1G28A

Structure of a flavin-binding domain, lov2, from the chimeric phytochrome/phototropin photoreceptor phy3
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
104
structure length
104
Chain Sequence
KSFVITDPRLPDNPIIFASDRFLELTEYTREEVLGNNCRFLQGRGTDRKAVQLIRDAVKEQRDVTVQVLNYTKGGRAFWNLFHLQVMRDENGDVQYFIGVQQEM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PHY3 PROTEIN
publication title Structure of a flavin-binding plant photoreceptor domain: insights into light-mediated signal transduction
pubmed doi rcsb
source organism Adiantum capillus-veneris
molecule tags Signaling protein, electron transport
total genus 29
structure length 104
sequence length 104
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-10-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1g28A00
4EEPA 5I5LA 4MN6A 2A24B 4R70A 2EA9A 1S4SA 5IU1A 2H28A 5AVFA 2PR6A 3LIBA 3K3DA 5HDCA 1T1AA 3H7WA 1P0ZA 5HSQA 5F5YA 3HJKA 5J4EA 3NJAA 4EQ1A 4GCZA 1OJ5A 1S1YA 3MFXA 3F1NA 1WA9A 1UGUA 4EETB 4YWZA 3KX0X 3ICYA 1Y28A 5HWWA 1S1ZA 4HOIA 3CLOA 3IS2B 2WKQA 5TBMA 3GECA 1XJ2A 4NXBA 2YKFA 5HWVA 3UB8A 1T1CA 3NOTC 1GSXA 3K3CA 2VEAA 3LIEA 2PD7A 1N9OA 3H7WB 3FG8A 1LT0A 5A8BA 3C8CA 1X0OA 1N9NA 4XT2B 4F3LA 3CAXA 1VB6A 4HJ4A 4HH2A 2L0WA 1V9YA 2ZBBA 1DP6A 2VV6A 1LL8A 4I3JA 1TS8A 2PR5A 5TBMB 3G6OA 4L9GA 4HHDA 4JGPA 1DRMA 3GDIA 1LSVA 2YKHA 3NHQA 5HD3A 1DP9A 4RQ9A 5F69A 5HDSA 1ODVA 3LI8A 5DJTA 3E4PA 4DJ2A 2J80A 2PHYA 5HZHA 4WLAA 3LIFA 1OTDA 3A0RA 4F3LB 4E04A 1V9ZA 1XJ4A 3MXQA 2INWA 2QJ7A 1G28A 2WKRA 2Z6CA 3BY8A 4XT2A 3NOPC 4KQDA 3PYPA 2CMNA 3F1OA 2D02A 1S4RA 4KUKA 2JN7A 2M1CA 4DJ3A 4I3IA 2V1BA 4JGOA 5DJUA 4EESA 4GS9A 1LSWA 2OOLA 4I3AA 1XFQA 1NWZA 1D06A 1XJ3A 5HDDA 5DKLA 2OWHA 3RH8B 1F98A 2BASA 5DKKA 4HP4A 3MQOA 2QHKA 3A0SA 4NXEA 2PD8A 3BWLA 3D72A 2V0UA 1GSWA 1LSXA 4HNBA 1T18A 3H82A 4WL9A 3F1OB 2PYRA 5AVEA 3B33A 4PKYA 3OLOA 3UE6A 3LIAA 3LYXA 3UMEA 1TS6A 2K7SA 3CWFA 5F68A 4HJ6A 5G4YA 2WKPA 4PKYG 4GS9B 2R78A 1KOUA 2QJ5A 3E4OA 3EWKA 4BBVA 2QWSA 4L9FA 1D7EA 3VE4A 1TS0A 1OT6A 3UB7A 1P97A 2V9AA 4BBUA 2W0NA 2HV1A 1UWNX 4GHIA 1OJGA 4GW9A 1N9LA 3BY9A 4HQAA 4LPZA 1OT9A 3P7NA 4HI4A 3MQQA 3H82B 3UMDA 4H6JB 3HJIA 4M4XA 4I39A 3VE3A 3EEHA 4B9OA 3T50A 4EEUA 1TS7A 3ULFA 4EERA 2OWJA 1OTAA 1EW0A 2QKPA 1OTIA 2L1MA 2I9VA 1GSVA 1XFNA 4EXOA 4KUOA 4R38A 1BYWA 4HP9A 2V0WA 3F1PA 2PYPA 4HY8A 2V1AA 4R3AA 4GHIB 3IBRA 2PDRA 3A0VA 2D01A 4LRYC 1T1BA 2W27A 2P7JA 3MJQA 2GJ3A 2KX6A 1OTEA 4K08A 4NXGA 2Z6DA 4I5SA 4MN5A 4EW7A 3UB6A 4JGRA 1UWPX 4WF0A 5IS1A 5F6AA 1XJ6A 5J7EA 3LI9A 4WN5A 1DP8A 4H6JA 2L4RA 1F9IA 3E4QA 3LIDA 2KDKA 3PHYA 3F1PB 4L9EA 4LRXC 4HH3A 4I38A 3VOLA 2A24A 2ZOHA 3RTYA 3F1NB 5J3WA 1JNUA 3UB9A 2VV8A 2VLGA 5G4ZA 4LLOB 3C2WA 5KIZA 4R6LA 3MR0A 5HWTA 3ZQ5A 3LUQA 3FC7A 2B02A 2ZOIA 4NXFA 1T19A 1MZUA 5EFWA 4JGQA 3NOUC 4HJ3A 2JHEA 4LRZE 1OTBA 3SW1A 4WUJA 4BBTA 1S66L 4HIAA 3H9WA 1S67L 3IS2A 5HD5A 3LICA 2VV7A
chains in the Genus database with same CATH superfamily
2ZC5B 1F5MA 1HVBA 4BD0A 2A24B 3D9YA 1FSYA 5AQ9A 1TDLA 2PR6A 4JF4A 1ACFA 4WEKA 2XSSA 1G6OA 3UDFA 3OZHA 2HP9A 1K55C 4ZBEA 3NJAA 4JXGA 1CI9A 1H5XA 4EQ1A 4GCZA 4S2NA 1NJ4A 2G2WA 4YWZA 3KX0X 1Y28A 4P6ZM 4HOIA 1VETA 3D4FA 2HDUA 1FILA 3IXGA 2XFSA 1NYYA 4K0XA 3O5YA 2A2LA 1H8YA 1FR6A 4E3MA 3IX4A 4B88A 3T12B 3Q81A 1T1CA 1KVMA 5CHUA 3S7PA 3C30A 3LIEA 2DCFA 1W63M 1MWRA 2Y2PA 1LT0A 4OQHA 4GDBA 1YT4A 1SKFA 5HAQA 3C8CA 2J7VA 3IX3A 4GOGA 5JYOA 3U2AA 3CI6A 2ZM2A 4JBFA 1VB6A 2KLIA 1GA9A 2J8YA 1Z6FA 4JXVA 4WMCA 3GVBA 2P9VA 2HPBA 1VETB 1CF0A 4X69A 2V2FF 1TS8A 2ZD8A 4Q8IA 4BJPA 3G6OA 1L0DA 2JKRI 2VK3A 3DWKA 4AFIA 1CK3A 3BFGA 3SH7A 4DXBA 1DRMA 3GDIA 2QZ6A 2XD1A 1K57A 1J9MA 3S7QA 2YKHA 3TE8A 3OPPA 3ZG0A 1DP9A 1D1JA 2Y2JA 1ODVA 3FKWA 3TJZC 4GKUA 4F94A 1K56D 3C7VA 2IA2A 2J80A 4R23A 3BFCA 2GNXA 4WLAA 2WK0A 3LIFA 3A0RA 3DTMA 4PM8A 4QPRA 1NZUA 1L3LA 1YSQA 2C6WB 1WE4A 1IYQA 1KVLA 2OAP1 3ZNTA 2P9VB 3S22A 4JKTA 3TOIA 4XXRA 1FR1A 5DF7A 1YLPA 4FD8A 1GHMA 1ERMA 2Z6CA 4BL2A 4DN0A 2ZMFA 4WELA 2WAEA 3ZG8B 4XT2A 3NOPC 4KQDA 4X6TA 1E3UD 4Y2FA 2UWXA 2E8JA 4BWIA 3FPWA 2XRNA 1MKIA 1S4RA 4O8GA 2Y79A 3QP6A 3EGDC 4I3IA 2Y2LA 1JWPA 4X1LA 1XXMA 2KOIA 1BT5A 4RA7A 1ZHHB 2ZL1A 4GS9A 4O0PA 2EX2A 2W1TA 3WS1A 4DDSA 3BQ8A 1TDGA 4QU3A 4UQIM 5DFYA 1KDSA 3IF6C 1E4DA 4E3OA 1NWZA 2H0TA 3NCKA 3N6IA 5DKLA 4YFMA 5FATA 2BASA 3KSHA 3O88A 4JF5A 3N8RA 3BWLA 1SZVA 5A93A 3BLSA 3OPRA 1GSWA 3NI9A 1T18A 3DTIA 2PYRA 4PKYA 3R4KA 3OLOA 3LIAA 4WM9A 3PBRA 5TFQA 4S2LA 4OQGA 3UE3A 3S7NA 3UY6A 5TJJA 4PAUA 4GS9B 3MSHA 2VKSA 2OSUA 2W1TB 2QPNA 4E6WA 2PU4A 5FDHA 4MBFA 3HCYA 3VE4A 3E0YA 3G32A 2ZC3B 5M18A 2HV1A 3VP1A 2HGVA 4GHIA 1JTGA 1LLBA 1J3WA 1OT9A 3IXBA 5EOEA 5U47A 5A91A 1SKOA 3T4OA 2WGIA 3AGFA 4C75A 3UMDA 4H6JB 2NUTC 3HJIA 4M4XA 5EM0A 1W7FA 4JXWA 1KGEA 4HESA 3UE1A 4G3WA 4EEUA 3B47A 2PAVP 3IF5A 3MKFA 3ULFA 4EERA 3LY4A 5F82A 4LV2A 2OWJA 5F1GA 4WBGA 4S2IA 3WS2A 1GSVA 4EXOA 2JKTI 3LR3A 1BYWA 2V20A 1H0MA 3QP8A 1HLUP 1Z09A 4OVDA 1JWVA 1K56A 1ALQA 3V3RA 4K0WA 2V1AA 2C5WB 4GHIB 5KMWA 1PW8A 1SKOB 1T1BA 2FFFB 3M2JA 2ZC6B 2XROA 3ZVWA 3V3SA 3IQAA 2P7JA 4S2PA 3MJQA 2GJ3A 2KX6A 1CJFA 2BG1A 2JKGA 3UB6A 4WF0A 5F6AA 2W3HA 3ISGA 1CQAA 3EQUA 4X1MA 3NULA 5FL3A 4Y0TA 3BFFA 2B18A 3NDGA 4KZBA 2L4RA 3E4QA 4QB8A 3G4PA 3G35A 5GLDA 1ONHA 4L9EA 4OKPA 4LRXC 5DF9A 3WS0A 3BRMA 3VOLA 3FYZA 3RTYA 3F1NB 1PFLA 2VV8A 1PI5A 2EFXA 3AGDA 1RGZA 4ETZA 3C2WA 1IOUA 1K54A 1BLCA 4KZ9A 3FC7A 4IBRA 4NXFA 2ZQDA 3NOUC 1LI0A 2JHEA 2LB5A 1ZTUA 5HARA 3TG9A 2Z2MB 3CJMA 3WRTA 3A3IA 4R4RA 5EVID 3AGEA 2ZQ9A 4P85A 2VGLS 3MZEA 2ZQ7A 1FSWA 2VX8A 4IJGA 4EEPA 5I5LA 5TGFA 4MN6A 2Y8HA 4R70A 1JTDA 2EA9A 5GLBA 3G30A 1S4SA 5IU1A 4YNRA 3ITBA 3LIBA 3K3DA 1S0WA 4JLFA 5FI7A 3B42A 3P09A 4B4XA 5J4EA 2XK1A 1YAXA 2BLSA 5FQMA 3C4OA 4DE2A 3WWXA 4LV1A 3T4QA 2P08A 4ID4A 4CLCC 5IT5A 4EUVA 1BTLA 3M2KA 1BLHA 4DKIA 3GECA 4NXBA 3QHYA 5HWVA 4UQIS 4DRTA 3UB8A 1IFQA 2Y55A 1IELA 4EUZA 3IXHA 3Q1FA 1IYSA 3DAVA 3CMZA 4OLDA 3LR5A 4MBHA 1N9OA 4ZJ1A 5CECA 4KZ8A 3G2YA 1LI9A 5C5KA 4IEDA 4M3KA 3QP4A 3VOZA 1X0OA 5L09A 4GLQA 1DJAA 4F3LA 1ESUA 2W3FA 3S1YA 4LCMA 4HJ4A 5AQBA 3WRZA 2ZMAA 3EEAA 3FKVA 4MCWA 5EM1A 2NUPC 4KQRA 3T1QB 2DNSA 5L10A 4L9GA 4R0QA 2J3TC 3GRJA 1LSVA 3NHQA 5HD3A 3QP5A 4RQ9A 3G2ZA 4NK3A 4Y5FA 2Y2KA 3UNWA 2JBFA 2QMIA 4RX2A 4R1GA 2ACGA 1WYBA 3V67A 3A3FA 4F3LB 1VEUA 1YLZA 4E04A 3GSGA 1JVJA 4E3JA 1O7EA 2QJ7A 1XP4A 1G28A 3JPUA 2E8IA 3BY8A 1K4FA 4D2OA 4OLGA 3RXWA 4PM9A 1WYCA 4C3QA 3MXSA 3NECA 3HLDA 2EXAA 2JN7A 2V8CA 5EVIA 3MS6A 3CUEC 3HBRA 3ZG9B 3G31A 4KG6A 5TR7A 3T4JA 4EU0A 2J9OA 1VEUB 3S4XA 3A3DA 2ZC4B 4KENB 1N4OA 2XA7S 3BFEA 4OPQA 2HDRA 5CXWA 3OBFA 3SH9A 1ES4A 4KZ3A 5HDDA 4N1XA 2EWVA 2K31A 1F98A 3LEQA 3T1SA 1KE0A 2EWWA 1LL9A 1ES3A 4HP4A 5MC7A 2HDSA 3MQOA 5FQ9A 5CEBA 3A0SA 4NXEA 3KSFA 3O86A 4S2MA 2ZC7A 2V0UA 1LSXA 4GDNA 5EVIB 3UE6A 1MWUA 3V50A 5CGSA 3T4LA 2WUQA 4Y3IA 4DMZA 3KYQA 5D3OA 3WS5A 2O9AA 2R78A 3PAEA 5CGWA 1H8MA 4P0MA 3IHAA 3E2LA 3ZHHA 4BBVA 3ZNYA 2XR0A 2JE5A 4L9FA 1DY6A 3HLWA 4KZ4A 1OJGA 3BY9A 4HQAA 4LPZA 1IKGA 1RP5A 2VGLM 3MQQA 4CPKA 1ESIA 2EX8A 4UA6A 4I39A 3RFBA 2IWDA 1XX2A 1VQQA 2HP5A 4U0XA 5BOHA 5EOOA 2WKEA 1EW0A 5FSRA 2QKPA 3UN7A 1ES2A 2L1MA 4E3KA 2I9VA 1K57C 4R38A 3HUOA 1HTZA 2V0WA 4XUZA 3F1PA 4DF6A 4GNUA 4OOMA 4HY8A 3N7WA 1NLYA 4QD4A 2XD5A 3MKEA 5DTKA 3MFDA 1W8QA 5JYPA 3SH8A 1K25A 3W8KA 5GLCA 2HF6A 4P87A 4DE3A 3IBRA 3O3VA 3T4TA 2HJEA 3A0VA 1C3BA 4N1HA 5DTTA 2DMWA 3P01A 2W27A 3RXXA 5DVAA 2ZQAA 4I5SA 4MN5A 2HDQA 4GN2A 4JGRA 1Q2PA 1NRFA 3LI9A 4N9LA 3UB5P 4WN5A 3UDXA 1GHIA 1KE4A 3Q7VA 4H6JA 1F9IA 3N8SA 4E3NA 3W2ZA 3W4PA 3PHYA 3F1PB 5GL9A 3FZCA 3VV4A 4CLCD 3ZG5A 2XH9A 3IX8A 1JNUA 2R9WA 1MPLA 2WAFA 5G4ZA 5E2EA 2OV5A 1S6RA 1TEMA 2G7UA 3ZVTA 5KIZA 3SZTA 1M40A 5HWTA 1ERQA 1T19A 5EFWA 2RL3A 2W3GA 3MXRA 4QWOA 3UPPA 5L8MA 4LRZE 4IBXA 5AQ7A 1XGIA 3Q7ZA 1OPXA 5CRFA 1FQGA 3Q7VB 3H9WA 2JC7A 3IS2A 3DBAA 1MKMA 5HD5A 5A92A 5GHXA 3VOYA 2RCXA 1YM1A 5KSHA 2H28A 4LCLA 1YMXA 3CITA 4NETA 1H3QA 5FQJA 2O9BA 3H7WA 4KZ6A 4OP5A 5HSQA 1PZOA 3UDIA 3ITAA 3BJNA 5E43A 4IUHA 4BL3A 3P98A 3MFXA 4EBLA 4XUXA 5G18A 3F1NA 4UA9A 1WA9A 3HL9A 4EWFA 3PAGA 1UGUA 2B95A 5J8XA 3ICYA 2WADA 1S1ZA 3A3JA 3CLOA 1BULA 3IS2B 3UPOA 1NYMA 1XJ2A 2XA7M 1K4EA 1KGGA 4LV3A 1FOFA 1PW1A 3NOTC 5K5BA 3PBOA 1AXBA 1E3UA 3N4IA 2VEAA 2MJ6A 3H7WB 3HUMA 4NG2A 4UHUA 5HPIA 2P74A 1AWIA 1YPRA 3UO9A 4BMWA 3ZGAB 2O99A 2X71A 2W3EA 4UAAA 1L2SA 4OONA 2L0WA 2ZBBA 1FCOA 1DP6A 3SOIA 3QP1A 5HL6A 1EROA 1LL8A 2EFUA 5CHJA 3W4QA 2PR5A 1STZA 1I2WA 3PTEA 2W1RA 4JGPA 3GQZA 1G6AA 1YLYA 5CHMA 4PHTA 5F69A 4OPRA 4OOYA 3LI8A 5DJTA 4PMAA 4DJ2A 4BENA 4MDZA 3L9KA 1OTDA 1TD5A 2Y2GA 1V9ZA 2Y2OA 1KE3A 3ZDJA 2XGNA 1MC0A 4IHQA 4WZ5A 2O0YA 4X53A 2Y91A 3NIAA 3BW6A 4HBTA 3NBLA 2WKRA 1K54C 1NRJA 3CG5A 4Y0OA 2WKHA 4G3VA 1IEMA 2Y2QA 1GHPA 5DTSA 2ZQ8A 4WZ4A 3PYPA 3OOVA 3IH9A 4P6BA 2CMNA 5EE8A 1EI5A 3F1OA 2D02A 4KUKA 3EOIA 2M1CA 3C5AA 4EV4A 2XDMA 2XF3A 3O87A 5DJUA 3KSIA 1FCNA 4CLCB 4BLMA 5LBRA 2UV0E 4RYEA 3JYIA 1BUEA 4WMCD 1LSWA 2DRWA 2VA0A 2WGVA 5EVLA 1XJ3A 1PWCA 1YLTA 3D3OA 1NLZA 2J3WA 2V1ZA 1K6SA 4UA7A 5DKKA 3TW8A 3VMAA 4Z9QA 2A3UA 4KZAA 4L0LA 2LB9A 2EXBA 3H82A 4WL9A 4FCFA 1NY0A 4ETXA 1PRQA 3F1OB 5FA7A 5AVEA 4DXCA 1W63Q 2Q0OA 4U3TA 3UMEA 1TS6A 5HAPA 4GD6A 1XKZA 2K7SA 3N8LA 4ARZA 4KZ5A 1RCJA 4HJ6A 1HZOA 3GV9A 4PKYG 1K55A 4O01A 1KOUA 2OAQ1 2QJ5A 3Q82A 3IWIA 3CHWP 5FQIA 4Y13A 2QWSA 3T4KA 1MWSA 1D7EA 4N92A 3UB7A 3JVUA 1P97A 2V9AA 4BBUA 1LHYA 2W0NA 3SS4A 1YMSA 5CEDA 2QYBA 3HUNA 4GW9A 5EECA 2H0YA 3MBZA 1KDWA 2Q9MA 5FQQA 4HI4A 1P9RA 4LV0A 5CERA 3CPTB 3H82B 2IWCA 1L0EA 4ZRRA 3EEHA 3LFVA 3VE3A 4B9OA 5KSCA 2XEPA 4Q0JA 3OCNA 3DTKA 2JCHA 2ZLYA 1TS7A 3M6BA 4ARZB 1OTAA 1OTIA 5KZHA 3ZYTA 5DFXA 2ZMVA 2PU2A 1VHMA 4HP9A 1SCWA 3LEZA 4C6YA 2PYPA 4MEZA 1L0FA 2JKRM 2OLVA 4A5RA 2HP6A 4KQOA 2H10A 2WGWA 3BECA 3MZDA 1QMEA 4Y15A 1PYYA 4LRYC 3HLFA 2VZWA 4E3IA 4YOFA 4MLLA 2Y4AA 5F83A 2Z6DA 1UWPX 5J7EA 2FZ0A 4IUKA 1M6KA 4S2NC 1DP8A 4FOFA 2Y59A 2R9XA 2KDKA 1P9WA 4FUWA 1ONGA 4GJ4A 4NKPA 3QP2A 3PBSA 3QNBA 4FH4A 1IYOA 3NDEA 3I7JA 3OCLA 5EVIC 1QMFA 3IXDA 5GHYA 5I94A 4DDYA 3TSGA 3UB9A 4O7DA 5FAOA 2WGWB 1IYPA 4IVKA 4R4SA 4QHCA 2W3DA 2VLGA 3KSGA 4X68A 4LLOB 1NZOA 2EX6A 3OC2A 2GDNA 3IWQA 3ZQ5A 3LUQA 2FFYA 2B02A 2ZOIA 3VP3A 1MZUA 1PWDA 3VFFA 3GMWA 4NEED 3PBQA 4MNRA 4HJ3A 4X55A 3M6HA 3Q07A 4KG5A 4WUJA 1YLWA 1PZPA 3LGOA 4ZJ2A 4BBTA 4E6XA 1FIKA 1BLPA 2K2NA 4S2OA 2X01A 3GTCA 4OOLA 1N9BA 3A3EA 5FI2A 5FDSA 1JWZA 4S2KA 5AVFA 3HLEA 4X56A 1ZG6A 3IF6A 5HDCA 3R7WA 3S7OA 4ZDXA 1T1AA 1MWTA 3FWLA 3UE0A 1OMEA 1P0ZA 1PIOA 5F5YA 3HJKA 2G2UA 3EGXC 3PBTA 3HVFA 4DE1A 5EPHA 4B4ZA 4MMNA 1OJ5A 1S1YA 4G3KA 2P04A 1EWZA 2EX9A 1K38A 4KG2A 4EETB 1CEFA 2XQZA 1NXYA 5HWWA 4ESPA 1U60A 5L07A 5A90A 5FEGA 1SDEA 3W4OA 1RGYA 3BFDA 5CX7A 2WKQA 5TBMA 1ZC2A 3DW0A 4Q0HA 3PBNA 2YKFA 4LFUA 1F2KA 4QY6A 3VSLA 4CLCE 1GSXA 3PXPA 1XA7A 1SHVA 3K3CA 3IF6B 4BD1A 3R7WB 2PD7A 1W8YA 4LENA 3FG8A 4CJNA 4RVAA 4EBNA 2Z2LB 3ZG7B 5A8BA 5M1AA 1YLJA 2Y2NA 5HPFA 4MN7A 4K91A 1N9NA 3U4LP 4JPMA 4XT2B 1CEGA 1BLSA 3CAXA 3VSKA 4YINA 4HH2A 4HEFA 1V9YA 3MQ0A 4PM6A 1Q2QA 3IWOA 2JKTM 2VV6A 3K2NA 3C38A 4KZ7A 3SS5A 4OQIA 4EBPA 4QY5A 2JKFA 4Y17A 4I3JA 5TBMB 3CZDA 3UPNA 3MF0A 4HHDA 3T1RA 2ZL1B 4KQQA 3B3XA 5HDSA 1LL5A 5IHVA 4RX3A 3E4PA 2XFTA 2PBDP 2PHYA 3BYDA 5HZHA 1ES5A 3HREA 1W5DA 3T4SA 1XJ4A 3EQVA 3MXQA 2INWA 4FTXA 1GA0A 3DWZA 3FV7A 1MY8A 4X25A 3RJUA 4R3BA 2AVXA 4OPZA 1ZG4A 2J3TD 5HAIA 2WZZA 5L2FA 3HLCA 5HX9A 3KO6A 5F1FA 1HD8A 4U0TA 2M7VA 2I72A 4Y0UA 2CC1A 1YSPA 5GHZA 5EUAA 4BQMA 2ZM0A 4DJ3A 1PNEA 1I5QA 2PT7A 4E3LA 3T1XA 2V1BA 4JGOA 4P6ZS 4EESA 1TF1A 1K0KA 4OQ0A 4II7A 4ZTKA 2ZJ9A 2OOLA 4I3AA 5HFOA 1Y4OA 3LY3A 4ME4A 1XFQA 2WZXA 4EQIA 1D06A 2B5RA 2OLUA 1XA1A 2OWHA 3RH8B 2O9CA 3ZCZA 5FQKA 2QHKA 1XGJA 2PD8A 3HLBA 5CTNA 3D72A 4OPYA 1XPBA 4HNBA 3E98A 2HJ9C 1MBLA 5M19A 3E2KA 4WYYA 3B33A 3LYXA 1BSGA 3IH8A 3NC8A 3MMHA 2M7UA 5HW3A 3OPLA 1PI4A 3CWFA 1DJCA 5F68A 5AQAA 5G4YA 2WKPA 3GR2A 3V5MA 4OH0A 1G68A 1I2SA 2Y2HA 5E2GA 3E4OA 3EWKA 4MBKA 4GZBA 3NY4A 1TS0A 1OT6A 1Y54A 1VM1A 4JXSA 4FSFA 4CLCA 1UWNX 4IVIA 4N9KA 2IWBA 1N9LA 1E25A 3BM6A 3P7NA 4R3JA 1TVFA 2GZAA 4HBUA 1H8ZA 3VFHA 3T50A 4Q0IA 3DTEA 3G34A 4LGWA 2WYXA 2VGJA 3C4PA 4ZJ3A 2VGKA 1XFNA 4WEJA 4KUOA 3BQAA 3VP0A 1GCEA 2HZ5A 4B93A 3SS3A 4FH2A 1DJBA 4QJGA 4R3AA 1IKIA 2J9PA 4PM7A 2PBYA 2ZM8A 5FI6A 2PDRA 2D01A 3MZFA 2VJWA 4Z1WA 1K6RA 4DE0A 4PM5A 1O07A 5FAPA 1G5UA 5AJGA 2XLNA 4OP8A 5FASA 1OTEA 3L7HA 4K08A 4WZ5C 2Q9NA 3BLMA 3LO7A 3VP2A 2GX5A 4NXGA 1YKDA 3FPVA 3KYEA 4EW7A 5EV0A 5IS1A 1XJ6A 1PWGA 3IHBA 5FEFA 3LR4A 3WS4A 5HL1A 3CPTA 4ZAMA 3BEBA 3V39A 3LIDA 3PR6A 3HLGA 2Y2IA 4HH3A 3ZFZA 2FH5A 1BZAA 4I38A 4JF6A 2A24A 3LR0A 2ZOHA 4GB7A 5CGXA 5EVEA 5J3WA 2BTFP 3IBJA 4H8RA 4CQHA 5CTMA 5E2FA 1SDNA 2A49A 4D60A 3QNCA 3C7UA 4UEYA 3TRCA 2X02A 4R6LA 3MR0A 3OPHA 3KYZA 3VP4A 1MXOA 4S2JA 1ZKJA 4JGQA 2WKIA 1CI8A 5GLAA 5E2HA 2Y2MA 1OTBA 4Y7PA 3SW1A 5FAQA 1FCMA 1KGFA 4GD8A 1S66L 4HIAA 5DF8A 2PRFA 3IT9A 3CUEA 4PPRA 1A0KA 3LCEA 2V8FA 1L0GA 1YQSA 1S67L 2ZQCA 3LICA 2H5SA 3JVVA 1W79A 2VV7A
chains in the Genus database with same CATH topology
2VX8A 4IJGA 1F5MA 4EEPA 5I5LA 4MN6A 2A24B 2Y8HA 4R70A 2EA9A 1S4SA 5IU1A 5KSHA 2H28A 4YNRA 5AVFA 2PR6A 3CITA 3LIBA 3K3DA 5HDCA 3R7WA 1H3QA 3S7OA 1T1AA 2O9BA 3H7WA 4WEKA 2XSSA 3B42A 1G6OA 1P0ZA 5HSQA 5F5YA 3HJKA 3EGXC 3PBTA 5J4EA 3NJAA 3BJNA 4IUHA 4EQ1A 4MMNA 4GCZA 1YAXA 1OJ5A 1S1YA 3MFXA 4G3KA 2P04A 3F1NA 3T4QA 2P08A 1WA9A 1UGUA 4EETB 4CLCC 4YWZA 5IT5A 3KX0X 3ICYA 1Y28A 4EUVA 5HWWA 4P6ZM 1S1ZA 4HOIA 3CLOA 3IS2B 5CX7A 2WKQA 5TBMA 3GECA 2A2LA 1XJ2A 3O5YA 4NXBA 4Q0HA 2XA7M 3PBNA 2YKFA 5HWVA 4UQIS 3UB8A 1IFQA 1T1CA 4CLCE 3NOTC 1GSXA 5K5BA 3PXPA 3PBOA 3K3CA 3S7PA 3C30A 2VEAA 3LIEA 3R7WB 2PD7A 1N9OA 1W63M 3LR5A 2MJ6A 3H7WB 3FG8A 1LT0A 5C5KA 5A8BA 5HPIA 5HPFA 4MN7A 3C8CA 1X0OA 4BMWA 1N9NA 4GLQA 4XT2B 2O99A 4F3LA 3U2AA 3CI6A 2W3FA 2W3EA 3CAXA 1VB6A 4HJ4A 4HH2A 2KLIA 2L0WA 1V9YA 2ZBBA 3MQ0A 3EEAA 1DP6A 2JKTM 2VV6A 3K2NA 4MCWA 3C38A 5HL6A 1LL8A 2NUPC 4I3JA 1TS8A 2PR5A 4BJPA 5TBMB 3G6OA 2JKRI 4AFIA 1STZA 4L9GA 3MF0A 2J3TC 2W1RA 4HHDA 4JGPA 1DRMA 3GDIA 1LSVA 3S7QA 2YKHA 3TE8A 3NHQA 5HD3A 1DP9A 4RQ9A 4PHTA 5F69A 5HDSA 1ODVA 3TJZC 4Y5FA 3LI8A 5DJTA 3E4PA 4DJ2A 2IA2A 2J80A 2PHYA 5HZHA 2GNXA 4MDZA 4WLAA 3LIFA 1OTDA 3A0RA 1TD5A 3V67A 4QPRA 4F3LB 4E04A 1V9ZA 3T4SA 1XJ4A 1YSQA 3EQVA 3MXQA 2OAP1 2INWA 2QJ7A 1MC0A 4IHQA 2O0YA 1G28A 2J3TD 3BW6A 2WKRA 2Z6CA 3BY8A 1NRJA 4DN0A 2ZMFA 4G3VA 4WELA 3KO6A 4XT2A 3NOPC 4KQDA 2M7VA 3PYPA 3OOVA 4Y2FA 2CMNA 1YSPA 4BWIA 3FPWA 3F1OA 2D02A 2XRNA 1S4RA 4KUKA 3EOIA 4O8GA 2Y79A 2JN7A 2M1CA 4DJ3A 2PT7A 3EGDC 4I3IA 2V1BA 3CUEC 2KOIA 4JGOA 3KSIA 4P6ZS 5DJUA 4CLCB 3T4JA 4EU0A 5LBRA 4EESA 1TF1A 1ZHHB 4II7A 4GS9A 4O0PA 1LSWA 2W1TA 2XA7S 2OOLA 2VA0A 4I3AA 3BQ8A 3OBFA 4UQIM 5DFYA 4ME4A 1XFQA 1NWZA 1D06A 1XJ3A 5HDDA 3D3OA 1NLZA 5DKLA 2EWVA 2K31A 2J3WA 2OWHA 1F98A 2O9CA 2BASA 5DKKA 3RH8B 3TW8A 2EWWA 3KSHA 5MC7A 4HP4A 3MQOA 2QHKA 3A0SA 4NXEA 4L0LA 2PD8A 3BWLA 3KSFA 2LB9A 3D72A 2V0UA 1GSWA 1LSXA 4HNBA 1T18A 3H82A 4WL9A 3E98A 4ETXA 2HJ9C 3F1OB 2PYRA 5AVEA 3B33A 3R4KA 3OLOA 4PKYA 3LIAA 3UE6A 3PBRA 3LYXA 1W63Q 3UMEA 1TS6A 3T4LA 4Y3IA 4DMZA 2K7SA 3UE3A 3KYQA 3MMHA 2M7UA 4ARZA 3S7NA 3CWFA 5TJJA 2O9AA 5F68A 4HJ6A 5G4YA 4PAUA 2WKPA 4PKYG 4GS9B 2R78A 4O01A 1KOUA 2OAQ1 2VKSA 2W1TB 1H8MA 2QJ5A 3E4OA 3EWKA 4BBVA 2QWSA 3T4KA 4L9FA 1D7EA 3HCYA 1TS0A 1OT6A 3VE4A 3E0YA 4FSFA 3UB7A 3JVUA 1P97A 2V9AA 4BBUA 4CLCA 2W0NA 2HV1A 1UWNX 2HGVA 4GHIA 1OJGA 2QYBA 4GW9A 1N9LA 3BY9A 4HQAA 4LPZA 1OT9A 3P7NA 2VGLM 3T4OA 4HI4A 1P9RA 2GZAA 3MQQA 3H82B 3UMDA 4H6JB 2NUTC 3HJIA 4M4XA 4I39A 3RFBA 4ZRRA 3EEHA 3LFVA 3VE3A 4B9OA 4G3WA 4Q0JA 3T50A 4Q0IA 3OCNA 4EEUA 3B47A 1TS7A 3ULFA 4EERA 2OWJA 4ARZB 1OTAA 1EW0A 2QKPA 1OTIA 2L1MA 2I9VA 3ZYTA 5DFXA 1GSVA 1XFNA 2ZMVA 4EXOA 4WEJA 4KUOA 2JKTI 3LR3A 1BYWA 4R38A 1VHMA 4HP9A 2V0WA 3BQAA 3F1PA 2PYPA 4OOMA 4HY8A 4B93A 1NLYA 2JKRM 2V1AA 4R3AA 4KQOA 4GHIB 2HF6A 3IBRA 3T4TA 2PDRA 2HJEA 3A0VA 2D01A 4LRYC 1T1BA 2VZWA 2VJWA 4Z1WA 2DMWA 2XROA 3P01A 2W27A 5AJGA 2P7JA 4YOFA 3MJQA 2GJ3A 2KX6A 1OTEA 4K08A 2GX5A 4NXGA 1YKDA 2Z6DA 3FPVA 4I5SA 4MN5A 4EW7A 3UB6A 4JGRA 1UWPX 4WF0A 5IS1A 5F6AA 1XJ6A 2W3HA 2FZ0A 5J7EA 4IUKA 3EQUA 3LI9A 5FL3A 3LR4A 4WN5A 1DP8A 2B18A 4FOFA 4H6JA 2L4RA 1F9IA 3E4QA 3LIDA 2KDKA 1P9WA 3PR6A 3W2ZA 3PHYA 3F1PB 4GJ4A 4L9EA 4NKPA 3VV4A 4LRXC 3PBSA 5DF9A 4HH3A 4CLCD 2FH5A 4I38A 3VOLA 3OCLA 2A24A 3LR0A 2ZOHA 3RTYA 3F1NB 5J3WA 1JNUA 3IBJA 3UB9A 4CQHA 2VV8A 2W3DA 2VLGA 3KSGA 5G4ZA 4LLOB 4ETZA 3C2WA 1IOUA 4UEYA 2G7UA 3TRCA 5KIZA 3OC2A 4R6LA 3MR0A 5HWTA 3ZQ5A 3KYZA 3LUQA 3FC7A 2B02A 2ZOIA 4NXFA 1T19A 1MZUA 5EFWA 2W3GA 4NEED 3PBQA 4JGQA 3NOUC 4HJ3A 2JHEA 2LB5A 5L8MA 1ZTUA 4LRZE 1OTBA 3SW1A 4WUJA 1OPXA 4BBTA 1S66L 4HIAA 3CUEA 3H9WA 2K2NA 1S67L 3IS2A 3DBAA 1MKMA 5HD5A 3LICA 2VGLS 4OOLA 3JVVA 2VV7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EEP A;  5I5L A;  4MN6 A;  2A24 B;  4R70 A;  2EA9 A;  1S4S A;  5IU1 A;  2H28 A;  5AVF A;  2PR6 A;  3LIB A;  3K3D A;  5HDC A;  1T1A A;  3H7W A;  1P0Z A;  5HSQ A;  5F5Y A;  3HJK A;  5J4E A;  3NJA A;  4EQ1 A;  4GCZ A;  1OJ5 A;  1S1Y A;  3MFX A;  3F1N A;  1WA9 A;  1UGU A;  4EET B;  4YWZ A;  3KX0 X;  3ICY A;  1Y28 A;  5HWW A;  1S1Z A;  4HOI A;  3CLO A;  3IS2 B;  2WKQ A;  5TBM A;  3GEC A;  1XJ2 A;  4NXB A;  2YKF A;  5HWV A;  3UB8 A;  1T1C A;  3NOT C;  1GSX A;  3K3C A;  2VEA A;  3LIE A;  2PD7 A;  1N9O A;  3H7W B;  3FG8 A;  1LT0 A;  5A8B A;  3C8C A;  1X0O A;  1N9N A;  4XT2 B;  4F3L A;  3CAX A;  1VB6 A;  4HJ4 A;  4HH2 A;  2L0W A;  1V9Y A;  2ZBB A;  1DP6 A;  2VV6 A;  1LL8 A;  4I3J A;  1TS8 A;  2PR5 A;  5TBM B;  3G6O A;  4L9G A;  4HHD A;  4JGP A;  1DRM A;  3GDI A;  1LSV A;  2YKH A;  3NHQ A;  5HD3 A;  1DP9 A;  4RQ9 A;  5F69 A;  5HDS A;  1ODV A;  3LI8 A;  5DJT A;  3E4P A;  4DJ2 A;  2J80 A;  2PHY A;  5HZH A;  4WLA A;  3LIF A;  1OTD A;  3A0R A;  4F3L B;  4E04 A;  1V9Z A;  1XJ4 A;  3MXQ A;  2INW A;  2QJ7 A;  1G28 A;  2WKR A;  2Z6C A;  3BY8 A;  4XT2 A;  3NOP C;  4KQD A;  3PYP A;  2CMN A;  3F1O A;  2D02 A;  1S4R A;  4KUK A;  2JN7 A;  2M1C A;  4DJ3 A;  4I3I A;  2V1B A;  4JGO A;  5DJU A;  4EES A;  4GS9 A;  1LSW A;  2OOL A;  4I3A A;  1XFQ A;  1NWZ A;  1D06 A;  1XJ3 A;  5HDD A;  5DKL A;  2OWH A;  3RH8 B;  1F98 A;  2BAS A;  5DKK A;  4HP4 A;  3MQO A;  2QHK A;  3A0S A;  4NXE A;  2PD8 A;  3BWL A;  3D72 A;  2V0U A;  1GSW A;  1LSX A;  4HNB A;  1T18 A;  3H82 A;  4WL9 A;  3F1O B;  2PYR A;  5AVE A;  3B33 A;  4PKY A;  3OLO A;  3UE6 A;  3LIA A;  3LYX A;  3UME A;  1TS6 A;  2K7S A;  3CWF A;  5F68 A;  4HJ6 A;  5G4Y A;  2WKP A;  4PKY G;  4GS9 B;  2R78 A;  1KOU A;  2QJ5 A;  3E4O A;  3EWK A;  4BBV A;  2QWS A;  4L9F A;  1D7E A;  3VE4 A;  1TS0 A;  1OT6 A;  3UB7 A;  1P97 A;  2V9A A;  4BBU A;  2W0N A;  2HV1 A;  1UWN X;  4GHI A;  1OJG A;  4GW9 A;  1N9L A;  3BY9 A;  4HQA A;  4LPZ A;  1OT9 A;  3P7N A;  4HI4 A;  3MQQ A;  3H82 B;  3UMD A;  4H6J B;  3HJI A;  4M4X A;  4I39 A;  3VE3 A;  3EEH A;  4B9O A;  3T50 A;  4EEU A;  1TS7 A;  3ULF A;  4EER A;  2OWJ A;  1OTA A;  1EW0 A;  2QKP A;  1OTI A;  2L1M A;  2I9V A;  1GSV A;  1XFN A;  4EXO A;  4KUO A;  4R38 A;  1BYW A;  4HP9 A;  2V0W A;  3F1P A;  2PYP A;  4HY8 A;  2V1A A;  4R3A A;  4GHI B;  3IBR A;  2PDR A;  3A0V A;  2D01 A;  4LRY C;  1T1B A;  2W27 A;  2P7J A;  3MJQ A;  2GJ3 A;  2KX6 A;  1OTE A;  4K08 A;  4NXG A;  2Z6D A;  4I5S A;  4MN5 A;  4EW7 A;  3UB6 A;  4JGR A;  1UWP X;  4WF0 A;  5IS1 A;  5F6A A;  1XJ6 A;  5J7E A;  3LI9 A;  4WN5 A;  1DP8 A;  4H6J A;  2L4R A;  1F9I A;  3E4Q A;  3LID A;  2KDK A;  3PHY A;  3F1P B;  4L9E A;  4LRX C;  4HH3 A;  4I38 A;  3VOL A;  2A24 A;  2ZOH A;  3RTY A;  3F1N B;  5J3W A;  1JNU A;  3UB9 A;  2VV8 A;  2VLG A;  5G4Z A;  4LLO B;  3C2W A;  5KIZ A;  4R6L A;  3MR0 A;  5HWT A;  3ZQ5 A;  3LUQ A;  3FC7 A;  2B02 A;  2ZOI A;  4NXF A;  1T19 A;  1MZU A;  5EFW A;  4JGQ A;  3NOU C;  4HJ3 A;  2JHE A;  4LRZ E;  1OTB A;  3SW1 A;  4WUJ A;  4BBT A;  1S66 L;  4HIA A;  3H9W A;  1S67 L;  3IS2 A;  5HD5 A;  3LIC A;  2VV7 A; 
#chains in the Genus database with same CATH topology
 2ZC5 B;  1F5M A;  1HVB A;  4BD0 A;  2A24 B;  3D9Y A;  1FSY A;  5AQ9 A;  1TDL A;  2PR6 A;  4JF4 A;  1ACF A;  4WEK A;  2XSS A;  1G6O A;  3UDF A;  3OZH A;  2HP9 A;  1K55 C;  4ZBE A;  3NJA A;  4JXG A;  1CI9 A;  1H5X A;  4EQ1 A;  4GCZ A;  4S2N A;  1NJ4 A;  2G2W A;  4YWZ A;  3KX0 X;  1Y28 A;  4P6Z M;  4HOI A;  1VET A;  3D4F A;  2HDU A;  1FIL A;  3IXG A;  2XFS A;  1NYY A;  4K0X A;  3O5Y A;  2A2L A;  1H8Y A;  1FR6 A;  4E3M A;  3IX4 A;  4B88 A;  3T12 B;  3Q81 A;  1T1C A;  1KVM A;  5CHU A;  3S7P A;  3C30 A;  3LIE A;  2DCF A;  1W63 M;  1MWR A;  2Y2P A;  1LT0 A;  4OQH A;  4GDB A;  1YT4 A;  1SKF A;  5HAQ A;  3C8C A;  2J7V A;  3IX3 A;  4GOG A;  5JYO A;  3U2A A;  3CI6 A;  2ZM2 A;  4JBF A;  1VB6 A;  2KLI A;  1GA9 A;  2J8Y A;  1Z6F A;  4JXV A;  4WMC A;  3GVB A;  2P9V A;  2HPB A;  1VET B;  1CF0 A;  4X69 A;  2V2F F;  1TS8 A;  2ZD8 A;  4Q8I A;  4BJP A;  3G6O A;  1L0D A;  2JKR I;  2VK3 A;  3DWK A;  4AFI A;  1CK3 A;  3BFG A;  3SH7 A;  4DXB A;  1DRM A;  3GDI A;  2QZ6 A;  2XD1 A;  1K57 A;  1J9M A;  3S7Q A;  2YKH A;  3TE8 A;  3OPP A;  3ZG0 A;  1DP9 A;  1D1J A;  2Y2J A;  1ODV A;  3FKW A;  3TJZ C;  4GKU A;  4F94 A;  1K56 D;  3C7V A;  2IA2 A;  2J80 A;  4R23 A;  3BFC A;  2GNX A;  4WLA A;  2WK0 A;  3LIF A;  3A0R A;  3DTM A;  4PM8 A;  4QPR A;  1NZU A;  1L3L A;  1YSQ A;  2C6W B;  1WE4 A;  1IYQ A;  1KVL A;  2OAP 1;  3ZNT A;  2P9V B;  3S22 A;  4JKT A;  3TOI A;  4XXR A;  1FR1 A;  5DF7 A;  1YLP A;  4FD8 A;  1GHM A;  1ERM A;  2Z6C A;  4BL2 A;  4DN0 A;  2ZMF A;  4WEL A;  2WAE A;  3ZG8 B;  4XT2 A;  3NOP C;  4KQD A;  4X6T A;  1E3U D;  4Y2F A;  2UWX A;  2E8J A;  4BWI A;  3FPW A;  2XRN A;  1MKI A;  1S4R A;  4O8G A;  2Y79 A;  3QP6 A;  3EGD C;  4I3I A;  2Y2L A;  1JWP A;  4X1L A;  1XXM A;  2KOI A;  1BT5 A;  4RA7 A;  1ZHH B;  2ZL1 A;  4GS9 A;  4O0P A;  2EX2 A;  2W1T A;  3WS1 A;  4DDS A;  3BQ8 A;  1TDG A;  4QU3 A;  4UQI M;  5DFY A;  1KDS A;  3IF6 C;  1E4D A;  4E3O A;  1NWZ A;  2H0T A;  3NCK A;  3N6I A;  5DKL A;  4YFM A;  5FAT A;  2BAS A;  3KSH A;  3O88 A;  4JF5 A;  3N8R A;  3BWL A;  1SZV A;  5A93 A;  3BLS A;  3OPR A;  1GSW A;  3NI9 A;  1T18 A;  3DTI A;  2PYR A;  4PKY A;  3R4K A;  3OLO A;  3LIA A;  4WM9 A;  3PBR A;  5TFQ A;  4S2L A;  4OQG A;  3UE3 A;  3S7N A;  3UY6 A;  5TJJ A;  4PAU A;  4GS9 B;  3MSH A;  2VKS A;  2OSU A;  2W1T B;  2QPN A;  4E6W A;  2PU4 A;  5FDH A;  4MBF A;  3HCY A;  3VE4 A;  3E0Y A;  3G32 A;  2ZC3 B;  5M18 A;  2HV1 A;  3VP1 A;  2HGV A;  4GHI A;  1JTG A;  1LLB A;  1J3W A;  1OT9 A;  3IXB A;  5EOE A;  5U47 A;  5A91 A;  1SKO A;  3T4O A;  2WGI A;  3AGF A;  4C75 A;  3UMD A;  4H6J B;  2NUT C;  3HJI A;  4M4X A;  5EM0 A;  1W7F A;  4JXW A;  1KGE A;  4HES A;  3UE1 A;  4G3W A;  4EEU A;  3B47 A;  2PAV P;  3IF5 A;  3MKF A;  3ULF A;  4EER A;  3LY4 A;  5F82 A;  4LV2 A;  2OWJ A;  5F1G A;  4WBG A;  4S2I A;  3WS2 A;  1GSV A;  4EXO A;  2JKT I;  3LR3 A;  1BYW A;  2V20 A;  1H0M A;  3QP8 A;  1HLU P;  1Z09 A;  4OVD A;  1JWV A;  1K56 A;  1ALQ A;  3V3R A;  4K0W A;  2V1A A;  2C5W B;  4GHI B;  5KMW A;  1PW8 A;  1SKO B;  1T1B A;  2FFF B;  3M2J A;  2ZC6 B;  2XRO A;  3ZVW A;  3V3S A;  3IQA A;  2P7J A;  4S2P A;  3MJQ A;  2GJ3 A;  2KX6 A;  1CJF A;  2BG1 A;  2JKG A;  3UB6 A;  4WF0 A;  5F6A A;  2W3H A;  3ISG A;  1CQA A;  3EQU A;  4X1M A;  3NUL A;  5FL3 A;  4Y0T A;  3BFF A;  2B18 A;  3NDG A;  4KZB A;  2L4R A;  3E4Q A;  4QB8 A;  3G4P A;  3G35 A;  5GLD A;  1ONH A;  4L9E A;  4OKP A;  4LRX C;  5DF9 A;  3WS0 A;  3BRM A;  3VOL A;  3FYZ A;  3RTY A;  3F1N B;  1PFL A;  2VV8 A;  1PI5 A;  2EFX A;  3AGD A;  1RGZ A;  4ETZ A;  3C2W A;  1IOU A;  1K54 A;  1BLC A;  4KZ9 A;  3FC7 A;  4IBR A;  4NXF A;  2ZQD A;  3NOU C;  1LI0 A;  2JHE A;  2LB5 A;  1ZTU A;  5HAR A;  3TG9 A;  2Z2M B;  3CJM A;  3WRT A;  3A3I A;  4R4R A;  5EVI D;  3AGE A;  2ZQ9 A;  4P85 A;  2VGL S;  3MZE A;  2ZQ7 A;  1FSW A;  2VX8 A;  4IJG A;  4EEP A;  5I5L A;  5TGF A;  4MN6 A;  2Y8H A;  4R70 A;  1JTD A;  2EA9 A;  5GLB A;  3G30 A;  1S4S A;  5IU1 A;  4YNR A;  3ITB A;  3LIB A;  3K3D A;  1S0W A;  4JLF A;  5FI7 A;  3B42 A;  3P09 A;  4B4X A;  5J4E A;  2XK1 A;  1YAX A;  2BLS A;  5FQM A;  3C4O A;  4DE2 A;  3WWX A;  4LV1 A;  3T4Q A;  2P08 A;  4ID4 A;  4CLC C;  5IT5 A;  4EUV A;  1BTL A;  3M2K A;  1BLH A;  4DKI A;  3GEC A;  4NXB A;  3QHY A;  5HWV A;  4UQI S;  4DRT A;  3UB8 A;  1IFQ A;  2Y55 A;  1IEL A;  4EUZ A;  3IXH A;  3Q1F A;  1IYS A;  3DAV A;  3CMZ A;  4OLD A;  3LR5 A;  4MBH A;  1N9O A;  4ZJ1 A;  5CEC A;  4KZ8 A;  3G2Y A;  1LI9 A;  5C5K A;  4IED A;  4M3K A;  3QP4 A;  3VOZ A;  1X0O A;  5L09 A;  4GLQ A;  1DJA A;  4F3L A;  1ESU A;  2W3F A;  3S1Y A;  4LCM A;  4HJ4 A;  5AQB A;  3WRZ A;  2ZMA A;  3EEA A;  3FKV A;  4MCW A;  5EM1 A;  2NUP C;  4KQR A;  3T1Q B;  2DNS A;  5L10 A;  4L9G A;  4R0Q A;  2J3T C;  3GRJ A;  1LSV A;  3NHQ A;  5HD3 A;  3QP5 A;  4RQ9 A;  3G2Z A;  4NK3 A;  4Y5F A;  2Y2K A;  3UNW A;  2JBF A;  2QMI A;  4RX2 A;  4R1G A;  2ACG A;  1WYB A;  3V67 A;  3A3F A;  4F3L B;  1VEU A;  1YLZ A;  4E04 A;  3GSG A;  1JVJ A;  4E3J A;  1O7E A;  2QJ7 A;  1XP4 A;  1G28 A;  3JPU A;  2E8I A;  3BY8 A;  1K4F A;  4D2O A;  4OLG A;  3RXW A;  4PM9 A;  1WYC A;  4C3Q A;  3MXS A;  3NEC A;  3HLD A;  2EXA A;  2JN7 A;  2V8C A;  5EVI A;  3MS6 A;  3CUE C;  3HBR A;  3ZG9 B;  3G31 A;  4KG6 A;  5TR7 A;  3T4J A;  4EU0 A;  2J9O A;  1VEU B;  3S4X A;  3A3D A;  2ZC4 B;  4KEN B;  1N4O A;  2XA7 S;  3BFE A;  4OPQ A;  2HDR A;  5CXW A;  3OBF A;  3SH9 A;  1ES4 A;  4KZ3 A;  5HDD A;  4N1X A;  2EWV A;  2K31 A;  1F98 A;  3LEQ A;  3T1S A;  1KE0 A;  2EWW A;  1LL9 A;  1ES3 A;  4HP4 A;  5MC7 A;  2HDS A;  3MQO A;  5FQ9 A;  5CEB A;  3A0S A;  4NXE A;  3KSF A;  3O86 A;  4S2M A;  2ZC7 A;  2V0U A;  1LSX A;  4GDN A;  5EVI B;  3UE6 A;  1MWU A;  3V50 A;  5CGS A;  3T4L A;  2WUQ A;  4Y3I A;  4DMZ A;  3KYQ A;  5D3O A;  3WS5 A;  2O9A A;  2R78 A;  3PAE A;  5CGW A;  1H8M A;  4P0M A;  3IHA A;  3E2L A;  3ZHH A;  4BBV A;  3ZNY A;  2XR0 A;  2JE5 A;  4L9F A;  1DY6 A;  3HLW A;  4KZ4 A;  1OJG A;  3BY9 A;  4HQA A;  4LPZ A;  1IKG A;  1RP5 A;  2VGL M;  3MQQ A;  4CPK A;  1ESI A;  2EX8 A;  4UA6 A;  4I39 A;  3RFB A;  2IWD A;  1XX2 A;  1VQQ A;  2HP5 A;  4U0X A;  5BOH A;  5EOO A;  2WKE A;  1EW0 A;  5FSR A;  2QKP A;  3UN7 A;  1ES2 A;  2L1M A;  4E3K A;  2I9V A;  1K57 C;  4R38 A;  3HUO A;  1HTZ A;  2V0W A;  4XUZ A;  3F1P A;  4DF6 A;  4GNU A;  4OOM A;  4HY8 A;  3N7W A;  1NLY A;  4QD4 A;  2XD5 A;  3MKE A;  5DTK A;  3MFD A;  1W8Q A;  5JYP A;  3SH8 A;  1K25 A;  3W8K A;  5GLC A;  2HF6 A;  4P87 A;  4DE3 A;  3IBR A;  3O3V A;  3T4T A;  2HJE A;  3A0V A;  1C3B A;  4N1H A;  5DTT A;  2DMW A;  3P01 A;  2W27 A;  3RXX A;  5DVA A;  2ZQA A;  4I5S A;  4MN5 A;  2HDQ A;  4GN2 A;  4JGR A;  1Q2P A;  1NRF A;  3LI9 A;  4N9L A;  3UB5 P;  4WN5 A;  3UDX A;  1GHI A;  1KE4 A;  3Q7V A;  4H6J A;  1F9I A;  3N8S A;  4E3N A;  3W2Z A;  3W4P A;  3PHY A;  3F1P B;  5GL9 A;  3FZC A;  3VV4 A;  4CLC D;  3ZG5 A;  2XH9 A;  3IX8 A;  1JNU A;  2R9W A;  1MPL A;  2WAF A;  5G4Z A;  5E2E A;  2OV5 A;  1S6R A;  1TEM A;  2G7U A;  3ZVT A;  5KIZ A;  3SZT A;  1M40 A;  5HWT A;  1ERQ A;  1T19 A;  5EFW A;  2RL3 A;  2W3G A;  3MXR A;  4QWO A;  3UPP A;  5L8M A;  4LRZ E;  4IBX A;  5AQ7 A;  1XGI A;  3Q7Z A;  1OPX A;  5CRF A;  1FQG A;  3Q7V B;  3H9W A;  2JC7 A;  3IS2 A;  3DBA A;  1MKM A;  5HD5 A;  5A92 A;  5GHX A;  3VOY A;  2RCX A;  1YM1 A;  5KSH A;  2H28 A;  4LCL A;  1YMX A;  3CIT A;  4NET A;  1H3Q A;  5FQJ A;  2O9B A;  3H7W A;  4KZ6 A;  4OP5 A;  5HSQ A;  1PZO A;  3UDI A;  3ITA A;  3BJN A;  5E43 A;  4IUH A;  4BL3 A;  3P98 A;  3MFX A;  4EBL A;  4XUX A;  5G18 A;  3F1N A;  4UA9 A;  1WA9 A;  3HL9 A;  4EWF A;  3PAG A;  1UGU A;  2B95 A;  5J8X A;  3ICY A;  2WAD A;  1S1Z A;  3A3J A;  3CLO A;  1BUL A;  3IS2 B;  3UPO A;  1NYM A;  1XJ2 A;  2XA7 M;  1K4E A;  1KGG A;  4LV3 A;  1FOF A;  1PW1 A;  3NOT C;  5K5B A;  3PBO A;  1AXB A;  1E3U A;  3N4I A;  2VEA A;  2MJ6 A;  3H7W B;  3HUM A;  4NG2 A;  4UHU A;  5HPI A;  2P74 A;  1AWI A;  1YPR A;  3UO9 A;  4BMW A;  3ZGA B;  2O99 A;  2X71 A;  2W3E A;  4UAA A;  1L2S A;  4OON A;  2L0W A;  2ZBB A;  1FCO A;  1DP6 A;  3SOI A;  3QP1 A;  5HL6 A;  1ERO A;  1LL8 A;  2EFU A;  5CHJ A;  3W4Q A;  2PR5 A;  1STZ A;  1I2W A;  3PTE A;  2W1R A;  4JGP A;  3GQZ A;  1G6A A;  1YLY A;  5CHM A;  4PHT A;  5F69 A;  4OPR A;  4OOY A;  3LI8 A;  5DJT A;  4PMA A;  4DJ2 A;  4BEN A;  4MDZ A;  3L9K A;  1OTD A;  1TD5 A;  2Y2G A;  1V9Z A;  2Y2O A;  1KE3 A;  3ZDJ A;  2XGN A;  1MC0 A;  4IHQ A;  4WZ5 A;  2O0Y A;  4X53 A;  2Y91 A;  3NIA A;  3BW6 A;  4HBT A;  3NBL A;  2WKR A;  1K54 C;  1NRJ A;  3CG5 A;  4Y0O A;  2WKH A;  4G3V A;  1IEM A;  2Y2Q A;  1GHP A;  5DTS A;  2ZQ8 A;  4WZ4 A;  3PYP A;  3OOV A;  3IH9 A;  4P6B A;  2CMN A;  5EE8 A;  1EI5 A;  3F1O A;  2D02 A;  4KUK A;  3EOI A;  2M1C A;  3C5A A;  4EV4 A;  2XDM A;  2XF3 A;  3O87 A;  5DJU A;  3KSI A;  1FCN A;  4CLC B;  4BLM A;  5LBR A;  2UV0 E;  4RYE A;  3JYI A;  1BUE A;  4WMC D;  1LSW A;  2DRW A;  2VA0 A;  2WGV A;  5EVL A;  1XJ3 A;  1PWC A;  1YLT A;  3D3O A;  1NLZ A;  2J3W A;  2V1Z A;  1K6S A;  4UA7 A;  5DKK A;  3TW8 A;  3VMA A;  4Z9Q A;  2A3U A;  4KZA A;  4L0L A;  2LB9 A;  2EXB A;  3H82 A;  4WL9 A;  4FCF A;  1NY0 A;  4ETX A;  1PRQ A;  3F1O B;  5FA7 A;  5AVE A;  4DXC A;  1W63 Q;  2Q0O A;  4U3T A;  3UME A;  1TS6 A;  5HAP A;  4GD6 A;  1XKZ A;  2K7S A;  3N8L A;  4ARZ A;  4KZ5 A;  1RCJ A;  4HJ6 A;  1HZO A;  3GV9 A;  4PKY G;  1K55 A;  4O01 A;  1KOU A;  2OAQ 1;  2QJ5 A;  3Q82 A;  3IWI A;  3CHW P;  5FQI A;  4Y13 A;  2QWS A;  3T4K A;  1MWS A;  1D7E A;  4N92 A;  3UB7 A;  3JVU A;  1P97 A;  2V9A A;  4BBU A;  1LHY A;  2W0N A;  3SS4 A;  1YMS A;  5CED A;  2QYB A;  3HUN A;  4GW9 A;  5EEC A;  2H0Y A;  3MBZ A;  1KDW A;  2Q9M A;  5FQQ A;  4HI4 A;  1P9R A;  4LV0 A;  5CER A;  3CPT B;  3H82 B;  2IWC A;  1L0E A;  4ZRR A;  3EEH A;  3LFV A;  3VE3 A;  4B9O A;  5KSC A;  2XEP A;  4Q0J A;  3OCN A;  3DTK A;  2JCH A;  2ZLY A;  1TS7 A;  3M6B A;  4ARZ B;  1OTA A;  1OTI A;  5KZH A;  3ZYT A;  5DFX A;  2ZMV A;  2PU2 A;  1VHM A;  4HP9 A;  1SCW A;  3LEZ A;  4C6Y A;  2PYP A;  4MEZ A;  1L0F A;  2JKR M;  2OLV A;  4A5R A;  2HP6 A;  4KQO A;  2H10 A;  2WGW A;  3BEC A;  3MZD A;  1QME A;  4Y15 A;  1PYY A;  4LRY C;  3HLF A;  2VZW A;  4E3I A;  4YOF A;  4MLL A;  2Y4A A;  5F83 A;  2Z6D A;  1UWP X;  5J7E A;  2FZ0 A;  4IUK A;  1M6K A;  4S2N C;  1DP8 A;  4FOF A;  2Y59 A;  2R9X A;  2KDK A;  1P9W A;  4FUW A;  1ONG A;  4GJ4 A;  4NKP A;  3QP2 A;  3PBS A;  3QNB A;  4FH4 A;  1IYO A;  3NDE A;  3I7J A;  3OCL A;  5EVI C;  1QMF A;  3IXD A;  5GHY A;  5I94 A;  4DDY A;  3TSG A;  3UB9 A;  4O7D A;  5FAO A;  2WGW B;  1IYP A;  4IVK A;  4R4S A;  4QHC A;  2W3D A;  2VLG A;  3KSG A;  4X68 A;  4LLO B;  1NZO A;  2EX6 A;  3OC2 A;  2GDN A;  3IWQ A;  3ZQ5 A;  3LUQ A;  2FFY A;  2B02 A;  2ZOI A;  3VP3 A;  1MZU A;  1PWD A;  3VFF A;  3GMW A;  4NEE D;  3PBQ A;  4MNR A;  4HJ3 A;  4X55 A;  3M6H A;  3Q07 A;  4KG5 A;  4WUJ A;  1YLW A;  1PZP A;  3LGO A;  4ZJ2 A;  4BBT A;  4E6X A;  1FIK A;  1BLP A;  2K2N A;  4S2O A;  2X01 A;  3GTC A;  4OOL A;  1N9B A;  3A3E A;  5FI2 A;  5FDS A;  1JWZ A;  4S2K A;  5AVF A;  3HLE A;  4X56 A;  1ZG6 A;  3IF6 A;  5HDC A;  3R7W A;  3S7O A;  4ZDX A;  1T1A A;  1MWT A;  3FWL A;  3UE0 A;  1OME A;  1P0Z A;  1PIO A;  5F5Y A;  3HJK A;  2G2U A;  3EGX C;  3PBT A;  3HVF A;  4DE1 A;  5EPH A;  4B4Z A;  4MMN A;  1OJ5 A;  1S1Y A;  4G3K A;  2P04 A;  1EWZ A;  2EX9 A;  1K38 A;  4KG2 A;  4EET B;  1CEF A;  2XQZ A;  1NXY A;  5HWW A;  4ESP A;  1U60 A;  5L07 A;  5A90 A;  5FEG A;  1SDE A;  3W4O A;  1RGY A;  3BFD A;  5CX7 A;  2WKQ A;  5TBM A;  1ZC2 A;  3DW0 A;  4Q0H A;  3PBN A;  2YKF A;  4LFU A;  1F2K A;  4QY6 A;  3VSL A;  4CLC E;  1GSX A;  3PXP A;  1XA7 A;  1SHV A;  3K3C A;  3IF6 B;  4BD1 A;  3R7W B;  2PD7 A;  1W8Y A;  4LEN A;  3FG8 A;  4CJN A;  4RVA A;  4EBN A;  2Z2L B;  3ZG7 B;  5A8B A;  5M1A A;  1YLJ A;  2Y2N A;  5HPF A;  4MN7 A;  4K91 A;  1N9N A;  3U4L P;  4JPM A;  4XT2 B;  1CEG A;  1BLS A;  3CAX A;  3VSK A;  4YIN A;  4HH2 A;  4HEF A;  1V9Y A;  3MQ0 A;  4PM6 A;  1Q2Q A;  3IWO A;  2JKT M;  2VV6 A;  3K2N A;  3C38 A;  4KZ7 A;  3SS5 A;  4OQI A;  4EBP A;  4QY5 A;  2JKF A;  4Y17 A;  4I3J A;  5TBM B;  3CZD A;  3UPN A;  3MF0 A;  4HHD A;  3T1R A;  2ZL1 B;  4KQQ A;  3B3X A;  5HDS A;  1LL5 A;  5IHV A;  4RX3 A;  3E4P A;  2XFT A;  2PBD P;  2PHY A;  3BYD A;  5HZH A;  1ES5 A;  3HRE A;  1W5D A;  3T4S A;  1XJ4 A;  3EQV A;  3MXQ A;  2INW A;  4FTX A;  1GA0 A;  3DWZ A;  3FV7 A;  1MY8 A;  4X25 A;  3RJU A;  4R3B A;  2AVX A;  4OPZ A;  1ZG4 A;  2J3T D;  5HAI A;  2WZZ A;  5L2F A;  3HLC A;  5HX9 A;  3KO6 A;  5F1F A;  1HD8 A;  4U0T A;  2M7V A;  2I72 A;  4Y0U A;  2CC1 A;  1YSP A;  5GHZ A;  5EUA A;  4BQM A;  2ZM0 A;  4DJ3 A;  1PNE A;  1I5Q A;  2PT7 A;  4E3L A;  3T1X A;  2V1B A;  4JGO A;  4P6Z S;  4EES A;  1TF1 A;  1K0K A;  4OQ0 A;  4II7 A;  4ZTK A;  2ZJ9 A;  2OOL A;  4I3A A;  5HFO A;  1Y4O A;  3LY3 A;  4ME4 A;  1XFQ A;  2WZX A;  4EQI A;  1D06 A;  2B5R A;  2OLU A;  1XA1 A;  2OWH A;  3RH8 B;  2O9C A;  3ZCZ A;  5FQK A;  2QHK A;  1XGJ A;  2PD8 A;  3HLB A;  5CTN A;  3D72 A;  4OPY A;  1XPB A;  4HNB A;  3E98 A;  2HJ9 C;  1MBL A;  5M19 A;  3E2K A;  4WYY A;  3B33 A;  3LYX A;  1BSG A;  3IH8 A;  3NC8 A;  3MMH A;  2M7U A;  5HW3 A;  3OPL A;  1PI4 A;  3CWF A;  1DJC A;  5F68 A;  5AQA A;  5G4Y A;  2WKP A;  3GR2 A;  3V5M A;  4OH0 A;  1G68 A;  1I2S A;  2Y2H A;  5E2G A;  3E4O A;  3EWK A;  4MBK A;  4GZB A;  3NY4 A;  1TS0 A;  1OT6 A;  1Y54 A;  1VM1 A;  4JXS A;  4FSF A;  4CLC A;  1UWN X;  4IVI A;  4N9K A;  2IWB A;  1N9L A;  1E25 A;  3BM6 A;  3P7N A;  4R3J A;  1TVF A;  2GZA A;  4HBU A;  1H8Z A;  3VFH A;  3T50 A;  4Q0I A;  3DTE A;  3G34 A;  4LGW A;  2WYX A;  2VGJ A;  3C4P A;  4ZJ3 A;  2VGK A;  1XFN A;  4WEJ A;  4KUO A;  3BQA A;  3VP0 A;  1GCE A;  2HZ5 A;  4B93 A;  3SS3 A;  4FH2 A;  1DJB A;  4QJG A;  4R3A A;  1IKI A;  2J9P A;  4PM7 A;  2PBY A;  2ZM8 A;  5FI6 A;  2PDR A;  2D01 A;  3MZF A;  2VJW A;  4Z1W A;  1K6R A;  4DE0 A;  4PM5 A;  1O07 A;  5FAP A;  1G5U A;  5AJG A;  2XLN A;  4OP8 A;  5FAS A;  1OTE A;  3L7H A;  4K08 A;  4WZ5 C;  2Q9N A;  3BLM A;  3LO7 A;  3VP2 A;  2GX5 A;  4NXG A;  1YKD A;  3FPV A;  3KYE A;  4EW7 A;  5EV0 A;  5IS1 A;  1XJ6 A;  1PWG A;  3IHB A;  5FEF A;  3LR4 A;  3WS4 A;  5HL1 A;  3CPT A;  4ZAM A;  3BEB A;  3V39 A;  3LID A;  3PR6 A;  3HLG A;  2Y2I A;  4HH3 A;  3ZFZ A;  2FH5 A;  1BZA A;  4I38 A;  4JF6 A;  2A24 A;  3LR0 A;  2ZOH A;  4GB7 A;  5CGX A;  5EVE A;  5J3W A;  2BTF P;  3IBJ A;  4H8R A;  4CQH A;  5CTM A;  5E2F A;  1SDN A;  2A49 A;  4D60 A;  3QNC A;  3C7U A;  4UEY A;  3TRC A;  2X02 A;  4R6L A;  3MR0 A;  3OPH A;  3KYZ A;  3VP4 A;  1MXO A;  4S2J A;  1ZKJ A;  4JGQ A;  2WKI A;  1CI8 A;  5GLA A;  5E2H A;  2Y2M A;  1OTB A;  4Y7P A;  3SW1 A;  5FAQ A;  1FCM A;  1KGF A;  4GD8 A;  1S66 L;  4HIA A;  5DF8 A;  2PRF A;  3IT9 A;  3CUE A;  4PPR A;  1A0K A;  3LCE A;  2V8F A;  1L0G A;  1YQS A;  1S67 L;  2ZQC A;  3LIC A;  2H5S A;  3JVV A;  1W79 A;  2VV7 A; 
#chains in the Genus database with same CATH homology
 2VX8 A;  4IJG A;  1F5M A;  4EEP A;  5I5L A;  4MN6 A;  2A24 B;  2Y8H A;  4R70 A;  2EA9 A;  1S4S A;  5IU1 A;  5KSH A;  2H28 A;  4YNR A;  5AVF A;  2PR6 A;  3CIT A;  3LIB A;  3K3D A;  5HDC A;  3R7W A;  1H3Q A;  3S7O A;  1T1A A;  2O9B A;  3H7W A;  4WEK A;  2XSS A;  3B42 A;  1G6O A;  1P0Z A;  5HSQ A;  5F5Y A;  3HJK A;  3EGX C;  3PBT A;  5J4E A;  3NJA A;  3BJN A;  4IUH A;  4EQ1 A;  4MMN A;  4GCZ A;  1YAX A;  1OJ5 A;  1S1Y A;  3MFX A;  4G3K A;  2P04 A;  3F1N A;  3T4Q A;  2P08 A;  1WA9 A;  1UGU A;  4EET B;  4CLC C;  4YWZ A;  5IT5 A;  3KX0 X;  3ICY A;  1Y28 A;  4EUV A;  5HWW A;  4P6Z M;  1S1Z A;  4HOI A;  3CLO A;  3IS2 B;  5CX7 A;  2WKQ A;  5TBM A;  3GEC A;  2A2L A;  1XJ2 A;  3O5Y A;  4NXB A;  4Q0H A;  2XA7 M;  3PBN A;  2YKF A;  5HWV A;  4UQI S;  3UB8 A;  1IFQ A;  1T1C A;  4CLC E;  3NOT C;  1GSX A;  5K5B A;  3PXP A;  3PBO A;  3K3C A;  3S7P A;  3C30 A;  2VEA A;  3LIE A;  3R7W B;  2PD7 A;  1N9O A;  1W63 M;  3LR5 A;  2MJ6 A;  3H7W B;  3FG8 A;  1LT0 A;  5C5K A;  5A8B A;  5HPI A;  5HPF A;  4MN7 A;  3C8C A;  1X0O A;  4BMW A;  1N9N A;  4GLQ A;  4XT2 B;  2O99 A;  4F3L A;  3U2A A;  3CI6 A;  2W3F A;  2W3E A;  3CAX A;  1VB6 A;  4HJ4 A;  4HH2 A;  2KLI A;  2L0W A;  1V9Y A;  2ZBB A;  3MQ0 A;  3EEA A;  1DP6 A;  2JKT M;  2VV6 A;  3K2N A;  4MCW A;  3C38 A;  5HL6 A;  1LL8 A;  2NUP C;  4I3J A;  1TS8 A;  2PR5 A;  4BJP A;  5TBM B;  3G6O A;  2JKR I;  4AFI A;  1STZ A;  4L9G A;  3MF0 A;  2J3T C;  2W1R A;  4HHD A;  4JGP A;  1DRM A;  3GDI A;  1LSV A;  3S7Q A;  2YKH A;  3TE8 A;  3NHQ A;  5HD3 A;  1DP9 A;  4RQ9 A;  4PHT A;  5F69 A;  5HDS A;  1ODV A;  3TJZ C;  4Y5F A;  3LI8 A;  5DJT A;  3E4P A;  4DJ2 A;  2IA2 A;  2J80 A;  2PHY A;  5HZH A;  2GNX A;  4MDZ A;  4WLA A;  3LIF A;  1OTD A;  3A0R A;  1TD5 A;  3V67 A;  4QPR A;  4F3L B;  4E04 A;  1V9Z A;  3T4S A;  1XJ4 A;  1YSQ A;  3EQV A;  3MXQ A;  2OAP 1;  2INW A;  2QJ7 A;  1MC0 A;  4IHQ A;  2O0Y A;  1G28 A;  2J3T D;  3BW6 A;  2WKR A;  2Z6C A;  3BY8 A;  1NRJ A;  4DN0 A;  2ZMF A;  4G3V A;  4WEL A;  3KO6 A;  4XT2 A;  3NOP C;  4KQD A;  2M7V A;  3PYP A;  3OOV A;  4Y2F A;  2CMN A;  1YSP A;  4BWI A;  3FPW A;  3F1O A;  2D02 A;  2XRN A;  1S4R A;  4KUK A;  3EOI A;  4O8G A;  2Y79 A;  2JN7 A;  2M1C A;  4DJ3 A;  2PT7 A;  3EGD C;  4I3I A;  2V1B A;  3CUE C;  2KOI A;  4JGO A;  3KSI A;  4P6Z S;  5DJU A;  4CLC B;  3T4J A;  4EU0 A;  5LBR A;  4EES A;  1TF1 A;  1ZHH B;  4II7 A;  4GS9 A;  4O0P A;  1LSW A;  2W1T A;  2XA7 S;  2OOL A;  2VA0 A;  4I3A A;  3BQ8 A;  3OBF A;  4UQI M;  5DFY A;  4ME4 A;  1XFQ A;  1NWZ A;  1D06 A;  1XJ3 A;  5HDD A;  3D3O A;  1NLZ A;  5DKL A;  2EWV A;  2K31 A;  2J3W A;  2OWH A;  1F98 A;  2O9C A;  2BAS A;  5DKK A;  3RH8 B;  3TW8 A;  2EWW A;  3KSH A;  5MC7 A;  4HP4 A;  3MQO A;  2QHK A;  3A0S A;  4NXE A;  4L0L A;  2PD8 A;  3BWL A;  3KSF A;  2LB9 A;  3D72 A;  2V0U A;  1GSW A;  1LSX A;  4HNB A;  1T18 A;  3H82 A;  4WL9 A;  3E98 A;  4ETX A;  2HJ9 C;  3F1O B;  2PYR A;  5AVE A;  3B33 A;  3R4K A;  3OLO A;  4PKY A;  3LIA A;  3UE6 A;  3PBR A;  3LYX A;  1W63 Q;  3UME A;  1TS6 A;  3T4L A;  4Y3I A;  4DMZ A;  2K7S A;  3UE3 A;  3KYQ A;  3MMH A;  2M7U A;  4ARZ A;  3S7N A;  3CWF A;  5TJJ A;  2O9A A;  5F68 A;  4HJ6 A;  5G4Y A;  4PAU A;  2WKP A;  4PKY G;  4GS9 B;  2R78 A;  4O01 A;  1KOU A;  2OAQ 1;  2VKS A;  2W1T B;  1H8M A;  2QJ5 A;  3E4O A;  3EWK A;  4BBV A;  2QWS A;  3T4K A;  4L9F A;  1D7E A;  3HCY A;  1TS0 A;  1OT6 A;  3VE4 A;  3E0Y A;  4FSF A;  3UB7 A;  3JVU A;  1P97 A;  2V9A A;  4BBU A;  4CLC A;  2W0N A;  2HV1 A;  1UWN X;  2HGV A;  4GHI A;  1OJG A;  2QYB A;  4GW9 A;  1N9L A;  3BY9 A;  4HQA A;  4LPZ A;  1OT9 A;  3P7N A;  2VGL M;  3T4O A;  4HI4 A;  1P9R A;  2GZA A;  3MQQ A;  3H82 B;  3UMD A;  4H6J B;  2NUT C;  3HJI A;  4M4X A;  4I39 A;  3RFB A;  4ZRR A;  3EEH A;  3LFV A;  3VE3 A;  4B9O A;  4G3W A;  4Q0J A;  3T50 A;  4Q0I A;  3OCN A;  4EEU A;  3B47 A;  1TS7 A;  3ULF A;  4EER A;  2OWJ A;  4ARZ B;  1OTA A;  1EW0 A;  2QKP A;  1OTI A;  2L1M A;  2I9V A;  3ZYT A;  5DFX A;  1GSV A;  1XFN A;  2ZMV A;  4EXO A;  4WEJ A;  4KUO A;  2JKT I;  3LR3 A;  1BYW A;  4R38 A;  1VHM A;  4HP9 A;  2V0W A;  3BQA A;  3F1P A;  2PYP A;  4OOM A;  4HY8 A;  4B93 A;  1NLY A;  2JKR M;  2V1A A;  4R3A A;  4KQO A;  4GHI B;  2HF6 A;  3IBR A;  3T4T A;  2PDR A;  2HJE A;  3A0V A;  2D01 A;  4LRY C;  1T1B A;  2VZW A;  2VJW A;  4Z1W A;  2DMW A;  2XRO A;  3P01 A;  2W27 A;  5AJG A;  2P7J A;  4YOF A;  3MJQ A;  2GJ3 A;  2KX6 A;  1OTE A;  4K08 A;  2GX5 A;  4NXG A;  1YKD A;  2Z6D A;  3FPV A;  4I5S A;  4MN5 A;  4EW7 A;  3UB6 A;  4JGR A;  1UWP X;  4WF0 A;  5IS1 A;  5F6A A;  1XJ6 A;  2W3H A;  2FZ0 A;  5J7E A;  4IUK A;  3EQU A;  3LI9 A;  5FL3 A;  3LR4 A;  4WN5 A;  1DP8 A;  2B18 A;  4FOF A;  4H6J A;  2L4R A;  1F9I A;  3E4Q A;  3LID A;  2KDK A;  1P9W A;  3PR6 A;  3W2Z A;  3PHY A;  3F1P B;  4GJ4 A;  4L9E A;  4NKP A;  3VV4 A;  4LRX C;  3PBS A;  5DF9 A;  4HH3 A;  4CLC D;  2FH5 A;  4I38 A;  3VOL A;  3OCL A;  2A24 A;  3LR0 A;  2ZOH A;  3RTY A;  3F1N B;  5J3W A;  1JNU A;  3IBJ A;  3UB9 A;  4CQH A;  2VV8 A;  2W3D A;  2VLG A;  3KSG A;  5G4Z A;  4LLO B;  4ETZ A;  3C2W A;  1IOU A;  4UEY A;  2G7U A;  3TRC A;  5KIZ A;  3OC2 A;  4R6L A;  3MR0 A;  5HWT A;  3ZQ5 A;  3KYZ A;  3LUQ A;  3FC7 A;  2B02 A;  2ZOI A;  4NXF A;  1T19 A;  1MZU A;  5EFW A;  2W3G A;  4NEE D;  3PBQ A;  4JGQ A;  3NOU C;  4HJ3 A;  2JHE A;  2LB5 A;  5L8M A;  1ZTU A;  4LRZ E;  1OTB A;  3SW1 A;  4WUJ A;  1OPX A;  4BBT A;  1S66 L;  4HIA A;  3CUE A;  3H9W A;  2K2N A;  1S67 L;  3IS2 A;  3DBA A;  1MKM A;  5HD5 A;  3LIC A;  2VGL S;  4OOL A;  3JVV A;  2VV7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...