET B;  3LO7 A;  1LLB A;  4MDZ A;  3NI9 A;  2IWC A;  2V8C A;  3NC8 A;  3IBR A;  3M6B A;  1FCM A;  4S2O A;  2XEP A;  3EEH A;  5FAT A;  2ZJ9 A;  2J8Y A;  5AVF A;  3MFD A;  3ZCZ A;  1Q2Q A;  2WKQ A;  4X55 A;  4A5R A;  3SH7 A;  4EQI A;  1JTD A;  2P7J A;  3PHY A;  2XF3 A;  4JF4 A;  3WRT A;  4EER A;  1RP5 A;  4RYE A;  4MNR A;  1M6K A;  3CPT B;  1V9Z A;  3LGO A;  3UB5 P;  3UE0 A;  4CPK A;  3DTI A;  1YM1 A;  4MBK A;  1K57 C;  3IX3 A;  3OCN A;  1PWG A;  3NDE A;  1IKG A;  4X1L A;  4IVK A;  1YAX A;  2QPN A;  5A91 A;  1XJ2 A;  3UE1 A;  3UB6 A;  2EXB A;  2W3D A;  3CG5 A;  3P7N A;  4KUK A;  2FFF B;  1YLT A;  2XD1 A;  1W7F A;  2K7S A;  2RCX A;  3R4K A;  3CMZ A;  2PBY A;  2J3W A;  3LIE A;  2Y2I A;  1MXO A;  2E8J A;  3AGF A;  2G2W A;  1FSY A;  4EUZ A;  1ACF A;  3NJA A;  4NXB A;  2YKF A;  4EXO A;  4WL9 A;  3ZVW A;  4LV0 A;  3FWL A;  2QKP A;  3VOL A;  4X25 A;  4I38 A;  1JWZ A;  1SKF A;  2JN7 A;  4WYY A;  1E25 A;  1P97 A;  1WA9 A;  5CXW A;  4JXV A;  1TF1 A;  2Z2L B;  4BQM A;  4F3L B;  3NOU C;  3TOI A;  3OPR A;  5TBM B;  4IED A;  1XP4 A;  4IVI A;  3HLB A;  4LRY C;  5FI6 A;  3NOP C;  1G28 A;  4WZ5 C;  3VP1 A;  4R3A A;  3FV7 A;  1KVL A;  1SZV A;  5TFQ A;  2EWW A;  4KZB A;  3IXH A;  2ZMF A;  1S66 L;  4CJN A;  2VZW A;  2WYX A;  5HD5 A;  5A92 A;  3DWK A;  3VFF A;  5CHM A;  4ZRR A;  3T1X A;  1PNE A;  3IQA A;  1BYW A;  2JHE A;  4CLC B;  3Q7V B;  3LEQ A;  1YLW A;  3DWZ A;  2VKS A;  4K0X A;  4S2I A;  2EX9 A;  4G3V A;  4FD8 A;  4OPR A;  4RVA A;  2OSU A;  4R1G A;  1NLZ A;  4OVD A;  4L9F A;  2L4R A;  4S2K A;  1FIK A;  4RQ9 A;  5HDC A;  2QJ7 A;  4GZB A;  2R9W A;  2ZL1 A;  1L0D A;  2A2L A;  1PI5 A;  4EEP A;  4JGQ A;  4P87 A;  5EVI B;  4O01 A;  2ZC7 A;  1VET B;  1ZG4 A;  4Q0H A;  4QPR A;  5F69 A;  4Y0T A;  2WKP A;  3NHQ A;  3T4S A;  3V67 A;  4XUX A;  5DJT A;  2CMN A;  2WKH A;  4L9E A;  3GMW A;  4BBT A;  3S7P A;  1JVJ A;  2OLV A;  3PAE A;  2ZLY A;  3GSG A;  3Q7Z A;  3HLC A;  4GS9 A;  1EWZ A;  2V1A A;  4GNU A;  3SS3 A;  3MKE A;  4GLQ A;  4X6T A;  3S7N A;  3H7W B;  4BD1 A;  2J9P A;  5FSR A;  3IF5 A;  1VHM A;  5E43 A;  3LID A;  3UPP A;  3M2J A;  1MPL A;  3VP2 A;  1N9N A;  1H8Y A;  2P9V A;  4GHI B;  4HJ4 A;  3MS6 A;  4P0M A;  3ZNY A;  3SH8 A;  4MN7 A;  2JKT M;  3JYI A;  5GLA A;  4EQ1 A;  4X1M A;  1I2W A;  1YMX A;  3BEB A;  5EV0 A;  4N1H A;  3BQ8 A;  3H82 A;  3RXX A;  1CK3 A;  3AGD A;  1MKI A;  1NRJ A;  1K4F A;  3F1N B;  2WK0 A;  4KZ5 A;  4OON A;  3BWL A;  1X0O A;  4OPY A;  3D9Y A;  4ZJ1 A;  4PM5 A;  4S2N C;  4EV4 A;  2HP5 A;  2V0U A;  3CHW P;  1A0K A;  5G4Y A;  3GDI A;  4UHU A;  3HBR A;  3LIA A;  4HNB A;  3H9W A;  2EX6 A;  1HZO A;  3I7J A;  3UB7 A;  2HJ9 C;  2PDR A;  1TDG A;  4GDB A;  1YQS A;  4DJ2 A;  3S4X A;  1DP8 A;  2JE5 A;  4RX3 A;  4WZ4 A;  1SKO A;  4GDN A;  4LRZ E;  3MXR A;  4BBV A;  3ZVT A;  3WS2 A;  1EW0 A;  3QNB A;  4OOM A;  3UDX A;  3BFE A;  5GHY A;  4CQH A;  1BLH A;  4ARZ B;  3ZHH A;  2PBD P;  1TS0 A;  2GNX A;  5JYP A;  3NOT C;  1KDW A;  5L8M A;  4KQQ A;  4U0T A;  3F1O B;  1H8Z A;  4RA7 A;  3CIT A;  3UPN A;  3RFB A;  2V1B A;  1CJF A;  4GN2 A;  4M4X A;  2O9B A;  3B47 A;  4G3W A;  3SS4 A;  2RL3 A;  3L9K A;  3T4L A;  4BEN A;  3GRJ A;  3MJQ A;  3E4O A;  2H5S A;  5J3W A;  5J8X A;  5EUA A;  1K57 A;  1XGJ A;  5F83 A;  3PXP A;  1WYC A;  3CI6 A;  4IJG A;  4R38 A;  1ZKJ A;  2Y2J A;  3Q07 A;  1P9W A;  4Y15 A;  1PWD A;  3UE3 A;  4OH0 A;  3FZC A;  1QME A;  4KZ3 A;  3QP5 A;  4PMA A;  4R4R A;  3LI8 A;  1XFQ A;  3B42 A;  3WRZ A;  1XJ6 A;  4XT2 A;  4OQI A;  1DJB A;  5A90 A;  5CGW A;  3L7H A;  1PYY A;  4HJ3 A;  5G18 A;  3PR6 A;  1W63 Q;  2JKG A;  4E3M A;  3IS2 B;  3VSK A;  4Y0O A;  4S2P A;  1S0W A;  4G3K A;  3B3X A;  3ZDJ A;  4ME4 A;  4EBP A;  4CLC D;  3V50 A;  2Y2G A;  4R4S A;  3EWK A;  5EPH A;  5HD3 A;  4JLF A;  2WZZ A;  3UNW A;  5IU1 A;  5U47 A;  1NJ4 A;  3GTC A;  4BJP A;  5DJU A;  2OOL A;  1STZ A;  2VA0 A;  3SS5 A;  2KDK A;  1LSW A;  3QP4 A;  2VX8 A;  4N9K A;  2ACG A;  5EOO A;  3T1S A;  3O3V A;  1ESI A;  3UME A;  1KDS A;  5TGF A;  2Y2P A;  4PKY G;  4HOI A;  2NUT C;  3KYE A;  4WZ5 A;  4DDY A;  4QJG A;  5HAR A;  2J3T D;  4HHD A;  3LIF A;  1UWN X;  2HDU A;  3CAX A;  5IS1 A;  3S7O A;  4UEY A;  2ZM8 A;  1LL8 A;  5D3O A;  2R78 A;  3R7W B;  4K91 A;  1D06 A;  2ZM2 A;  4GKU A;  4GCZ A;  3HUM A;  1FCO A;  4KG6 A;  4Y13 A;  3C38 A;  1K25 A;  2PR5 A;  1NXY A;  3O87 A;  2KOI A;  5EOE A;  5HDS A;  4MCW A;  3EOI A;  5EE8 A;  2K2N A;  2HDS A;  2PD7 A;  1O7E A;  2ZC6 B;  4Q0I A;  3HVF A;  2QYB A;  3K2N A;  3FKV A;  3VP3 A;  2W0N A;  5J7E A;  3TJZ C;  5DTS A;  3E4Q A;  5DF9 A;  2YKH A;  3HUO A;  1Z6F A;  2ZMA A;  5F6A A;  3ZQ5 A;  3LI9 A;  1ALQ A;  4LCL A;  1PI4 A;  3KYQ A;  2B02 A;  4I3A A;  2J9O A;  1AXB A;  3BLS A;  4MBH A;  4R70 A;  5CGS A;  1ZTU A;  4EEU A;  5EFW A;  3VMA A;  4OPZ A;  3HLW A;  3Q1F A;  4GOG A;  1ZG6 A;  1IKI A;  1K38 A;  3VE4 A;  3W2Z A;  4B88 A;  2V9A A;  2V0W A;  5FAS A;  3LFV A;  4ZJ2 A;  4JXG A;  4WLA A;  2A3U A;  3T50 A;  5E2H A;  2V20 A;  2ZQ9 A;  2W27 A;  3CLO A;  1K56 A;  1RGY A;  1BZA A;  5EEC A;  2E8I A;  4OQH A;  1ES4 A;  5FA7 A;  4JXW A;  3VOZ A;  2VGL S;  4Y2F A;  3UDI A;  2WAF A;  3UB9 A;  3UPO A;  4XXR A;  2VGL M;  5FQK A;  4YWZ A;  1JWP A;  1TS6 A;  3MXS A;  2XQZ A;  3V3R A;  5GLC A;  1XFN A;  4QHC A;  2J80 A;  2OAQ 1;  4WMC D;  1BLP A;  5L2F A;  4GJ4 A;  5DVA A;  3FPW A;  2B18 A;  3HLG A;  2Q9M A;  1F2K A;  1IEM A;  2HP9 A;  1N9B A;  3P01 A;  5F1F A;  5DF8 A;  4B4Z A;  1LI9 A;  1MWT A;  4Y0U A;  3MR0 A;  3PTE A;  1ONG A;  2XGN A;  3O86 A;  3U4L P;  4D2O A;  4KZ6 A;  4S2N A;  2C5W B;  1XGI A;  5KSH A;  2JKR I;  1P0Z A;  3NY4 A;  2XR0 A;  3TG9 A;  5HX9 A;  3QHY A;  2ZOI A;  1FSW A;  4OOL A;  4BMW A;  1TD5 A;  3KX0 X;  2XFT A;  4H6J B;  3S22 A;  4EUV A;  5DFY A;  5EM1 A;  4JKT A;  1W63 M;  3OLO A;  1BUL A;  1S4R A;  1IYP A;  4LV2 A;  1ESU A;  5E2F A;  3HUN A;  1H3Q A;  3ITB A;  1ERM A;  2WGW A;  3ZG5 A;  3IT9 A;  4LRX C;  1HLU P;  4OKP A;  1J3W A;  1L0F A;  2VV7 A;  4GD6 A;  4I3I A;  2ZL1 B;  4KEN B;  3N6I A;  2GX5 A;  1LHY A;  2O9A A;  4U3T A;  1VEU B;  1TEM A;  5J4E A;  5FAQ A;  1JTG A;  1M40 A;  2JKT I;  3IF6 C;  2K31 A;  5DTT A;  3N8R A;  2ZC4 B;  4KZ7 A;  1Y4O A;  3PBT A;  3S1Y A;  1K4E A;  3RTY A;  1V9Y A;  2WKI A;  4NXG A;  3MZD A;  3GR2 A;  3D72 A;  1L0G A;  2G7U A;  2KLI A;  3MKF A;  3OCL A;  4NK3 A;  1S1Y A;  4F3L A;  1K6R A;  4PPR A;  4MN6 A;  1PIO A;  2XLN A;  5CTN A;  2WKR A;  4KUO A;  3BM6 A;  2CC1 A;  2OAP 1;  2GZA A;  3W8K A;  4E6X A;  3PYP A;  1G5U A;  1VQQ A;  3IHB A;  3KSI A;  5DF7 A;  3E0Y A;  5AVE A;  4DE1 A;  3E98 A;  2HZ5 A;  3ZGA B;  3OPL A;  2XRO A;  4YFM A;  3UO9 A;  3C30 A;  2P9V B;  4LCM A;  2HDR A;  1MZU A;  4OPQ A;  3VSL A;  3QP2 A;  4HEF A;  4ETX A;  4WN5 A;  2BLS A;  3FC7 A;  2VJW A;  5CHU A;  5GL9 A;  3Q7V A;  2OLU A;  2EX2 A;  4ZTK A;  2W3E A;  3ZG7 B;  2ZQ7 A;  1N9L A;  5CRF A;  2DCF A;  1HD8 A;  5HWW A;  3H82 B;  3RJU A;  3CWF A;  4O8G A;  4DRT A;  2ZOH A;  5KZH A;  3K3C A;  2XA7 S;  3CZD A;  3MQQ A;  1E3U A;  3MSH A;  2XA7 M;  4E3L A;  4N1X A;  3NIA A;  4E3O A;  5AQ9 A;  3M6H A;  3KYZ A;  3U2A A;  3UE6 A;  2M1C A;  3KO6 A;  5GHZ A;  3N4I A;  1NZO A;  4Q0J A;  1YMS A;  3LIC A;  5CX7 A;  5F68 A;  3FYZ A;  1OT6 A;  2W3G A;  5FEG A;  5DFX A;  3G35 A;  5A93 A;  2NUP C;  4NEE D;  4ZBE A;  5HZH A;  1JWV A;  2VEA A;  3MF0 A;  5FL3 A;  2JKF A;  1ES3 A;  3ZYT A;  5FI2 A;  1AWI A;  4FH4 A;  1YT4 A;  1SKO B;  5IHV A;  5I5L A;  4JXS A;  1RGZ A;  4S2M A;  3A3J A;  3DW0 A;  3TW8 A;  4O0P A;  3HJI A;  2WGI A;  3MZF A;  1OTI A;  3GEC A;  4E6W A;  3SW1 A;  2W1T A;  1LSV A;  5CEC A;  2XRN A;  4DE3 A;  3NEC A;  3C7V A;  3VP0 A;  4XUZ A;  2VGK A;  3MZE A;  3MQO A;  3ICY A;  4PAU A;  3RH8 B;  2I72 A;  3BLM A;  2QHK A;  1NRF A;  1GCE A;  2X02 A;  1NLY A;  1E4D A;  4JGP A;  3A3E A;  3LCE A;  5FI7 A;  2WKE A;  1UWP X;  2ZBB A;  1F5M A;  3D3O A;  3LYX A;  4FTX A;  4B93 A;  1OJ5 A;  3JVU A;  1O07 A;  2HDQ A;  4E04 A;  1PW1 A;  1BLS A;  3OC2 A;  5HWV A;  1ONH A;  4P85 A;  3OZH A;  4MMN A;  2PT7 A;  2EA9 A;  2X01 A;  3HLF A;  3S7Q A;  1K54 A;  1I2S A;  1KE0 A;  3P09 A;  5AQA A;  3P98 A;  2PHY A;  3EGX C;  3IWI A;  2PRF A;  3GVB A;  4R23 A;  1C3B A;  2DNS A;  4B9O A;  5DTK A;  2UV0 E;  5CTM A;  2ZC3 B;  5HAQ A;  2EWV A;  1CI8 A;  3BW6 A;  4HY8 A;  2FZ0 A;  1RCJ A;  1H0M A;  4NET A;  2PAV P;  4NKP A;  4UQI M;  1KGF A;  2VV8 A;  1N4O A;  2ZD8 A;  4IHQ A;  1H5X A;  4I3J A;  4S2J A;  4HP9 A;  1BTL A;  4K0W A;  3C8C A;  1IYQ A;  1PWC A;  3GV9 A;  2O0Y A;  5FQJ A;  3VV4 A;  1S1Z A;  3QP1 A;  4KG2 A;  1Y28 A;  2A24 B;  3NUL A;  5HSQ A;  4QY5 A;  3IWO A;  3OPP A;  2W3H A;  1K55 A;  2IWD A;  2ZM0 A;  5G4Z A;  4ARZ A;  1NWZ A;  1CEF A;  3PBQ A;  1SDE A;  3G2Z A;  4KQD A;  3G34 A;  3A3D A;  4IBR A;  4HP4 A;  3NBL A;  1ERO A;  1MKM A;  2HF6 A;  1ERQ A;  1N9O A;  3WS0 A;  1XXM A;  2B95 A;  2HJE A;  3G6O A;  4KZA A;  3UB8 A;  3D4F A;  2Y55 A;  3G32 A;  5E2G A;  4KZ4 A;  1YPR A;  3T1Q B;  5HAP A;  5CHJ A;  3O88 A;  2Q9N A;  3N8L A;  4X56 A;  3G2Y A;  5JYO A;  4HJ6 A;  3DBA A;  4HES A;  2ZQA A;  1CF0 A;  4FCF A;  5HW3 A;  3VE3 A;  3TSG A;  4OP5 A;  2Y8H A;  3F1P A;  5AJG A;  2Y2M A;  3A0V A;  3UY6 A;  1H8M A;  1BT5 A;  3T4O A;  2DMW A;  4DE2 A;  5EVI C;  1XJ4 A;  4BL3 A;  2WGV A;  3CUE C;  3WS1 A;  2VV6 A;  4DXC A;  4E3N A;  2LB9 A;  1CI9 A;  1YLP A;  2Y59 A;  3IF6 A;  5FQI A;  2B5R A;  3VFH A;  3LR4 A;  4DJ3 A;  2L1M A;  4EES A;  4JGO A;  2XSS A;  3MXQ A;  4FOF A;  2WZX A;  1W5D A;  4B4X A;  4KZ8 A;  1TVF A;  1T19 A;  2Y79 A;  1ZC2 A;  5HAI A;  5IT5 A;  4L9G A;  2FH5 A;  3T4K A;  4ESP A;  3BFD A;  1MWR A;  5M18 A;  1T1B A;  4PKY A;  3IH8 A;  5F1G A;  2ZMV A;  2GJ3 A;  4UA6 A;  4DDS A;  4BBU A;  4DXB A;  5FEF A;  4E3J A;  2WAD A;  5AQB A;  1ES5 A;  4WUJ A;  3T4T A;  2OWJ A;  3UN7 A;  3IBJ A;  3NCK A;  4HQA A;  3G4P A;  4GD8 A;  4UA7 A;  3TE8 A;  3C5A A;  4EBL A;  5M1A A;  1WYB A;  2XK1 A;  3BQA A;  4MN5 A;  2EXA A;  5EVL A;  1EI5 A;  3ZG0 A;  4N9L A;  3QNC A;  1K54 C;  2VGJ A;  4OOY A;  3LR5 A;  5L07 A;  1K0K A;  1OTA A;  2Y4A A;  3JPU A;  2BTF P;  2VLG A;  1T18 A;  3ISG A;  4Y3I A;  4HH2 A;  2WAE A;  1YLZ A;  4H8R A;  4F94 A;  3OBF A;  1FIL A;  3HCY A;  1LL5 A;  3ITA A;  1UGU A;  3KSH A;  3AGE A;  2WUQ A;  5HPF A;  4DF6 A;  4K08 A;  1BLC A;  4DKI A;  4R6L A;  2OWH A;  5FAO A;  3ZG8 B;  1BUE A;  2L0W A;  5BOH A;  4ID4 A;  4HIA A;  2C6W B;  3DTE A;  3T12 B;  4LFU A;  1T1A A;  3C2W A;  1MWU A;  1XA1 A;  3SH9 A;  5L10 A;  1NY0 A;  1K55 C;  4Y17 A;  2QWS A;  2R9X A;  5EM0 A;  1SHV A;  3BY8 A;  3E2L A;  3ZG9 B;  2LB5 A;  2WGW B;  2PU2 A;  2Y2K A;  2JCH A;  3IXD A;  1L3L A;  1OT9 A;  3DTM A;  2PU4 A;  2BG1 A;  4I5S A;  3CPT A;  1CEG A;  3E2K A;  4UAA A;  3LEZ A;  3HJK A;  5KIZ A;  3N8S A;  4PM8 A;  4E3K A;  3BRM A;  3A3F A;  1G6A A;  4R3J A;  1OTD A;  4QB8 A;  1DRM A;  3MFX A;  3O5Y A;  1TDL A;  4WM9 A;  4EBN A;  3DTK A;  4OLG A;  1FR6 A;  4Q8I A;  5GHX A;  4Z1W A;  3VP4 A;  5HL1 A;  2MJ6 A;  4DE0 A;  2A49 A;  1KOU A;  5MC7 A;  1YSQ A;  1XKZ A;  1FCN A;  4C6Y A;  1MBL A;  1XJ3 A;  3EQV A;  1I5Q A;  2EFX A;  2PR6 A;  4X53 A;  1OJG A;  3UMD A;  4AFI A;  4PHT A;  1LL9 A;  2VK3 A;  2Y2N A;  4FUW A;  4H6J A;  5TBM A;  4GS9 B;  1P9R A;  3ZNT A;  3E4P A;  4E3I A;  1MC0 A;  3HRE A;  2PYR A;  2Z6D A;  2D02 A;  1LSX A;  1F98 A;  3LR3 A;  4OLD A;  2EX8 A;  1ZHH B;  4EU0 A;  3FKW A;  1GHM A;  1ES2 A;  1KVM A;  2Y91 A;  3HL9 A;  1G6O A;  3BY9 A;  3ULF A;  4LV3 A;  1VEU A;  1Z09 A;  2Y2H A;  5KMW A;  2KX6 A;  2XH9 A;  2HV1 A;  4HH3 A;  5CER A;  4YIN A;  1GSV A;  4CLC A;  1IEL A;  4Y7P A;  2JBF A;  2INW A;  5F82 A;  4GB7 A;  4OP8 A;  2JKR M;  4CLC E;  4P6Z S;  2M7V A;  3W4P A;  4YNR A;  2D01 A;  3HLD A;  4P6Z M;  2H28 A;  3PBR A;  3JVV A;  4NXE A;  3A0S A;  3IX4 A;  4II7 A;  5AQ7 A;  4LPZ A;  5EVI A;  1DY6 A;  3K3D A;  4BLM A;  2W1T B;  3LY3 A;  3BFF A;  3CUE A;  1W8Q A;  3PBN A;  1OPX A;  1VET A;  2G2U A;  4N92 A;  4MLL A;  4QWO A;  3LY4 A;  1MY8 A;  2O9C A;  1K56 D;  1PRQ A;  1SCW A;  3V5M A;  4I39 A;  5HPI A;  1DJC A;  1OTE A;  4ZAM A;  2Z6C A;  3C4P A;  4UA9 A;  4M3K A;  3UDF A;  3IHA A;  4MBF A;  1U60 A;  5TJJ A;  3IWQ A;  4YOF A;  3W4O A;  4FSF A;  3QP6 A;  2ZQC A;  1XX2 A;  1YLJ A;  3HLE A;  3H7W A;  5K5B A;  5DKK A;  4X68 A;  3IXB A;  4JBF A;  3TRC A;  1WE4 A;  3FG8 A; 
#chains in the Genus database with same CATH homology
 4WLA A;  2PYP A;  5HWT A;  1BYW A;  3T50 A;  2JHE A;  4CLC B;  1YSP A;  2W27 A;  4GW9 A;  3CLO A;  4HJ6 A;  2VKS A;  4G3V A;  4DN0 A;  4ETZ A;  3EEA A;  4GHI A;  3DBA A;  1NLZ A;  4L9F A;  5F5Y A;  2L4R A;  3VE3 A;  2VGL S;  4RQ9 A;  4Y2F A;  2Y8H A;  3F1P A;  4WEJ A;  5AJG A;  3A0V A;  1H8M A;  3UB9 A;  2BAS A;  5HDC A;  2QJ7 A;  2VGL M;  3PBO A;  3T4O A;  2DMW A;  2A2L A;  1XJ4 A;  3OOV A;  4YWZ A;  4BWI A;  1TS6 A;  5C5K A;  4EEP A;  4JGQ A;  3CUE C;  3B33 A;  1XFN A;  3F1N A;  2J80 A;  2OAQ 1;  2VV6 A;  2IA2 A;  4O01 A;  4IUK A;  4LLO B;  4GJ4 A;  2LB9 A;  1S67 L;  2M7U A;  3FPW A;  4Q0H A;  4QPR A;  2B18 A;  5F69 A;  2WKP A;  3NHQ A;  3T4S A;  3V67 A;  5DJT A;  2CMN A;  3LR4 A;  4L9E A;  3LR0 A;  3P01 A;  4DJ3 A;  1DP9 A;  3S7P A;  2L1M A;  3EGD C;  3T4J A;  4BBT A;  4XT2 B;  4JGO A;  2XSS A;  4Y5F A;  3MXQ A;  4FOF A;  3PBS A;  3MR0 A;  2HGV A;  2W1R A;  4GS9 A;  1GSX A;  4UQI S;  1T19 A;  2V1A A;  5KSH A;  2PD8 A;  2Y79 A;  4NXF A;  2JKR I;  1P0Z A;  5IT5 A;  4GLQ A;  4L9G A;  2FH5 A;  3T4K A;  3S7N A;  3H7W B;  1T1B A;  2ZOI A;  4PKY A;  5HDD A;  4OOL A;  4BMW A;  2ZMV A;  1TD5 A;  1VHM A;  3KX0 X;  3T4Q A;  2GJ3 A;  3LID A;  4H6J B;  4BBU A;  4EUV A;  5HL6 A;  5DFY A;  4WUJ A;  3T4T A;  1N9N A;  1W63 M;  3OLO A;  2OWJ A;  1S4R A;  4GHI B;  1YKD A;  4HJ4 A;  3IBJ A;  1H3Q A;  4HQA A;  2P08 A;  4LRX C;  3MMH A;  3TE8 A;  3F1O A;  4MN7 A;  3F1P B;  2JKT M;  3BQA A;  4MN5 A;  4EQ1 A;  2VV7 A;  4I3I A;  2GX5 A;  2O9A A;  5J4E A;  2I9V A;  3BQ8 A;  3H82 A;  3LR5 A;  1NRJ A;  4KQO A;  4CLC C;  3F1N B;  1OTA A;  2JKT I;  3FPV A;  2K31 A;  4IUH A;  3BWL A;  2VLG A;  1T18 A;  3PBT A;  4Y3I A;  3RTY A;  4HH2 A;  1V9Y A;  1X0O A;  2QJ5 A;  4NXG A;  3D72 A;  2G7U A;  4WF0 A;  2KLI A;  3OBF A;  3A0R A;  3OCL A;  1GSW A;  3HCY A;  1OTB A;  1S1Y A;  1UGU A;  3KSH A;  2V0U A;  5HPF A;  5LBR A;  3KSG A;  4K08 A;  5G4Y A;  4F3L A;  4R6L A;  2OWH A;  2L0W A;  3GDI A;  4MN6 A;  4HIA A;  3LIA A;  4HNB A;  3H9W A;  4WEK A;  2J3T C;  2A24 A;  3UB7 A;  2WKR A;  1IFQ A;  2HJ9 C;  2O99 A;  4KUO A;  2PDR A;  5DKL A;  2OAP 1;  2GZA A;  3PYP A;  4DJ2 A;  1DP8 A;  1LT0 A;  3KSI A;  1T1A A;  4WEL A;  3E0Y A;  5AVE A;  3C2W A;  3E98 A;  4LRZ E;  3BJN A;  2XRO A;  4BBV A;  2QWS A;  1EW0 A;  4OOM A;  3C30 A;  4CQH A;  3BY8 A;  3IS2 A;  1MZU A;  2LB5 A;  4ARZ B;  4EW7 A;  1TS0 A;  2GNX A;  3NOT C;  5L8M A;  4ETX A;  4WN5 A;  3F1O B;  1OT9 A;  3FC7 A;  2VJW A;  3CIT A;  1D7E A;  3RFB A;  2V1B A;  2W3E A;  4M4X A;  1IOU A;  2O9B A;  2P04 A;  3B47 A;  4G3W A;  1N9L A;  4I5S A;  3KSF A;  4DMZ A;  5HWW A;  3LIB A;  3H82 B;  3CWF A;  1JNU A;  3HJK A;  4L0L A;  4O8G A;  3T4L A;  2ZOH A;  3MJQ A;  5KIZ A;  3E4O A;  5J3W A;  3K3C A;  2XA7 S;  3EQU A;  3MQQ A;  1S4S A;  2XA7 M;  3PXP A;  4JGR A;  1OTD A;  2W3F A;  1ODV A;  3CI6 A;  1DRM A;  4IJG A;  3MFX A;  4R38 A;  1F9I A;  3O5Y A;  3KYZ A;  3U2A A;  3UE6 A;  2M1C A;  3KO6 A;  1P9W A;  1T1C A;  4Q0J A;  5A8B A;  3UE3 A;  1TS7 A;  3LIC A;  5CX7 A;  5F68 A;  1OT6 A;  1DP6 A;  2W3G A;  4Z1W A;  3R7W A;  5DFX A;  3LI8 A;  2NUP C;  1XFQ A;  4NEE D;  3MQ0 A;  5HZH A;  2MJ6 A;  3B42 A;  2VEA A;  1XJ6 A;  1TS8 A;  1KOU A;  1VB6 A;  3MF0 A;  4HI4 A;  3LUQ A;  4XT2 A;  5FL3 A;  4EET B;  1YSQ A;  3ZYT A;  5MC7 A;  4MDZ A;  1XJ3 A;  3EQV A;  3IBR A;  5I5L A;  2PR6 A;  4HJ3 A;  1OJG A;  4O0P A;  3TW8 A;  3EEH A;  3UMD A;  3PR6 A;  4AFI A;  1W63 Q;  3HJI A;  4PHT A;  3IS2 B;  1OTI A;  5AVF A;  3GEC A;  4G3K A;  3SW1 A;  2W1T A;  1LSV A;  2WKQ A;  2XRN A;  4ME4 A;  4CLC D;  4H6J A;  3MQO A;  5TBM A;  4GS9 B;  1P9R A;  3ICY A;  3EWK A;  2P7J A;  4PAU A;  3RH8 B;  3PHY A;  3E4P A;  5HD3 A;  1MC0 A;  2QHK A;  2PYR A;  2Z6D A;  4EER A;  1NLY A;  2D02 A;  5IU1 A;  4JGP A;  4BJP A;  1LSX A;  1F98 A;  5DJU A;  3LR3 A;  1V9Z A;  2OOL A;  1STZ A;  2VA0 A;  2KDK A;  1LSW A;  2VX8 A;  1UWP X;  2ZBB A;  1ZHH B;  4EU0 A;  1F5M A;  3OCN A;  3D3O A;  3LYX A;  4B93 A;  1OJ5 A;  3JVU A;  3UME A;  1YAX A;  4E04 A;  4PKY G;  4HOI A;  3OC2 A;  2NUT C;  5HWV A;  1XJ2 A;  3UB6 A;  1G6O A;  3BY9 A;  3ULF A;  2W3D A;  3P7N A;  2J3T D;  4HHD A;  4KUK A;  3LIF A;  4MMN A;  2PT7 A;  2EA9 A;  2K7S A;  1UWN X;  3R4K A;  5IS1 A;  3CAX A;  3S7O A;  3S7Q A;  4UEY A;  2KX6 A;  2J3W A;  2HV1 A;  4HH3 A;  4CLC A;  1GSV A;  3LIE A;  1LL8 A;  2PHY A;  2INW A;  3EGX C;  2R78 A;  3R7W B;  1D06 A;  4GCZ A;  4B9O A;  2JKR M;  4CLC E;  4P6Z S;  2M7V A;  3C38 A;  2PR5 A;  3NJA A;  4NXB A;  4YNR A;  2YKF A;  4EXO A;  4WL9 A;  2D01 A;  2KOI A;  2H28 A;  4P6Z M;  5HDS A;  3PBR A;  3JVV A;  2QKP A;  4MCW A;  3EOI A;  4NXE A;  2EWV A;  2K2N A;  3VOL A;  3BW6 A;  2PD7 A;  4HY8 A;  4I38 A;  2FZ0 A;  3A0S A;  4II7 A;  2JN7 A;  4NKP A;  4UQI M;  4Q0I A;  4LPZ A;  2VV8 A;  2QYB A;  3K2N A;  1P97 A;  1WA9 A;  4IHQ A;  3K3D A;  4I3J A;  1TF1 A;  4HP9 A;  2W1T B;  2W0N A;  3C8C A;  3CUE A;  5J7E A;  3PBN A;  3TJZ C;  1OPX A;  4F3L B;  2O0Y A;  3E4Q A;  3NOU C;  5DF9 A;  3VV4 A;  2YKH A;  1S1Z A;  5TBM B;  1Y28 A;  2A24 B;  5F6A A;  2O9C A;  3ZQ5 A;  3LI9 A;  5HSQ A;  4I39 A;  5HPI A;  1OTE A;  2B02 A;  3KYQ A;  4I3A A;  2W3H A;  4LRY C;  5G4Z A;  4ARZ A;  1NWZ A;  3NOP C;  2Z6C A;  1G28 A;  4R70 A;  3PBQ A;  4EES A;  4KQD A;  1ZTU A;  4R3A A;  4EEU A;  5EFW A;  5TJJ A;  4HP4 A;  2EWW A;  4YOF A;  1MKM A;  4FSF A;  2HF6 A;  1N9O A;  3VE4 A;  3H7W A;  2ZMF A;  3W2Z A;  1S66 L;  5K5B A;  2V9A A;  2HJE A;  3G6O A;  2VZW A;  2V0W A;  5DKK A;  5HD5 A;  3LFV A;  3UB8 A;  4ZRR A;  3TRC A;  3FG8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...