1G28A

Structure of a flavin-binding domain, lov2, from the chimeric phytochrome/phototropin photoreceptor phy3
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
104
structure length
104
Chain Sequence
KSFVITDPRLPDNPIIFASDRFLELTEYTREEVLGNNCRFLQGRGTDRKAVQLIRDAVKEQRDVTVQVLNYTKGGRAFWNLFHLQVMRDENGDVQYFIGVQQEM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of a flavin-binding plant photoreceptor domain: insights into light-mediated signal transduction
pubmed doi rcsb
molecule keywords PHY3 PROTEIN
molecule tags Signaling protein, electron transport
source organism Adiantum capillus-veneris
total genus 29
structure length 104
sequence length 104
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-10-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1g28A00
3ZQ5A 2JN7A 4K08A 3UB8A 4BBVA 4E04A 3F1OA 2QHKA 4KUOA 2A24A 1NWZA 4WN5A 2PYRA 2V0UA 1TS6A 3NOTC 3E4PA 1T18A 1S66L 3F1PB 3K3CA 4EEUA 4NXEA 1ODVA 4HH3A 3VOLA 1LL8A 5DKLA 3LIDA 4I39A 2KDKA 2V1BA 3H82A 5HD5A 4LRYC 4KQDA 3F1NB 5HZHA 4H6JA 4WF0A 4HH2A 2PHYA 4EETB 3F1OB 1OTEA 5J4EA 2KX6A 3VE4A 5F5YA 1XJ3A 1T1AA 5AVFA 3SW1A 2W0NA 4R70A 1TS7A 4GW9A 4HP9A 2PR5A 3LIBA 2J80A 3RH8B 3VE3A 3H82B 4LPZA 1F9IA 1WA9A 4H6JB 3K3DA 1LSVA 5G4ZA 5HD3A 2L0WA 2VEAA 1OT9A 3KX0X 4LRXC 2H28A 2PD8A 1P97A 3MQOA 4L9GA 2I9VA 4L9EA 2JHEA 4EEPA 3FG8A 3G6OA 1TS8A 2W27A 1TS0A 3IBRA 1T1BA 4DJ2A 1N9LA 3GDIA 5A8BA 1UWPX 4I3IA 2K7SA 1V9ZA 2YKFA 4JGQA 4HJ4A 4B9OA 1OTAA 2BASA 2VV8A 3F1NA 2WKQA 3P7NA 4WLAA 4BBTA 2GJ3A 5HWTA 1LT0A 2Z6DA 3MXQA 4HJ3A 3UB9A 4NXFA 3PHYA 1P0ZA 3LIEA 4R3AA 4MN6A 3BWLA 4PKYG 4L9FA 3CWFA 2VV6A 3RTYA 4GCZA 1MZUA 1GSVA 1N9OA 2M1CA 1S67L 5HDCA 3E4QA 4HY8A 5F6AA 4BBUA 1Y28A 2QJ7A 1GSWA 2D01A 3C2WA 3BY8A 3LIAA 1OTBA 2OWJA 4GHIA 2Z6CA 4R6LA 4JGOA 4R38A 3UMDA 1DP9A 4HI4A 3MFXA 3OLOA 2WKPA 2QKPA 2INWA 4EESA 4JGPA 5HDDA 5IU1A 5IS1A 1OTDA 1F98A 3NOPC 4XT2B 4HQAA 3UE6A 3MJQA 3UB6A 2V9AA 2ZOIA 5DKKA 3H9WA 1S4SA 3EEHA 3E4OA 1JNUA 1EW0A 4GHIB 4LRZE 1BYWA 3BY9A 2PYPA 1GSXA 3HJIA 1KOUA 1UGUA 5F69A 3PYPA 1D06A 4I3JA 3NHQA 2ZOHA 1DRMA 4HP4A 3H7WA 3ICYA 3A0VA 3LIFA 4MN5A 4F3LA 5AVEA 1XFQA 2P7JA 3CLOA 4I5SA 4EW7A 1V9YA 3HJKA 4EERA 1XJ6A 4EXOA 5DJUA 1OT6A 2EA9A 5DJTA 2L4RA 2D02A 3CAXA 2V1AA 3H7WB 4JGRA 2VLGA 4F3LB 2QWSA 3B33A 3IS2A 3MR0A 5J7EA 1XJ4A 3ULFA 5J3WA 2L1MA 1S1ZA 3LYXA 1LSWA 5G4YA 3C8CA 2HV1A 2YKHA 5HDSA 2CMNA 4XT2A 3LUQA 5HWWA 4LLOB 5TBMB 1VB6A 1XFNA 3LICA 1T1CA 5HSQA 1DP6A 1S1YA 1DP8A 3A0RA 2R78A 2V0WA 4HJ6A 1LSXA 4YWZA 2B02A 2A24B 4I3AA 3IS2B 1N9NA 2VV7A 3D72A 1G28A 2ZBBA 4NXBA 2OWHA 4WUJA 4I38A 1X0OA 1OJ5A 1OTIA 5I5LA 4RQ9A 4GS9A 3FC7A 3NOUC 4PKYA 4DJ3A 4HHDA 3T50A 1UWNX 1XJ2A 5EFWA 2PD7A 1D7EA 3A0SA 3UMEA 4KUKA 5HWVA 3GECA 4EQ1A 4WL9A 1T19A 3NJAA 2PDRA 4NXGA 3MQQA 4GS9B 3UB7A 5KIZA 3F1PA 2OOLA 5F68A 3LI9A 4M4XA 5TBMA 2QJ5A 2PR6A 1S4RA 2WKRA 4HOIA 1OJGA 3EWKA 3LI8A 4HIAA 4HNBA
chains in the Genus database with same CATH superfamily
2OAP1 1G6OA 3KO6A 2Y2HA 3WRZA 1CQAA 4FCFA 3KSFA 4KUOA 1YM1A 2A24A 5TGFA 1N4OA 2PYRA 4U0XA 2V0UA 5EE8A 2VKSA 5F1FA 1TS6A 5FA7A 1T18A 1S66L 3K3CA 1K57A 2DNSA 1MBLA 4KZAA 1XGIA 4BJPA 1RGYA 4E6XA 3LIDA 3O87A 5U47A 1G68A 2DRWA 2V1BA 5HD5A 3ZFZA 5DTTA 1OPXA 2X71A 4ZTKA 4HH2A 3S7OA 3IF6B 2E8JA 3V5MA 4R1GA 2KX6A 3VE4A 3GQZA 3SW1A 3KYQA 1TS7A 3S1YA 4HP9A 5EUAA 2J9OA 3EQUA 4GDNA 4DMZA 1AWIA 5F1GA 4B4ZA 3FKVA 3SS3A 1FCNA 3E98A 2VK3A 5AQAA 3VE3A 2UV0E 2EX9A 3B3XA 4ZJ3A 3QNBA 3E0YA 3UPNA 3Q81A 4P85A 4Y0UA 2VEAA 1NRFA 2Y2QA 4KENB 2W3GA 3VP3A 1XGJA 2Y2JA 2XD1A 2VA0A 3HREA 5FQKA 3FV7A 4LV1A 2I9VA 2JHEA 1Y4OA 4EEPA 4WEJA 3DTEA 2G2WA 3IBRA 5M19A 3W4QA 1N9LA 5IT5A 1VEUB 4P6ZM 5FAOA 4K0WA 4HJ4A 4B9OA 4MN7A 2WAEA 3PTEA 3F1NA 2VV8A 4B93A 2Y2GA 1FOFA 2GJ3A 1FR6A 1XA7A 3W4OA 3MXQA 4LV3A 4Z1WA 4OQGA 4DDSA 4HBUA 4UQIM 3C7VA 4ETXA 1BUEA 5A92A 1HD8A 3RTYA 3JYIA 5FATA 4MDZA 5AQBA 3IWQA 1KDSA 2BLSA 2M1CA 1S67L 1PFLA 3E4QA 4UHUA 4N1HA 4CQHA 2EX2A 5EPHA 1YSPA 1NLZA 1DJBA 5EOOA 4MCWA 1PI4A 4ME4A 3E2KA 4BMWA 3BY8A 2OWJA 3D9YA 4GHIA 1MKIA 5FQ9A 5HX9A 3TJZC 3P09A 2Z6CA 3T4QA 1DP9A 2WK0A 4XUXA 5KMWA 1H8YA 3HLDA 1TDGA 5FASA 2XR0A 1K54A 2JKGA 2ZQAA 2Y79A 4WYYA 3UN7A 4JXGA 4JGPA 3Q07A 5IU1A 2W1RA 1OTDA 2W3FA 1K4EA 3GTCA 1PRQA 3IXHA 3UB6A 2ZOIA 5DKKA 3G30A 3IXDA 4OOYA 3EEHA 4EV4A 1W63M 3E4OA 4GHIB 1EW0A 3HBRA 3N8LA 2PYPA 3IX4A 2GNXA 3FYZA 4ZRRA 3T12B 1Y54A 1KOUA 1UGUA 2ZC5B 3IX8A 4DXCA 1CF0A 3PYPA 2XFSA 4I3JA 1NZUA 3PAEA 1LI9A 3IT9A 2ZMVA 4Y5FA 2V2FF 2H10A 3V67A 3S7PA 3ZDJA 4F3LA 4YFMA 5AVEA 3IXBA 2HGVA 3DTIA 2P7JA 3C38A 1Z09A 5M1AA 2GDNA 5DVAA 2ZM2A 3MZFA 1YPRA 5E2FA 2J3TD 3PBQA 4GJ4A 4O7DA 5DJUA 3OC2A 3CITA 1YT4A 2ZM0A 3LR0A 3SH8A 4IVIA 2L4RA 3BQAA 1QMFA 4S2JA 2JKFA 2ZMFA 4OOLA 2X01A 4GKUA 4OPQA 3L7HA 2DMWA 4F3LB 4JXSA 2QWSA 4P0MA 2J8YA 1IELA 1KVMA 3UPOA 1ZHHB 2L1MA 1H8ZA 3VOZA 5G4YA 3BFCA 2WKEA 2J3WA 1PZPA 4XT2A 3BYDA 5HAIA 3IF5A 3WS0A 1TF1A 2IA2A 5HSQA 4C6YA 1DP6A 3OCNA 4S2LA 4S2OA 2NUTC 1XXMA 4MBHA 2GZAA 3MKFA 4QU3A 5HL1A 5CHUA 3N8SA 3WS5A 2V0WA 2OSUA 3BRMA 3NBLA 1ZTUA 5GHZA 1IYQA 3ZG9B 4I3AA 1FIKA 2ZC3B 3HCYA 4QWOA 3G2YA 5EVIA 1YLTA 2VGJA 1VETA 3I7JA 1G28A 3ITAA 4P6ZS 1SDNA 5EV0A 3MF0A 1XKZA 3ZVTA 5CTNA 2G2UA 1OJ5A 2XH9A 5I5LA 5CX7A 3RJUA 3V39A 4EQIA 3TRCA 3NOUC 4PKYA 2JC7A 3PBRA 2Y55A 2HP9A 1XP4A 5M18A 2XROA 4OVDA 4WEKA 4OONA 4Y15A 2PD7A 1JWZA 4PAUA 5EVIB 4KZ9A 1VETB 3GECA 3NCKA 1E4DA 3C7UA 1M6KA 1CI9A 2C6WB 1BT5A 1L0FA 3BFFA 2EXAA 3NI9A 1ES3A 2ZM8A 3F1PA 4GNUA 3UY6A 3BW6A 4M4XA 1I2WA 4JPMA 1ACFA 4IHQA 3LY4A 4HOIA 1OJGA 4R3BA 4QHCA 2EFXA 2ZC7A 4M3KA 2X02A 1DY6A 4E3OA 2O9AA 3N8RA 4JLFA 3ZCZA 3F1OA 4L0LA 2WYXA 2V8FA 1NWZA 4Y3IA 3HL9A 2ZL1A 1CJFA 3NOTC 3CMZA 3E4PA 3PXPA 4EEUA 3F1PB 2Z2LB 2ZQCA 1PIOA 2HDRA 2V20A 3EQVA 1ODVA 3G31A 3LO7A 4UA6A 3HLBA 4I39A 2KDKA 3OBFA 1DJCA 3H82A 3PBTA 4LRYC 4KQDA 3TG9A 4FUWA 3CUEA 2PBYA 2BTFP 3K2NA 3F1OB 1E3UD 4G3KA 1PNEA 5F5YA 2ZL1B 3CI6A 3JPUA 4EBPA 1KGFA 1YSQA 1KE3A 4MBFA 3D4FA 1ES2A 1XX2A 5DFYA 4DN0A 3HUMA 3UDFA 4S2MA 5CEBA 3T4TA 3BM6A 5FQQA 3H82B 3PBNA 5E2GA 1F9IA 1O07A 1WA9A 2WKHA 3GR2A 3K3DA 1LSVA 2L0WA 4HEFA 1OT9A 5HPFA 4BENA 2XA7M 4LRXC 5L2FA 4ZJ1A 2H28A 4X55A 2A3UA 3T1RA 3G4PA 4YNRA 3MQOA 4L9GA 4KG2A 1TEMA 3PAGA 1O7EA 1TS8A 2H0TA 3T4JA 1TS0A 2W1TB 2O9CA 1F2KA 3FPWA 5DTKA 3TSGA 4DJ2A 4S2NC 1H5XA 3SOIA 1UWPX 2EX6A 2JKTM 3FWLA 1V9ZA 3Q7VA 3HLCA 1RP5A 3NY4A 2PT7A 3BEBA 4UA9A 4BBTA 4GDBA 1ERMA 2ZLYA 4N1XA 3IF6A 3OPRA 5HWTA 2PU2A 1GA0A 3ISGA 3UPPA 2C5WB 3DTKA 3PHYA 2J3TC 3LIEA 3VP0A 4ARZA 3QP2A 4MN6A 3O3VA 2Y2OA 1MWRA 5A91A 5CEDA 3KSHA 3CWFA 3Q7VB 3BFGA 2A2LA 1NYYA 1GSVA 1N9OA 5HDCA 1TDLA 2M7VA 4RX3A 2VGKA 5GL9A 3VFHA 4OQIA 1Y28A 3MMHA 3IH8A 3LEZA 2D01A 3C2WA 3G32A 2W3HA 4CLCA 4UA7A 3B47A 3LIAA 4ARZB 3CG5A 1VHMA 4B88A 2JBFA 4NG2A 1K56D 3CPTA 4ETZA 4R6LA 1FSYA 4JGOA 4AFIA 4WZ4A 4HI4A 3MFXA 3G2ZA 1PW1A 3S22A 5JYOA 2QYBA 1WYCA 4QD4A 2QKPA 3OOVA 4OP8A 4U0TA 5L09A 1VEUA 1K38A 5EVEA 3B42A 3ZG0A 1F98A 3NOPC 3VMAA 3GSGA 4CPKA 3MXRA 4CLCB 3VP2A 1IKIA 3HUOA 1NJ4A 3H9WA 1ES4A 3IHAA 3CJMA 1Z6FA 3C4OA 1MWUA 3CPTB 4JF4A 3QP8A 1FCMA 1YQSA 4EBLA 5F69A 3VP1A 1GHMA 3NHQA 3SS4A 2CC1A 3WWXA 3NIAA 1TD5A 5FQMA 3MKEA 4KG6A 3W4PA 3M6HA 4MN5A 3GVBA 3T4OA 2ZQDA 1W79A 4WMCA 4EW7A 4X1LA 3HJKA 5CGWA 4QB8A 4NEED 4PM7A 4RVAA 1BLSA 5E43A 4WZ5C 1KE0A 4EERA 1BULA 2EA9A 1ONGA 2Q9NA 3VOYA 5LBRA 1RGZA 3UB5P 4WELA 3MZEA 1ZG6A 2PAVP 2O0YA 3DW0A 5EECA 3UE1A 2FFYA 4NK3A 3RFBA 4LENA 5DTSA 1PI5A 2VLGA 3B33A 3MR0A 2ZD8A 1F5MA 1XJ4A 2Y2IA 4GD8A 2Q0OA 3W2ZA 2ZQ9A 4JF5A 4X68A 1XA1A 4KZ5A 2YKHA 5TR7A 2XA7S 2XDMA 3EEAA 5HL6A 4Q0HA 2GX5A 1VB6A 2ZC6B 1XFNA 5EVLA 3T1QB 4EUVA 1T1CA 1W8QA 1LL5A 3PR6A 2XEPA 3S7NA 3A3DA 3SH7A 4IBRA 3DBAA 2RL3A 2B02A 3ZG8B 5FEFA 4N9LA 5KZHA 1N9NA 1QMEA 5FAQA 3D72A 2IWBA 1MY8A 2Y8HA 5HFOA 5CHJA 4BLMA 4KQRA 1BLCA 1WYBA 3ZG7B 4HBTA 4PM9A 3QP1A 1OTIA 4IJGA 1AXBA 5GLAA 4WM9A 3UNWA 2O99A 4DJ3A 4E3MA 3MXSA 4DE2A 1XJ2A 5K5BA 4DE0A 3IBJA 3HUNA 5HWVA 4EQ1A 1T19A 3TW8A 2HDQA 4EU0A 2PU4A 3MQQA 1YLWA 1U60A 5KIZA 2FZ0A 2OAQ1 2OLVA 4GZBA 5F68A 3O86A 2LB5A 2QJ5A 2J9PA 2WKRA 2I72A 3EWKA 3LR3A 3M6BA 2V1ZA 4JKTA 1JWPA 3JVUA 3ZQ5A 2JN7A 4K08A 3UB8A 4BBVA 3U2AA 2QZ6A 2QHKA 1FR1A 1PWDA 5EOEA 2EFUA 2E8IA 1ES5A 4UEYA 4WN5A 1MWSA 1W63Q 3P01A 3IQAA 5FAPA 2Y2PA 5HAQA 5F83A 4NXEA 3WS1A 4PM8A 2A49A 4DKIA 4Q0IA 1KGEA 4E6WA 5DKLA 3OCLA 4X6TA 1YAXA 1L0GA 2Y59A 5HZHA 4KZ7A 2JKRM 4WF0A 1PW8A 5L10A 3W8KA 1OTEA 1DJAA 1MKMA 1XJ3A 1T1AA 1EI5A 2JCHA 1IOUA 2W0NA 3Q82A 3EGXC 3IWIA 4LFUA 5CRFA 3QP5A 4GW9A 4LCMA 2WGIA 1ESIA 4XXRA 5CERA 5FSRA 2WZZA 4GB7A 1CEGA 2PR5A 2HJ9C 3G35A 2QMIA 2J80A 4LPZA 4KQQA 4FTXA 5E2HA 4JXVA 4HESA 5HD3A 3T4LA 3ZGAB 1WE4A 4X25A 1YLPA 2G7UA 4OH0A 5FI7A 4UQIS 1K55C 1NLYA 2PD8A 5GHYA 1P97A 2ZC4B 3EGDC 3HLGA 4L9EA 4QY5A 1HZOA 3BLSA 3E2LA 1YMSA 4OPZA 3FG8A 3G6OA 4G3VA 5CGSA 4DRTA 5I94A 2NUPC 3BFEA 2P9VB 4FSFA 1T1BA 3LR5A 5AQ7A 3T1XA 3PBOA 3GDIA 5A8BA 4YOFA 4DE1A 4OOMA 4BWIA 2VGLM 4JGQA 4PM5A 3GV9A 4P87A 4R3JA 2H5SA 2RCXA 4WLAA 1XPBA 4OKPA 4OPYA 4BL2A 1LT0A 4ID4A 1K57C 4GD6A 1GA9A 4Y0OA 5L07A 1P0ZA 4QJGA 3MS6A 2PBDP 4R4SA 4MNRA 1IYPA 3BWLA 2IWCA 1H8MA 4JXWA 2ZJ9A 2VV6A 4O0PA 1S6RA 2ZMAA 5EVID 4GCZA 3HLWA 5JYPA 1MZUA 5AJGA 5CECA 1HLUP 1FQGA 2QJ7A 4ZDXA 2WGWB 3ITBA 2XFTA 2V8CA 2JKTI 2Y2NA 4R38A 3C5AA 3UMDA 5GHXA 3LR4A 2W1TA 2P08A 4R4RA 3FZCA 2JE5A 2INWA 2HP5A 5IS1A 4KZ8A 3VSKA 2V9AA 5G18A 5L8MA 3IXGA 3M2KA 5A93A 4KZBA 1JNUA 4ZBEA 3R7WA 3BY9A 3Q1FA 2B95A 2UWXA 2WADA 4Y0TA 3HJIA 1MWTA 4GOGA 1H0MA 1FCOA 1D06A 4NKPA 2ZOHA 1DRMA 3NULA 4HP4A 2Q9MA 3ICYA 2VZWA 3A0VA 1RCJA 2EXBA 1BLHA 3LIFA 4LV2A 2XSSA 1IYOA 1K25A 4S2PA 3OZHA 3Q7ZA 4X69A 1XFQA 3CLOA 4I5SA 1V9YA 1A0KA 4DXBA 1ESUA 2P04A 2R9XA 4F94A 3R7WB 3JVVA 4N92A 1XJ6A 4EXOA 4Y7PA 5DJTA 3N6IA 2D02A 4Y17A 5E2EA 4JGRA 3ZG5A 2DCFA 2K2NA 2XRNA 1BZAA 3IS2A 5J7EA 1L0DA 2VJWA 1YLYA 1J9MA 1LSWA 1PWGA 4OQHA 3C8CA 1I5QA 4WBGA 2HV1A 2XGNA 2CMNA 5HWWA 4LLOB 5TBMB 1IKGA 4D2OA 1CI8A 2Z2MB 1S1YA 3OPPA 5FI2A 1K54C 1JWVA 4GN2A 1DP8A 2R78A 5EM0A 3M2JA 1LSXA 1ZG4A 4YWZA 5GLBA 2A24B 3IS2B 2HPBA 3NDGA 3KSGA 3LFVA 3LY3A 2OV5A 5DFXA 1G5UA 2R9WA 2ZBBA 3C4PA 3VV4A 3RXWA 5FEGA 4NXBA 1IEMA 1GHIA 2B5RA 4WUJA 1NY0A 4I38A 2VGLS 4N9KA 3LCEA 3DTMA 3IHBA 1P9RA 2J7VA 1D1JA 3QNCA 1BLPA 4GS9A 1NYMA 2EX8A 2QPNA 3FC7A 2HDUA 4X1MA 4HHDA 5TJJA 4ZJ2A 1NXYA 4YINA 1ZC2A 4IVKA 1K6SA 3A0SA 3QHYA 1SKFA 3OPLA 2KLIA 5HW3A 2ZQ8A 5KSHA 3NJAA 5CHMA 4OLDA 2PDRA 3BFDA 3MSHA 4KG5A 3GMWA 5HARA 1SCWA 3P98A 2XQZA 1P9WA 4GS9B 3HLEA 3LI9A 3QP4A 4II7A 2PR6A 1S4RA 2LB9A 4GLQA 5FQIA 5C5KA 3MFDA 1CEFA 3LI8A 2BG1A 4S2NA 4HNBA 2OLUA 4LGWA 4E04A 3IX3A 3UO9A 4CLCD 2XF3A 4DF6A 1L3LA 3ZYTA 2KOIA 2Y2LA 1YMXA 4DDYA 4S2KA 3MZDA 4MMNA 3RXXA 4HH3A 3UE3A 2XD5A 1MXOA 1LL8A 3VOLA 1OMEA 1J3WA 5EVIC 2IWDA 3F1NB 4O8GA 4BL3A 3DWKA 4H6JA 4RYEA 1Q2QA 3UDXA 2PHYA 4EETB 1YKDA 5J4EA 5AVFA 3VP4A 2P74A 4R70A 1HTZA 5GLDA 3V3SA 3U4LP 3IWOA 3AGEA 4KZ3A 3LIBA 3RH8B 4OPRA 3NDEA 3VFFA 4B4XA 3NC8A 2MJ6A 5CXWA 2M7UA 1I2SA 1W5DA 4H6JB 5G4ZA 2H0YA 4WMCD 4E3IA 1LI0A 1N9BA 4E3NA 4MLLA 3SH9A 3KX0X 4K91A 4Q8IA 4IUHA 2VX8A 4BQMA 4OQ0A 2FFFB 1YLJA 4X53A 3BQ8A 4E3KA 3D3OA 5A90A 5J8XA 3BLMA 1PWCA 3A3FA 1VQQA 4KZ4A 5HAPA 2W27A 4Z9QA 2JKRI 3R4KA 1H3QA 4KZ6A 3ZNTA 2O9BA 4I3IA 2K7SA 2HZ5A 1K6RA 2YKFA 5MC7A 1OTAA 4LCLA 3MQ0A 1LLBA 2BASA 2HJEA 1NRJA 2WKQA 3P7NA 2WAFA 3A3EA 4E3JA 3KSIA 1FILA 2Z6DA 4ESPA 4HJ3A 1LHYA 5CTMA 2W3EA 4NXFA 3UB9A 2HP6A 1VM1A 3CZDA 1STZA 4PMAA 2HDSA 4R3AA 3BECA 5DF7A 3ZHHA 4PKYG 3C30A 3CUEC 4L9FA 4PM6A 4WZ5A 3T1SA 2W3DA 3A3IA 3EOIA 4NETA 3WRTA 1PYYA 4HY8A 4OP5A 1SKOA 3SS5A 5F6AA 4BBUA 4P6BA 3ZNYA 5BOHA 1PZOA 1ERQA 1GSWA 4X56A 5FL3A 5KSCA 4CJNA 4LV0A 2Y4AA 1OTBA 4UAAA 2K31A 4D60A 4XUZA 5F82A 3WS2A 5TFQA 5CGXA 3V50A 4PHTA 3DAVA 3OLOA 2P9VA 2XLNA 2WKPA 1L0EA 3QP6A 1SZVA 3N4IA 5EM1A 3ZVWA 4R0QA 1IFQA 5AQ9A 5FI6A 3A3JA 5DF8A 4EESA 1SKOB 3AGDA 5HDDA 1ZKJA 2XK1A 4IBXA 4XT2B 2Y2KA 4HQAA 4KQOA 3UE6A 4FOFA 4G3WA 3MJQA 1E3UA 1KDWA 1S4SA 4LRZE 1BYWA 3SZTA 1GSXA 3OPHA 1EWZA 2HF6A 4JF6A 1ALQA 2PRFA 4MBKA 3FKWA 3L9KA 1LL9A 3VSLA 4CLCE 1KGGA 4R23A 1JVJA 3H7WA 3IF6C 4RX2A 1E25A 4K0XA 4DE3A 3V3RA 1JTDA 3UE0A 1W8YA 2WKIA 3HLFA 5FDSA 4C75A 1HVBA 1OT6A 2WGWA 3TE8A 3TOIA 5DF9A 3AGFA 1K4FA 3CAXA 3S7QA 4FD8A 1SHVA 1G6AA 1SDEA 4FH2A 4E3LA 2WZXA 5HPIA 2V1AA 1TVFA 3H7WB 2ACGA 3LEQA 4RA7A 2FH5A 1EROA 1M40A 4ZAMA 3FPVA 4U3TA 2Y91A 4BD1A 1W7FA 4CLCC 3ULFA 5J3WA 1S1ZA 3LYXA 4QY6A 5HDSA 3LUQA 5FQJA 1Q2PA 2B18A 4IUKA 4OLGA 3O5YA 3LICA 4EBNA 4Q0JA 3IH9A 4H8RA 2EWWA 2WGVA 4PPRA 1MC0A 1NZOA 2WUQA 1K0KA 3A0RA 4HJ6A 2EWVA 1MPLA 1L2SA 2VV7A 1C3BA 5GLCA 2OWHA 4IEDA 1GCEA 3CHWP 1X0OA 3WS4A 4MEZA 3GRJA 2AVXA 3KYZA 1YLZA 2ZQ7A 4RQ9A 3DWZA 3O88A 1BTLA 4O01A 3LGOA 1IYSA 3HVFA 1CK3A 5D3OA 3T50A 1K56A 1UWNX 3S4XA 4Y13A 1KVLA 5EFWA 3G34A 3BJNA 1D7EA 3T4KA 1ONHA 3KYEA 3UMEA 1KE4A 4KUKA 4JBFA 4S2IA 4WL9A 4A5RA 1BSGA 1FSWA 2Y2MA 4C3QA 3PBSA 3MBZA 4NXGA 1JTGA 4FH4A 5FDHA 1K55A 4EWFA 3UB7A 1S0WA 2OOLA 5IHVA 1GHPA 3UDIA 3N7WA 5TBMA 4QPRA 4EUZA 4BD0A 4Y2FA 3T4SA 4HIAA 3NECA
chains in the Genus database with same CATH topology
3ZQ5A 2OAP1 2JN7A 1G6OA 2O9AA 4K08A 3UB8A 4BBVA 4E04A 3KO6A 3U2AA 3F1OA 4CLCD 2QHKA 4L0LA 3KSFA 4KUOA 2A24A 1NWZA 4Y3IA 4UEYA 4WN5A 2PYRA 3ZYTA 2V0UA 1W63Q 2VKSA 3P01A 1TS6A 2KOIA 3NOTC 3E4PA 1T18A 3PXPA 1S66L 3F1PB 3K3CA 4EEUA 4MMNA 4NXEA 3EQVA 1ODVA 4HH3A 3UE3A 4Q0IA 4BJPA 3VOLA 1LL8A 5DKLA 3LIDA 3OCLA 4I39A 2KDKA 1YAXA 3OBFA 2V1BA 3H82A 3PBTA 5HD5A 4LRYC 4KQDA 1OPXA 3F1NB 4O8GA 5HZHA 3CUEA 2JKRM 4H6JA 4WF0A 3K2NA 4HH2A 2PHYA 3S7OA 4EETB 3F1OB 1YKDA 1OTEA 5J4EA 4G3KA 2KX6A 1MKMA 3VE4A 5F5YA 1XJ3A 1T1AA 3CI6A 5AVFA 3SW1A 1IOUA 1YSQA 2W0NA 4R70A 3KYQA 1TS7A 3EGXC 4GW9A 4HP9A 5DFYA 4DN0A 3EQUA 4DMZA 2PR5A 2HJ9C 3E98A 3LIBA 2J80A 3T4TA 3RH8B 3VE3A 3H82B 3PBNA 4LPZA 1F9IA 1WA9A 2MJ6A 2M7UA 3E0YA 4H6JB 3K3DA 1LSVA 5G4ZA 5HD3A 3T4LA 2L0WA 2VEAA 1OT9A 5HPFA 2G7UA 3KX0X 2XA7M 2W3GA 4LRXC 2H28A 4IUHA 4UQIS 2VX8A 2PD8A 1NLYA 2VA0A 1P97A 4YNRA 3EGDC 3MQOA 4L9GA 2I9VA 4L9EA 3BQ8A 2JHEA 3D3OA 4EEPA 3FG8A 3G6OA 4G3VA 1TS8A 2NUPC 3T4JA 4WEJA 2W27A 1TS0A 4FSFA 2W1TB 3IBRA 1T1BA 3LR5A 2O9CA 2JKRI 4DJ2A 3FPWA 3R4KA 1H3QA 3PBOA 1N9LA 3GDIA 5A8BA 5IT5A 2O9BA 4YOFA 1UWPX 4I3IA 2K7SA 4OOMA 4BWIA 2JKTM 4P6ZM 1V9ZA 2VGLM 2YKFA 4JGQA 5MC7A 4HJ4A 4B9OA 4MN7A 1OTAA 3MQ0A 2BASA 2HJEA 2VV8A 3F1NA 1NRJA 2WKQA 4B93A 2PT7A 3P7NA 4WLAA 4BBTA 2GJ3A 5HWTA 1LT0A 3KSIA 2Z6DA 3MXQA 4HJ3A 2W3EA 4NXFA 3UB9A 3PHYA 2J3TC 1P0ZA 4Z1WA 3LIEA 1STZA 4ARZA 4R3AA 4MN6A 4UQIM 3BWLA 4ETXA 3KSHA 3C30A 3CUEC 4PKYG 1H8MA 4L9FA 3CWFA 2W3DA 2VV6A 4O0PA 3RTYA 3EOIA 4MDZA 4GCZA 2A2LA 1MZUA 5AJGA 1GSVA 1N9OA 2M1CA 1S67L 5HDCA 3E4QA 2M7VA 4CQHA 4HY8A 1YSPA 1NLZA 5F6AA 4BBUA 1Y28A 3MMHA 4MCWA 2QJ7A 1GSWA 2D01A 4ME4A 3C2WA 2W3HA 5FL3A 4CLCA 4BMWA 3BY8A 3B47A 3LIAA 1OTBA 2OWJA 4ARZB 2K31A 1VHMA 2JKTI 4GHIA 4ETZA 3TJZC 3T4QA 2Z6CA 4R6LA 4JGOA 4R38A 3UMDA 4AFIA 1DP9A 4PHTA 4HI4A 3MFXA 3OLOA 3LR4A 2W1TA 2P08A 2QYBA 2WKPA 2QKPA 2INWA 3OOVA 1IFQA 3B42A 2Y79A 4EESA 4JGPA 5HDDA 5IU1A 2W1RA 5IS1A 1OTDA 1F98A 3NOPC 4XT2B 2W3FA 4HQAA 4KQOA 3UE6A 4FOFA 4G3WA 3MJQA 4CLCB 3UB6A 2V9AA 2ZOIA 5DKKA 5L8MA 3H9WA 1S4SA 3EEHA 1W63M 3E4OA 1JNUA 1EW0A 4GHIB 4LRZE 1BYWA 3R7WA 3BY9A 2PYPA 1GSXA 2GNXA 3HJIA 4ZRRA 1KOUA 1UGUA 2HF6A 5F69A 3PYPA 1D06A 4I3JA 4NKPA 3NHQA 2ZOHA 4CLCE 1DRMA 4HP4A 3H7WA 1TD5A 3ICYA 2ZMVA 4Y5FA 2VZWA 3A0VA 3V67A 3LIFA 3S7PA 4MN5A 2XSSA 4F3LA 5AVEA 2HGVA 3T4OA 1XFQA 2P7JA 3C38A 3CLOA 4I5SA 4EW7A 1V9YA 3HJKA 4NEED 2P04A 2J3TD 3PBQA 4GJ4A 3R7WB 3JVVA 4EERA 1XJ6A 4EXOA 5DJUA 1OT6A 3OC2A 2EA9A 3TE8A 3CITA 5DJTA 5DF9A 5LBRA 3LR0A 4WELA 2L4RA 2D02A 3BQAA 3CAXA 3S7QA 2O0YA 2ZMFA 5HPIA 2V1AA 4OOLA 3H7WB 4JGRA 3RFBA 2FH5A 3FPVA 2DMWA 2VLGA 4F3LB 2K2NA 2QWSA 2XRNA 3B33A 3IS2A 3MR0A 1F5MA 5J7EA 2VJWA 4CLCC 1XJ4A 1ZHHB 3ULFA 5J3WA 2L1MA 1S1ZA 3LYXA 1LSWA 3W2ZA 5G4YA 3C8CA 2J3WA 2HV1A 2YKHA 5HDSA 2CMNA 2XA7S 3EEAA 4XT2A 5HL6A 3LUQA 5HWWA 4Q0HA 4LLOB 5TBMB 2B18A 4IUKA 2GX5A 1TF1A 3O5YA 1VB6A 1XFNA 3LICA 4EUVA 2IA2A 4Q0JA 1T1CA 5HSQA 1DP6A 3PR6A 1S1YA 3OCNA 3S7NA 2NUTC 2GZAA 2EWWA 1MC0A 1DP8A 3DBAA 3A0RA 2R78A 2V0WA 1ZTUA 4HJ6A 1LSXA 4YWZA 2B02A 2A24B 2EWVA 4I3AA 3HCYA 3IS2B 1N9NA 2VV7A 3D72A 3KSGA 3LFVA 5DFXA 1G28A 2ZBBA 3VV4A 2Y8HA 4P6ZS 4NXBA 2OWHA 4WUJA 4I38A 2VGLS 1X0OA 4HNBA 3MF0A 3KYZA 1OJ5A 1P9RA 1OTIA 4IJGA 5I5LA 4RQ9A 5CX7A 4GS9A 4O01A 3FC7A 3TRCA 3NOUC 4PKYA 2O99A 3PBRA 4DJ3A 4HHDA 2XROA 5TJJA 3T50A 4WEKA 1UWNX 1XJ2A 5K5BA 5EFWA 2PD7A 3BJNA 1D7EA 4PAUA 3T4KA 3IBJA 3A0SA 3UMEA 4KUKA 5HWVA 3GECA 4EQ1A 4WL9A 2KLIA 5KSHA 1T19A 3NJAA 3TW8A 3PBSA 2PDRA 4EU0A 4NXGA 3MQQA 1P9WA 4GS9B 3UB7A 5KIZA 2FZ0A 3F1PA 2OAQ1 2OOLA 5F68A 3LI9A 3BW6A 4M4XA 2LB5A 4II7A 5TBMA 2QJ5A 2PR6A 4QPRA 4IHQA 1S4RA 2LB9A 2WKRA 1OJGA 4GLQA 4HOIA 5C5KA 3EWKA 3LR3A 4Y2FA 3LI8A 3T4SA 4HIAA 3JVUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZQ5 A;  2JN7 A;  4K08 A;  3UB8 A;  4BBV A;  4E04 A;  3F1O A;  2QHK A;  4KUO A;  2A24 A;  1NWZ A;  4WN5 A;  2PYR A;  2V0U A;  1TS6 A;  3NOT C;  3E4P A;  1T18 A;  1S66 L;  3F1P B;  3K3C A;  4EEU A;  4NXE A;  1ODV A;  4HH3 A;  3VOL A;  1LL8 A;  5DKL A;  3LID A;  4I39 A;  2KDK A;  2V1B A;  3H82 A;  5HD5 A;  4LRY C;  4KQD A;  3F1N B;  5HZH A;  4H6J A;  4WF0 A;  4HH2 A;  2PHY A;  4EET B;  3F1O B;  1OTE A;  5J4E A;  2KX6 A;  3VE4 A;  5F5Y A;  1XJ3 A;  1T1A A;  5AVF A;  3SW1 A;  2W0N A;  4R70 A;  1TS7 A;  4GW9 A;  4HP9 A;  2PR5 A;  3LIB A;  2J80 A;  3RH8 B;  3VE3 A;  3H82 B;  4LPZ A;  1F9I A;  1WA9 A;  4H6J B;  3K3D A;  1LSV A;  5G4Z A;  5HD3 A;  2L0W A;  2VEA A;  1OT9 A;  3KX0 X;  4LRX C;  2H28 A;  2PD8 A;  1P97 A;  3MQO A;  4L9G A;  2I9V A;  4L9E A;  2JHE A;  4EEP A;  3FG8 A;  3G6O A;  1TS8 A;  2W27 A;  1TS0 A;  3IBR A;  1T1B A;  4DJ2 A;  1N9L A;  3GDI A;  5A8B A;  1UWP X;  4I3I A;  2K7S A;  1V9Z A;  2YKF A;  4JGQ A;  4HJ4 A;  4B9O A;  1OTA A;  2BAS A;  2VV8 A;  3F1N A;  2WKQ A;  3P7N A;  4WLA A;  4BBT A;  2GJ3 A;  5HWT A;  1LT0 A;  2Z6D A;  3MXQ A;  4HJ3 A;  3UB9 A;  4NXF A;  3PHY A;  1P0Z A;  3LIE A;  4R3A A;  4MN6 A;  3BWL A;  4PKY G;  4L9F A;  3CWF A;  2VV6 A;  3RTY A;  4GCZ A;  1MZU A;  1GSV A;  1N9O A;  2M1C A;  1S67 L;  5HDC A;  3E4Q A;  4HY8 A;  5F6A A;  4BBU A;  1Y28 A;  2QJ7 A;  1GSW A;  2D01 A;  3C2W A;  3BY8 A;  3LIA A;  1OTB A;  2OWJ A;  4GHI A;  2Z6C A;  4R6L A;  4JGO A;  4R38 A;  3UMD A;  1DP9 A;  4HI4 A;  3MFX A;  3OLO A;  2WKP A;  2QKP A;  2INW A;  4EES A;  4JGP A;  5HDD A;  5IU1 A;  5IS1 A;  1OTD A;  1F98 A;  3NOP C;  4XT2 B;  4HQA A;  3UE6 A;  3MJQ A;  3UB6 A;  2V9A A;  2ZOI A;  5DKK A;  3H9W A;  1S4S A;  3EEH A;  3E4O A;  1JNU A;  1EW0 A;  4GHI B;  4LRZ E;  1BYW A;  3BY9 A;  2PYP A;  1GSX A;  3HJI A;  1KOU A;  1UGU A;  5F69 A;  3PYP A;  1D06 A;  4I3J A;  3NHQ A;  2ZOH A;  1DRM A;  4HP4 A;  3H7W A;  3ICY A;  3A0V A;  3LIF A;  4MN5 A;  4F3L A;  5AVE A;  1XFQ A;  2P7J A;  3CLO A;  4I5S A;  4EW7 A;  1V9Y A;  3HJK A;  4EER A;  1XJ6 A;  4EXO A;  5DJU A;  1OT6 A;  2EA9 A;  5DJT A;  2L4R A;  2D02 A;  3CAX A;  2V1A A;  3H7W B;  4JGR A;  2VLG A;  4F3L B;  2QWS A;  3B33 A;  3IS2 A;  3MR0 A;  5J7E A;  1XJ4 A;  3ULF A;  5J3W A;  2L1M A;  1S1Z A;  3LYX A;  1LSW A;  5G4Y A;  3C8C A;  2HV1 A;  2YKH A;  5HDS A;  2CMN A;  4XT2 A;  3LUQ A;  5HWW A;  4LLO B;  5TBM B;  1VB6 A;  1XFN A;  3LIC A;  1T1C A;  5HSQ A;  1DP6 A;  1S1Y A;  1DP8 A;  3A0R A;  2R78 A;  2V0W A;  4HJ6 A;  1LSX A;  4YWZ A;  2B02 A;  2A24 B;  4I3A A;  3IS2 B;  1N9N A;  2VV7 A;  3D72 A;  1G28 A;  2ZBB A;  4NXB A;  2OWH A;  4WUJ A;  4I38 A;  1X0O A;  1OJ5 A;  1OTI A;  5I5L A;  4RQ9 A;  4GS9 A;  3FC7 A;  3NOU C;  4PKY A;  4DJ3 A;  4HHD A;  3T50 A;  1UWN X;  1XJ2 A;  5EFW A;  2PD7 A;  1D7E A;  3A0S A;  3UME A;  4KUK A;  5HWV A;  3GEC A;  4EQ1 A;  4WL9 A;  1T19 A;  3NJA A;  2PDR A;  4NXG A;  3MQQ A;  4GS9 B;  3UB7 A;  5KIZ A;  3F1P A;  2OOL A;  5F68 A;  3LI9 A;  4M4X A;  5TBM A;  2QJ5 A;  2PR6 A;  1S4R A;  2WKR A;  4HOI A;  1OJG A;  3EWK A;  3LI8 A;  4HIA A;  4HNB A; 
#chains in the Genus database with same CATH topology
 2OAP 1;  1G6O A;  3KO6 A;  2Y2H A;  3WRZ A;  1CQA A;  4FCF A;  3KSF A;  4KUO A;  1YM1 A;  2A24 A;  5TGF A;  1N4O A;  2PYR A;  4U0X A;  2V0U A;  5EE8 A;  2VKS A;  5F1F A;  1TS6 A;  5FA7 A;  1T18 A;  1S66 L;  3K3C A;  1K57 A;  2DNS A;  1MBL A;  4KZA A;  1XGI A;  4BJP A;  1RGY A;  4E6X A;  3LID A;  3O87 A;  5U47 A;  1G68 A;  2DRW A;  2V1B A;  5HD5 A;  3ZFZ A;  5DTT A;  1OPX A;  2X71 A;  4ZTK A;  4HH2 A;  3S7O A;  3IF6 B;  2E8J A;  3V5M A;  4R1G A;  2KX6 A;  3VE4 A;  3GQZ A;  3SW1 A;  3KYQ A;  1TS7 A;  3S1Y A;  4HP9 A;  5EUA A;  2J9O A;  3EQU A;  4GDN A;  4DMZ A;  1AWI A;  5F1G A;  4B4Z A;  3FKV A;  3SS3 A;  1FCN A;  3E98 A;  2VK3 A;  5AQA A;  3VE3 A;  2UV0 E;  2EX9 A;  3B3X A;  4ZJ3 A;  3QNB A;  3E0Y A;  3UPN A;  3Q81 A;  4P85 A;  4Y0U A;  2VEA A;  1NRF A;  2Y2Q A;  4KEN B;  2W3G A;  3VP3 A;  1XGJ A;  2Y2J A;  2XD1 A;  2VA0 A;  3HRE A;  5FQK A;  3FV7 A;  4LV1 A;  2I9V A;  2JHE A;  1Y4O A;  4EEP A;  4WEJ A;  3DTE A;  2G2W A;  3IBR A;  5M19 A;  3W4Q A;  1N9L A;  5IT5 A;  1VEU B;  4P6Z M;  5FAO A;  4K0W A;  4HJ4 A;  4B9O A;  4MN7 A;  2WAE A;  3PTE A;  3F1N A;  2VV8 A;  4B93 A;  2Y2G A;  1FOF A;  2GJ3 A;  1FR6 A;  1XA7 A;  3W4O A;  3MXQ A;  4LV3 A;  4Z1W A;  4OQG A;  4DDS A;  4HBU A;  4UQI M;  3C7V A;  4ETX A;  1BUE A;  5A92 A;  1HD8 A;  3RTY A;  3JYI A;  5FAT A;  4MDZ A;  5AQB A;  3IWQ A;  1KDS A;  2BLS A;  2M1C A;  1S67 L;  1PFL A;  3E4Q A;  4UHU A;  4N1H A;  4CQH A;  2EX2 A;  5EPH A;  1YSP A;  1NLZ A;  1DJB A;  5EOO A;  4MCW A;  1PI4 A;  4ME4 A;  3E2K A;  4BMW A;  3BY8 A;  2OWJ A;  3D9Y A;  4GHI A;  1MKI A;  5FQ9 A;  5HX9 A;  3TJZ C;  3P09 A;  2Z6C A;  3T4Q A;  1DP9 A;  2WK0 A;  4XUX A;  5KMW A;  1H8Y A;  3HLD A;  1TDG A;  5FAS A;  2XR0 A;  1K54 A;  2JKG A;  2ZQA A;  2Y79 A;  4WYY A;  3UN7 A;  4JXG A;  4JGP A;  3Q07 A;  5IU1 A;  2W1R A;  1OTD A;  2W3F A;  1K4E A;  3GTC A;  1PRQ A;  3IXH A;  3UB6 A;  2ZOI A;  5DKK A;  3G30 A;  3IXD A;  4OOY A;  3EEH A;  4EV4 A;  1W63 M;  3E4O A;  4GHI B;  1EW0 A;  3HBR A;  3N8L A;  2PYP A;  3IX4 A;  2GNX A;  3FYZ A;  4ZRR A;  3T12 B;  1Y54 A;  1KOU A;  1UGU A;  2ZC5 B;  3IX8 A;  4DXC A;  1CF0 A;  3PYP A;  2XFS A;  4I3J A;  1NZU A;  3PAE A;  1LI9 A;  3IT9 A;  2ZMV A;  4Y5F A;  2V2F F;  2H10 A;  3V67 A;  3S7P A;  3ZDJ A;  4F3L A;  4YFM A;  5AVE A;  3IXB A;  2HGV A;  3DTI A;  2P7J A;  3C38 A;  1Z09 A;  5M1A A;  2GDN A;  5DVA A;  2ZM2 A;  3MZF A;  1YPR A;  5E2F A;  2J3T D;  3PBQ A;  4GJ4 A;  4O7D A;  5DJU A;  3OC2 A;  3CIT A;  1YT4 A;  2ZM0 A;  3LR0 A;  3SH8 A;  4IVI A;  2L4R A;  3BQA A;  1QMF A;  4S2J A;  2JKF A;  2ZMF A;  4OOL A;  2X01 A;  4GKU A;  4OPQ A;  3L7H A;  2DMW A;  4F3L B;  4JXS A;  2QWS A;  4P0M A;  2J8Y A;  1IEL A;  1KVM A;  3UPO A;  1ZHH B;  2L1M A;  1H8Z A;  3VOZ A;  5G4Y A;  3BFC A;  2WKE A;  2J3W A;  1PZP A;  4XT2 A;  3BYD A;  5HAI A;  3IF5 A;  3WS0 A;  1TF1 A;  2IA2 A;  5HSQ A;  4C6Y A;  1DP6 A;  3OCN A;  4S2L A;  4S2O A;  2NUT C;  1XXM A;  4MBH A;  2GZA A;  3MKF A;  4QU3 A;  5HL1 A;  5CHU A;  3N8S A;  3WS5 A;  2V0W A;  2OSU A;  3BRM A;  3NBL A;  1ZTU A;  5GHZ A;  1IYQ A;  3ZG9 B;  4I3A A;  1FIK A;  2ZC3 B;  3HCY A;  4QWO A;  3G2Y A;  5EVI A;  1YLT A;  2VGJ A;  1VET A;  3I7J A;  1G28 A;  3ITA A;  4P6Z S;  1SDN A;  5EV0 A;  3MF0 A;  1XKZ A;  3ZVT A;  5CTN A;  2G2U A;  1OJ5 A;  2XH9 A;  5I5L A;  5CX7 A;  3RJU A;  3V39 A;  4EQI A;  3TRC A;  3NOU C;  4PKY A;  2JC7 A;  3PBR A;  2Y55 A;  2HP9 A;  1XP4 A;  5M18 A;  2XRO A;  4OVD A;  4WEK A;  4OON A;  4Y15 A;  2PD7 A;  1JWZ A;  4PAU A;  5EVI B;  4KZ9 A;  1VET B;  3GEC A;  3NCK A;  1E4D A;  3C7U A;  1M6K A;  1CI9 A;  2C6W B;  1BT5 A;  1L0F A;  3BFF A;  2EXA A;  3NI9 A;  1ES3 A;  2ZM8 A;  3F1P A;  4GNU A;  3UY6 A;  3BW6 A;  4M4X A;  1I2W A;  4JPM A;  1ACF A;  4IHQ A;  3LY4 A;  4HOI A;  1OJG A;  4R3B A;  4QHC A;  2EFX A;  2ZC7 A;  4M3K A;  2X02 A;  1DY6 A;  4E3O A;  2O9A A;  3N8R A;  4JLF A;  3ZCZ A;  3F1O A;  4L0L A;  2WYX A;  2V8F A;  1NWZ A;  4Y3I A;  3HL9 A;  2ZL1 A;  1CJF A;  3NOT C;  3CMZ A;  3E4P A;  3PXP A;  4EEU A;  3F1P B;  2Z2L B;  2ZQC A;  1PIO A;  2HDR A;  2V20 A;  3EQV A;  1ODV A;  3G31 A;  3LO7 A;  4UA6 A;  3HLB A;  4I39 A;  2KDK A;  3OBF A;  1DJC A;  3H82 A;  3PBT A;  4LRY C;  4KQD A;  3TG9 A;  4FUW A;  3CUE A;  2PBY A;  2BTF P;  3K2N A;  3F1O B;  1E3U D;  4G3K A;  1PNE A;  5F5Y A;  2ZL1 B;  3CI6 A;  3JPU A;  4EBP A;  1KGF A;  1YSQ A;  1KE3 A;  4MBF A;  3D4F A;  1ES2 A;  1XX2 A;  5DFY A;  4DN0 A;  3HUM A;  3UDF A;  4S2M A;  5CEB A;  3T4T A;  3BM6 A;  5FQQ A;  3H82 B;  3PBN A;  5E2G A;  1F9I A;  1O07 A;  1WA9 A;  2WKH A;  3GR2 A;  3K3D A;  1LSV A;  2L0W A;  4HEF A;  1OT9 A;  5HPF A;  4BEN A;  2XA7 M;  4LRX C;  5L2F A;  4ZJ1 A;  2H28 A;  4X55 A;  2A3U A;  3T1R A;  3G4P A;  4YNR A;  3MQO A;  4L9G A;  4KG2 A;  1TEM A;  3PAG A;  1O7E A;  1TS8 A;  2H0T A;  3T4J A;  1TS0 A;  2W1T B;  2O9C A;  1F2K A;  3FPW A;  5DTK A;  3TSG A;  4DJ2 A;  4S2N C;  1H5X A;  3SOI A;  1UWP X;  2EX6 A;  2JKT M;  3FWL A;  1V9Z A;  3Q7V A;  3HLC A;  1RP5 A;  3NY4 A;  2PT7 A;  3BEB A;  4UA9 A;  4BBT A;  4GDB A;  1ERM A;  2ZLY A;  4N1X A;  3IF6 A;  3OPR A;  5HWT A;  2PU2 A;  1GA0 A;  3ISG A;  3UPP A;  2C5W B;  3DTK A;  3PHY A;  2J3T C;  3LIE A;  3VP0 A;  4ARZ A;  3QP2 A;  4MN6 A;  3O3V A;  2Y2O A;  1MWR A;  5A91 A;  5CED A;  3KSH A;  3CWF A;  3Q7V B;  3BFG A;  2A2L A;  1NYY A;  1GSV A;  1N9O A;  5HDC A;  1TDL A;  2M7V A;  4RX3 A;  2VGK A;  5GL9 A;  3VFH A;  4OQI A;  1Y28 A;  3MMH A;  3IH8 A;  3LEZ A;  2D01 A;  3C2W A;  3G32 A;  2W3H A;  4CLC A;  4UA7 A;  3B47 A;  3LIA A;  4ARZ B;  3CG5 A;  1VHM A;  4B88 A;  2JBF A;  4NG2 A;  1K56 D;  3CPT A;  4ETZ A;  4R6L A;  1FSY A;  4JGO A;  4AFI A;  4WZ4 A;  4HI4 A;  3MFX A;  3G2Z A;  1PW1 A;  3S22 A;  5JYO A;  2QYB A;  1WYC A;  4QD4 A;  2QKP A;  3OOV A;  4OP8 A;  4U0T A;  5L09 A;  1VEU A;  1K38 A;  5EVE A;  3B42 A;  3ZG0 A;  1F98 A;  3NOP C;  3VMA A;  3GSG A;  4CPK A;  3MXR A;  4CLC B;  3VP2 A;  1IKI A;  3HUO A;  1NJ4 A;  3H9W A;  1ES4 A;  3IHA A;  3CJM A;  1Z6F A;  3C4O A;  1MWU A;  3CPT B;  4JF4 A;  3QP8 A;  1FCM A;  1YQS A;  4EBL A;  5F69 A;  3VP1 A;  1GHM A;  3NHQ A;  3SS4 A;  2CC1 A;  3WWX A;  3NIA A;  1TD5 A;  5FQM A;  3MKE A;  4KG6 A;  3W4P A;  3M6H A;  4MN5 A;  3GVB A;  3T4O A;  2ZQD A;  1W79 A;  4WMC A;  4EW7 A;  4X1L A;  3HJK A;  5CGW A;  4QB8 A;  4NEE D;  4PM7 A;  4RVA A;  1BLS A;  5E43 A;  4WZ5 C;  1KE0 A;  4EER A;  1BUL A;  2EA9 A;  1ONG A;  2Q9N A;  3VOY A;  5LBR A;  1RGZ A;  3UB5 P;  4WEL A;  3MZE A;  1ZG6 A;  2PAV P;  2O0Y A;  3DW0 A;  5EEC A;  3UE1 A;  2FFY A;  4NK3 A;  3RFB A;  4LEN A;  5DTS A;  1PI5 A;  2VLG A;  3B33 A;  3MR0 A;  2ZD8 A;  1F5M A;  1XJ4 A;  2Y2I A;  4GD8 A;  2Q0O A;  3W2Z A;  2ZQ9 A;  4JF5 A;  4X68 A;  1XA1 A;  4KZ5 A;  2YKH A;  5TR7 A;  2XA7 S;  2XDM A;  3EEA A;  5HL6 A;  4Q0H A;  2GX5 A;  1VB6 A;  2ZC6 B;  1XFN A;  5EVL A;  3T1Q B;  4EUV A;  1T1C A;  1W8Q A;  1LL5 A;  3PR6 A;  2XEP A;  3S7N A;  3A3D A;  3SH7 A;  4IBR A;  3DBA A;  2RL3 A;  2B02 A;  3ZG8 B;  5FEF A;  4N9L A;  5KZH A;  1N9N A;  1QME A;  5FAQ A;  3D72 A;  2IWB A;  1MY8 A;  2Y8H A;  5HFO A;  5CHJ A;  4BLM A;  4KQR A;  1BLC A;  1WYB A;  3ZG7 B;  4HBT A;  4PM9 A;  3QP1 A;  1OTI A;  4IJG A;  1AXB A;  5GLA A;  4WM9 A;  3UNW A;  2O99 A;  4DJ3 A;  4E3M A;  3MXS A;  4DE2 A;  1XJ2 A;  5K5B A;  4DE0 A;  3IBJ A;  3HUN A;  5HWV A;  4EQ1 A;  1T19 A;  3TW8 A;  2HDQ A;  4EU0 A;  2PU4 A;  3MQQ A;  1YLW A;  1U60 A;  5KIZ A;  2FZ0 A;  2OAQ 1;  2OLV A;  4GZB A;  5F68 A;  3O86 A;  2LB5 A;  2QJ5 A;  2J9P A;  2WKR A;  2I72 A;  3EWK A;  3LR3 A;  3M6B A;  2V1Z A;  4JKT A;  1JWP A;  3JVU A;  3ZQ5 A;  2JN7 A;  4K08 A;  3UB8 A;  4BBV A;  3U2A A;  2QZ6 A;  2QHK A;  1FR1 A;  1PWD A;  5EOE A;  2EFU A;  2E8I A;  1ES5 A;  4UEY A;  4WN5 A;  1MWS A;  1W63 Q;  3P01 A;  3IQA A;  5FAP A;  2Y2P A;  5HAQ A;  5F83 A;  4NXE A;  3WS1 A;  4PM8 A;  2A49 A;  4DKI A;  4Q0I A;  1KGE A;  4E6W A;  5DKL A;  3OCL A;  4X6T A;  1YAX A;  1L0G A;  2Y59 A;  5HZH A;  4KZ7 A;  2JKR M;  4WF0 A;  1PW8 A;  5L10 A;  3W8K A;  1OTE A;  1DJA A;  1MKM A;  1XJ3 A;  1T1A A;  1EI5 A;  2JCH A;  1IOU A;  2W0N A;  3Q82 A;  3EGX C;  3IWI A;  4LFU A;  5CRF A;  3QP5 A;  4GW9 A;  4LCM A;  2WGI A;  1ESI A;  4XXR A;  5CER A;  5FSR A;  2WZZ A;  4GB7 A;  1CEG A;  2PR5 A;  2HJ9 C;  3G35 A;  2QMI A;  2J80 A;  4LPZ A;  4KQQ A;  4FTX A;  5E2H A;  4JXV A;  4HES A;  5HD3 A;  3T4L A;  3ZGA B;  1WE4 A;  4X25 A;  1YLP A;  2G7U A;  4OH0 A;  5FI7 A;  4UQI S;  1K55 C;  1NLY A;  2PD8 A;  5GHY A;  1P97 A;  2ZC4 B;  3EGD C;  3HLG A;  4L9E A;  4QY5 A;  1HZO A;  3BLS A;  3E2L A;  1YMS A;  4OPZ A;  3FG8 A;  3G6O A;  4G3V A;  5CGS A;  4DRT A;  5I94 A;  2NUP C;  3BFE A;  2P9V B;  4FSF A;  1T1B A;  3LR5 A;  5AQ7 A;  3T1X A;  3PBO A;  3GDI A;  5A8B A;  4YOF A;  4DE1 A;  4OOM A;  4BWI A;  2VGL M;  4JGQ A;  4PM5 A;  3GV9 A;  4P87 A;  4R3J A;  2H5S A;  2RCX A;  4WLA A;  1XPB A;  4OKP A;  4OPY A;  4BL2 A;  1LT0 A;  4ID4 A;  1K57 C;  4GD6 A;  1GA9 A;  4Y0O A;  5L07 A;  1P0Z A;  4QJG A;  3MS6 A;  2PBD P;  4R4S A;  4MNR A;  1IYP A;  3BWL A;  2IWC A;  1H8M A;  4JXW A;  2ZJ9 A;  2VV6 A;  4O0P A;  1S6R A;  2ZMA A;  5EVI D;  4GCZ A;  3HLW A;  5JYP A;  1MZU A;  5AJG A;  5CEC A;  1HLU P;  1FQG A;  2QJ7 A;  4ZDX A;  2WGW B;  3ITB A;  2XFT A;  2V8C A;  2JKT I;  2Y2N A;  4R38 A;  3C5A A;  3UMD A;  5GHX A;  3LR4 A;  2W1T A;  2P08 A;  4R4R A;  3FZC A;  2JE5 A;  2INW A;  2HP5 A;  5IS1 A;  4KZ8 A;  3VSK A;  2V9A A;  5G18 A;  5L8M A;  3IXG A;  3M2K A;  5A93 A;  4KZB A;  1JNU A;  4ZBE A;  3R7W A;  3BY9 A;  3Q1F A;  2B95 A;  2UWX A;  2WAD A;  4Y0T A;  3HJI A;  1MWT A;  4GOG A;  1H0M A;  1FCO A;  1D06 A;  4NKP A;  2ZOH A;  1DRM A;  3NUL A;  4HP4 A;  2Q9M A;  3ICY A;  2VZW A;  3A0V A;  1RCJ A;  2EXB A;  1BLH A;  3LIF A;  4LV2 A;  2XSS A;  1IYO A;  1K25 A;  4S2P A;  3OZH A;  3Q7Z A;  4X69 A;  1XFQ A;  3CLO A;  4I5S A;  1V9Y A;  1A0K A;  4DXB A;  1ESU A;  2P04 A;  2R9X A;  4F94 A;  3R7W B;  3JVV A;  4N92 A;  1XJ6 A;  4EXO A;  4Y7P A;  5DJT A;  3N6I A;  2D02 A;  4Y17 A;  5E2E A;  4JGR A;  3ZG5 A;  2DCF A;  2K2N A;  2XRN A;  1BZA A;  3IS2 A;  5J7E A;  1L0D A;  2VJW A;  1YLY A;  1J9M A;  1LSW A;  1PWG A;  4OQH A;  3C8C A;  1I5Q A;  4WBG A;  2HV1 A;  2XGN A;  2CMN A;  5HWW A;  4LLO B;  5TBM B;  1IKG A;  4D2O A;  1CI8 A;  2Z2M B;  1S1Y A;  3OPP A;  5FI2 A;  1K54 C;  1JWV A;  4GN2 A;  1DP8 A;  2R78 A;  5EM0 A;  3M2J A;  1LSX A;  1ZG4 A;  4YWZ A;  5GLB A;  2A24 B;  3IS2 B;  2HPB A;  3NDG A;  3KSG A;  3LFV A;  3LY3 A;  2OV5 A;  5DFX A;  1G5U A;  2R9W A;  2ZBB A;  3C4P A;  3VV4 A;  3RXW A;  5FEG A;  4NXB A;  1IEM A;  1GHI A;  2B5R A;  4WUJ A;  1NY0 A;  4I38 A;  2VGL S;  4N9K A;  3LCE A;  3DTM A;  3IHB A;  1P9R A;  2J7V A;  1D1J A;  3QNC A;  1BLP A;  4GS9 A;  1NYM A;  2EX8 A;  2QPN A;  3FC7 A;  2HDU A;  4X1M A;  4HHD A;  5TJJ A;  4ZJ2 A;  1NXY A;  4YIN A;  1ZC2 A;  4IVK A;  1K6S A;  3A0S A;  3QHY A;  1SKF A;  3OPL A;  2KLI A;  5HW3 A;  2ZQ8 A;  5KSH A;  3NJA A;  5CHM A;  4OLD A;  2PDR A;  3BFD A;  3MSH A;  4KG5 A;  3GMW A;  5HAR A;  1SCW A;  3P98 A;  2XQZ A;  1P9W A;  4GS9 B;  3HLE A;  3LI9 A;  3QP4 A;  4II7 A;  2PR6 A;  1S4R A;  2LB9 A;  4GLQ A;  5FQI A;  5C5K A;  3MFD A;  1CEF A;  3LI8 A;  2BG1 A;  4S2N A;  4HNB A;  2OLU A;  4LGW A;  4E04 A;  3IX3 A;  3UO9 A;  4CLC D;  2XF3 A;  4DF6 A;  1L3L A;  3ZYT A;  2KOI A;  2Y2L A;  1YMX A;  4DDY A;  4S2K A;  3MZD A;  4MMN A;  3RXX A;  4HH3 A;  3UE3 A;  2XD5 A;  1MXO A;  1LL8 A;  3VOL A;  1OME A;  1J3W A;  5EVI C;  2IWD A;  3F1N B;  4O8G A;  4BL3 A;  3DWK A;  4H6J A;  4RYE A;  1Q2Q A;  3UDX A;  2PHY A;  4EET B;  1YKD A;  5J4E A;  5AVF A;  3VP4 A;  2P74 A;  4R70 A;  1HTZ A;  5GLD A;  3V3S A;  3U4L P;  3IWO A;  3AGE A;  4KZ3 A;  3LIB A;  3RH8 B;  4OPR A;  3NDE A;  3VFF A;  4B4X A;  3NC8 A;  2MJ6 A;  5CXW A;  2M7U A;  1I2S A;  1W5D A;  4H6J B;  5G4Z A;  2H0Y A;  4WMC D;  4E3I A;  1LI0 A;  1N9B A;  4E3N A;  4MLL A;  3SH9 A;  3KX0 X;  4K91 A;  4Q8I A;  4IUH A;  2VX8 A;  4BQM A;  4OQ0 A;  2FFF B;  1YLJ A;  4X53 A;  3BQ8 A;  4E3K A;  3D3O A;  5A90 A;  5J8X A;  3BLM A;  1PWC A;  3A3F A;  1VQQ A;  4KZ4 A;  5HAP A;  2W27 A;  4Z9Q A;  2JKR I;  3R4K A;  1H3Q A;  4KZ6 A;  3ZNT A;  2O9B A;  4I3I A;  2K7S A;  2HZ5 A;  1K6R A;  2YKF A;  5MC7 A;  1OTA A;  4LCL A;  3MQ0 A;  1LLB A;  2BAS A;  2HJE A;  1NRJ A;  2WKQ A;  3P7N A;  2WAF A;  3A3E A;  4E3J A;  3KSI A;  1FIL A;  2Z6D A;  4ESP A;  4HJ3 A;  1LHY A;  5CTM A;  2W3E A;  4NXF A;  3UB9 A;  2HP6 A;  1VM1 A;  3CZD A;  1STZ A;  4PMA A;  2HDS A;  4R3A A;  3BEC A;  5DF7 A;  3ZHH A;  4PKY G;  3C30 A;  3CUE C;  4L9F A;  4PM6 A;  4WZ5 A;  3T1S A;  2W3D A;  3A3I A;  3EOI A;  4NET A;  3WRT A;  1PYY A;  4HY8 A;  4OP5 A;  1SKO A;  3SS5 A;  5F6A A;  4BBU A;  4P6B A;  3ZNY A;  5BOH A;  1PZO A;  1ERQ A;  1GSW A;  4X56 A;  5FL3 A;  5KSC A;  4CJN A;  4LV0 A;  2Y4A A;  1OTB A;  4UAA A;  2K31 A;  4D60 A;  4XUZ A;  5F82 A;  3WS2 A;  5TFQ A;  5CGX A;  3V50 A;  4PHT A;  3DAV A;  3OLO A;  2P9V A;  2XLN A;  2WKP A;  1L0E A;  3QP6 A;  1SZV A;  3N4I A;  5EM1 A;  3ZVW A;  4R0Q A;  1IFQ A;  5AQ9 A;  5FI6 A;  3A3J A;  5DF8 A;  4EES A;  1SKO B;  3AGD A;  5HDD A;  1ZKJ A;  2XK1 A;  4IBX A;  4XT2 B;  2Y2K A;  4HQA A;  4KQO A;  3UE6 A;  4FOF A;  4G3W A;  3MJQ A;  1E3U A;  1KDW A;  1S4S A;  4LRZ E;  1BYW A;  3SZT A;  1GSX A;  3OPH A;  1EWZ A;  2HF6 A;  4JF6 A;  1ALQ A;  2PRF A;  4MBK A;  3FKW A;  3L9K A;  1LL9 A;  3VSL A;  4CLC E;  1KGG A;  4R23 A;  1JVJ A;  3H7W A;  3IF6 C;  4RX2 A;  1E25 A;  4K0X A;  4DE3 A;  3V3R A;  1JTD A;  3UE0 A;  1W8Y A;  2WKI A;  3HLF A;  5FDS A;  4C75 A;  1HVB A;  1OT6 A;  2WGW A;  3TE8 A;  3TOI A;  5DF9 A;  3AGF A;  1K4F A;  3CAX A;  3S7Q A;  4FD8 A;  1SHV A;  1G6A A;  1SDE A;  4FH2 A;  4E3L A;  2WZX A;  5HPI A;  2V1A A;  1TVF A;  3H7W B;  2ACG A;  3LEQ A;  4RA7 A;  2FH5 A;  1ERO A;  1M40 A;  4ZAM A;  3FPV A;  4U3T A;  2Y91 A;  4BD1 A;  1W7F A;  4CLC C;  3ULF A;  5J3W A;  1S1Z A;  3LYX A;  4QY6 A;  5HDS A;  3LUQ A;  5FQJ A;  1Q2P A;  2B18 A;  4IUK A;  4OLG A;  3O5Y A;  3LIC A;  4EBN A;  4Q0J A;  3IH9 A;  4H8R A;  2EWW A;  2WGV A;  4PPR A;  1MC0 A;  1NZO A;  2WUQ A;  1K0K A;  3A0R A;  4HJ6 A;  2EWV A;  1MPL A;  1L2S A;  2VV7 A;  1C3B A;  5GLC A;  2OWH A;  4IED A;  1GCE A;  3CHW P;  1X0O A;  3WS4 A;  4MEZ A;  3GRJ A;  2AVX A;  3KYZ A;  1YLZ A;  2ZQ7 A;  4RQ9 A;  3DWZ A;  3O88 A;  1BTL A;  4O01 A;  3LGO A;  1IYS A;  3HVF A;  1CK3 A;  5D3O A;  3T50 A;  1K56 A;  1UWN X;  3S4X A;  4Y13 A;  1KVL A;  5EFW A;  3G34 A;  3BJN A;  1D7E A;  3T4K A;  1ONH A;  3KYE A;  3UME A;  1KE4 A;  4KUK A;  4JBF A;  4S2I A;  4WL9 A;  4A5R A;  1BSG A;  1FSW A;  2Y2M A;  4C3Q A;  3PBS A;  3MBZ A;  4NXG A;  1JTG A;  4FH4 A;  5FDH A;  1K55 A;  4EWF A;  3UB7 A;  1S0W A;  2OOL A;  5IHV A;  1GHP A;  3UDI A;  3N7W A;  5TBM A;  4QPR A;  4EUZ A;  4BD0 A;  4Y2F A;  3T4S A;  4HIA A;  3NEC A; 
#chains in the Genus database with same CATH homology
 3ZQ5 A;  2OAP 1;  2JN7 A;  1G6O A;  2O9A A;  4K08 A;  3UB8 A;  4BBV A;  4E04 A;  3KO6 A;  3U2A A;  3F1O A;  4CLC D;  2QHK A;  4L0L A;  3KSF A;  4KUO A;  2A24 A;  1NWZ A;  4Y3I A;  4UEY A;  4WN5 A;  2PYR A;  3ZYT A;  2V0U A;  1W63 Q;  2VKS A;  3P01 A;  1TS6 A;  2KOI A;  3NOT C;  3E4P A;  1T18 A;  3PXP A;  1S66 L;  3F1P B;  3K3C A;  4EEU A;  4MMN A;  4NXE A;  3EQV A;  1ODV A;  4HH3 A;  3UE3 A;  4Q0I A;  4BJP A;  3VOL A;  1LL8 A;  5DKL A;  3LID A;  3OCL A;  4I39 A;  2KDK A;  1YAX A;  3OBF A;  2V1B A;  3H82 A;  3PBT A;  5HD5 A;  4LRY C;  4KQD A;  1OPX A;  3F1N B;  4O8G A;  5HZH A;  3CUE A;  2JKR M;  4H6J A;  4WF0 A;  3K2N A;  4HH2 A;  2PHY A;  3S7O A;  4EET B;  3F1O B;  1YKD A;  1OTE A;  5J4E A;  4G3K A;  2KX6 A;  1MKM A;  3VE4 A;  5F5Y A;  1XJ3 A;  1T1A A;  3CI6 A;  5AVF A;  3SW1 A;  1IOU A;  1YSQ A;  2W0N A;  4R70 A;  3KYQ A;  1TS7 A;  3EGX C;  4GW9 A;  4HP9 A;  5DFY A;  4DN0 A;  3EQU A;  4DMZ A;  2PR5 A;  2HJ9 C;  3E98 A;  3LIB A;  2J80 A;  3T4T A;  3RH8 B;  3VE3 A;  3H82 B;  3PBN A;  4LPZ A;  1F9I A;  1WA9 A;  2MJ6 A;  2M7U A;  3E0Y A;  4H6J B;  3K3D A;  1LSV A;  5G4Z A;  5HD3 A;  3T4L A;  2L0W A;  2VEA A;  1OT9 A;  5HPF A;  2G7U A;  3KX0 X;  2XA7 M;  2W3G A;  4LRX C;  2H28 A;  4IUH A;  4UQI S;  2VX8 A;  2PD8 A;  1NLY A;  2VA0 A;  1P97 A;  4YNR A;  3EGD C;  3MQO A;  4L9G A;  2I9V A;  4L9E A;  3BQ8 A;  2JHE A;  3D3O A;  4EEP A;  3FG8 A;  3G6O A;  4G3V A;  1TS8 A;  2NUP C;  3T4J A;  4WEJ A;  2W27 A;  1TS0 A;  4FSF A;  2W1T B;  3IBR A;  1T1B A;  3LR5 A;  2O9C A;  2JKR I;  4DJ2 A;  3FPW A;  3R4K A;  1H3Q A;  3PBO A;  1N9L A;  3GDI A;  5A8B A;  5IT5 A;  2O9B A;  4YOF A;  1UWP X;  4I3I A;  2K7S A;  4OOM A;  4BWI A;  2JKT M;  4P6Z M;  1V9Z A;  2VGL M;  2YKF A;  4JGQ A;  5MC7 A;  4HJ4 A;  4B9O A;  4MN7 A;  1OTA A;  3MQ0 A;  2BAS A;  2HJE A;  2VV8 A;  3F1N A;  1NRJ A;  2WKQ A;  4B93 A;  2PT7 A;  3P7N A;  4WLA A;  4BBT A;  2GJ3 A;  5HWT A;  1LT0 A;  3KSI A;  2Z6D A;  3MXQ A;  4HJ3 A;  2W3E A;  4NXF A;  3UB9 A;  3PHY A;  2J3T C;  1P0Z A;  4Z1W A;  3LIE A;  1STZ A;  4ARZ A;  4R3A A;  4MN6 A;  4UQI M;  3BWL A;  4ETX A;  3KSH A;  3C30 A;  3CUE C;  4PKY G;  1H8M A;  4L9F A;  3CWF A;  2W3D A;  2VV6 A;  4O0P A;  3RTY A;  3EOI A;  4MDZ A;  4GCZ A;  2A2L A;  1MZU A;  5AJG A;  1GSV A;  1N9O A;  2M1C A;  1S67 L;  5HDC A;  3E4Q A;  2M7V A;  4CQH A;  4HY8 A;  1YSP A;  1NLZ A;  5F6A A;  4BBU A;  1Y28 A;  3MMH A;  4MCW A;  2QJ7 A;  1GSW A;  2D01 A;  4ME4 A;  3C2W A;  2W3H A;  5FL3 A;  4CLC A;  4BMW A;  3BY8 A;  3B47 A;  3LIA A;  1OTB A;  2OWJ A;  4ARZ B;  2K31 A;  1VHM A;  2JKT I;  4GHI A;  4ETZ A;  3TJZ C;  3T4Q A;  2Z6C A;  4R6L A;  4JGO A;  4R38 A;  3UMD A;  4AFI A;  1DP9 A;  4PHT A;  4HI4 A;  3MFX A;  3OLO A;  3LR4 A;  2W1T A;  2P08 A;  2QYB A;  2WKP A;  2QKP A;  2INW A;  3OOV A;  1IFQ A;  3B42 A;  2Y79 A;  4EES A;  4JGP A;  5HDD A;  5IU1 A;  2W1R A;  5IS1 A;  1OTD A;  1F98 A;  3NOP C;  4XT2 B;  2W3F A;  4HQA A;  4KQO A;  3UE6 A;  4FOF A;  4G3W A;  3MJQ A;  4CLC B;  3UB6 A;  2V9A A;  2ZOI A;  5DKK A;  5L8M A;  3H9W A;  1S4S A;  3EEH A;  1W63 M;  3E4O A;  1JNU A;  1EW0 A;  4GHI B;  4LRZ E;  1BYW A;  3R7W A;  3BY9 A;  2PYP A;  1GSX A;  2GNX A;  3HJI A;  4ZRR A;  1KOU A;  1UGU A;  2HF6 A;  5F69 A;  3PYP A;  1D06 A;  4I3J A;  4NKP A;  3NHQ A;  2ZOH A;  4CLC E;  1DRM A;  4HP4 A;  3H7W A;  1TD5 A;  3ICY A;  2ZMV A;  4Y5F A;  2VZW A;  3A0V A;  3V67 A;  3LIF A;  3S7P A;  4MN5 A;  2XSS A;  4F3L A;  5AVE A;  2HGV A;  3T4O A;  1XFQ A;  2P7J A;  3C38 A;  3CLO A;  4I5S A;  4EW7 A;  1V9Y A;  3HJK A;  4NEE D;  2P04 A;  2J3T D;  3PBQ A;  4GJ4 A;  3R7W B;  3JVV A;  4EER A;  1XJ6 A;  4EXO A;  5DJU A;  1OT6 A;  3OC2 A;  2EA9 A;  3TE8 A;  3CIT A;  5DJT A;  5DF9 A;  5LBR A;  3LR0 A;  4WEL A;  2L4R A;  2D02 A;  3BQA A;  3CAX A;  3S7Q A;  2O0Y A;  2ZMF A;  5HPI A;  2V1A A;  4OOL A;  3H7W B;  4JGR A;  3RFB A;  2FH5 A;  3FPV A;  2DMW A;  2VLG A;  4F3L B;  2K2N A;  2QWS A;  2XRN A;  3B33 A;  3IS2 A;  3MR0 A;  1F5M A;  5J7E A;  2VJW A;  4CLC C;  1XJ4 A;  1ZHH B;  3ULF A;  5J3W A;  2L1M A;  1S1Z A;  3LYX A;  1LSW A;  3W2Z A;  5G4Y A;  3C8C A;  2J3W A;  2HV1 A;  2YKH A;  5HDS A;  2CMN A;  2XA7 S;  3EEA A;  4XT2 A;  5HL6 A;  3LUQ A;  5HWW A;  4Q0H A;  4LLO B;  5TBM B;  2B18 A;  4IUK A;  2GX5 A;  1TF1 A;  3O5Y A;  1VB6 A;  1XFN A;  3LIC A;  4EUV A;  2IA2 A;  4Q0J A;  1T1C A;  5HSQ A;  1DP6 A;  3PR6 A;  1S1Y A;  3OCN A;  3S7N A;  2NUT C;  2GZA A;  2EWW A;  1MC0 A;  1DP8 A;  3DBA A;  3A0R A;  2R78 A;  2V0W A;  1ZTU A;  4HJ6 A;  1LSX A;  4YWZ A;  2B02 A;  2A24 B;  2EWV A;  4I3A A;  3HCY A;  3IS2 B;  1N9N A;  2VV7 A;  3D72 A;  3KSG A;  3LFV A;  5DFX A;  1G28 A;  2ZBB A;  3VV4 A;  2Y8H A;  4P6Z S;  4NXB A;  2OWH A;  4WUJ A;  4I38 A;  2VGL S;  1X0O A;  4HNB A;  3MF0 A;  3KYZ A;  1OJ5 A;  1P9R A;  1OTI A;  4IJG A;  5I5L A;  4RQ9 A;  5CX7 A;  4GS9 A;  4O01 A;  3FC7 A;  3TRC A;  3NOU C;  4PKY A;  2O99 A;  3PBR A;  4DJ3 A;  4HHD A;  2XRO A;  5TJJ A;  3T50 A;  4WEK A;  1UWN X;  1XJ2 A;  5K5B A;  5EFW A;  2PD7 A;  3BJN A;  1D7E A;  4PAU A;  3T4K A;  3IBJ A;  3A0S A;  3UME A;  4KUK A;  5HWV A;  3GEC A;  4EQ1 A;  4WL9 A;  2KLI A;  5KSH A;  1T19 A;  3NJA A;  3TW8 A;  3PBS A;  2PDR A;  4EU0 A;  4NXG A;  3MQQ A;  1P9W A;  4GS9 B;  3UB7 A;  5KIZ A;  2FZ0 A;  3F1P A;  2OAQ 1;  2OOL A;  5F68 A;  3LI9 A;  3BW6 A;  4M4X A;  2LB5 A;  4II7 A;  5TBM A;  2QJ5 A;  2PR6 A;  4QPR A;  4IHQ A;  1S4R A;  2LB9 A;  2WKR A;  1OJG A;  4GLQ A;  4HOI A;  5C5K A;  3EWK A;  3LR3 A;  4Y2F A;  3LI8 A;  3T4S A;  4HIA A;  3JVU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...