1G28A

Structure of a flavin-binding domain, lov2, from the chimeric phytochrome/phototropin photoreceptor phy3
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
104
structure length
104
Chain Sequence
b'KSFVITDPRLPDNPIIFASDRFLELTEYTREEVLGNNCRFLQGRGTDRKAVQLIRDAVKEQRDVTVQVLNYTKGGRAFWNLFHLQVMRDENGDVQYFIGVQQEM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PHY3 PROTEIN
publication title Structure of a flavin-binding plant photoreceptor domain: insights into light-mediated signal transduction
pubmed doi rcsb
source organism Adiantum capillus-veneris
molecule tags Signaling protein, electron transport
total genus 29
structure length 104
sequence length 104
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-10-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1g28A00
4HNBA 3LIAA 5J7EA 2PDRA 4H6JA 4JGPA 4L9EA 3UE6A 3CWFA 2PHYA 4R38A 4EETB 3FG8A 4DJ3A 4PKYG 3C2WA 1XFNA 3H9WA 3UMDA 3RH8B 3UB8A 4R6LA 1T1BA 1OJ5A 2J80A 3B33A 1F9IA 3F1PA 4NXBA 3MQQA 3SW1A 4NXGA 1S66L 3PYPA 1XFQA 2QWSA 4HH3A 4I3JA 1N9LA 2GJ3A 1D7EA 1N9NA 2VV6A 3VOLA 3HJIA 4HI4A 1JNUA 4HP4A 2L0WA 4HOIA 3LI8A 1P0ZA 4F3LA 4HH2A 2HV1A 2V9AA 5HWTA 3LYXA 3T50A 2B02A 3H82A 1OTIA 2INWA 4WLAA 4B9OA 2V1BA 2PR6A 3EEHA 3GDIA 3LIFA 3G6OA 1DRMA 4NXFA 3IS2A 3ZQ5A 2VV7A 1XJ6A 2Z6DA 1S1ZA 1TS0A 3LIEA 2JN7A 4MN5A 2Z6CA 1GSVA 1T1CA 4EEUA 1TS7A 1P97A 2KDKA 5A8BA 3E4OA 1LSWA 4DJ2A 4LLOB 3LIDA 4JGRA 3OLOA 4XT2B 5TBMB 1LSXA 2WKQA 1TS6A 4EQ1A 2W27A 2W0NA 1DP6A 5IS1A 5DJUA 2A24A 3C8CA 5F6AA 4WL9A 5HZHA 4BBVA 3ICYA 4GS9A 2I9VA 2QHKA 3H7WA 2QKPA 1UGUA 3A0VA 1N9OA 4RQ9A 4MN6A 1OT9A 1S1YA 4EERA 1GSXA 4I38A 5F69A 5DKLA 3F1NB 1KOUA 4R70A 3MQOA 4EESA 1G28A 1ODVA 3E4PA 2WKPA 2CMNA 3LUQA 3F1OB 5G4YA 4R3AA 5G4ZA 4KUOA 3P7NA 1DP9A 4HHDA 1LT0A 2WKRA 4I3IA 3A0RA 5HD5A 4I3AA 2PYPA 1UWNX 1EW0A 1WA9A 5EFWA 4EW7A 4LRXC 1XJ4A 1VB6A 4GCZA 2VEAA 1X0OA 2OWHA 4K08A 5F68A 4WF0A 4M4XA 1V9YA 1T18A 3LI9A 1BYWA 5J3WA 4GHIB 3A0SA 5DJTA 3ULFA 2D01A 3NOPC 1DP8A 3RTYA 4BBTA 4HJ3A 4WN5A 2L1MA 4I5SA 3HJKA 4PKYA 4LRZE 4KQDA 1OTDA 3KX0X 3PHYA 3VE3A 3NOUC 4L9FA 2P7JA 4H6JB 1V9ZA 2D02A 4JGOA 3K3DA 3UB7A 4EXOA 5HDCA 3MFXA 2PR5A 5AVFA 4HJ6A 4XT2A 2VV8A 1S4SA 3UB6A 5TBMA 2PD8A 2VLGA 5J4EA 3F1PB 2V0UA 2PYRA 4L9GA 3LICA 5AVEA 4HIAA 2OWJA 1OTEA 2K7SA 3IBRA 2V1AA 5KIZA 4F3LB 2ZOHA 4WUJA 1OTAA 3FC7A 3MJQA 3CLOA 3H82B 1LL8A 4E04A 3F1NA 1T1AA 3GECA 3MXQA 1F98A 5F5YA 1XJ2A 3IS2B 5HWVA 1LSVA 1S4RA 3BY9A 2H28A 4JGQA 1T19A 1OTBA 4LRYC 1Y28A 4NXEA 1D06A 3F1OA 3UMEA 3E4QA 2JHEA 4EEPA 3NHQA 2QJ5A 3UB9A 5HDSA 2EA9A 2QJ7A 5DKKA 1OT6A 3MR0A 4KUKA 5HWWA 4YWZA 3EWKA 5I5LA 2KX6A 2YKFA 1XJ3A 3BWLA 1OJGA 3D72A 3LIBA 1NWZA 2L4RA 5HDDA 1TS8A 1MZUA 2M1CA 3NOTC 2OOLA 1S67L 4GW9A 3VE4A 2A24B 4BBUA 4HJ4A 3NJAA 2ZBBA 2BASA 4I39A 5HD3A 4GS9B 4HY8A 2V0WA 4GHIA 3H7WB 4LPZA 1UWPX 2ZOIA 5IU1A 2PD7A 3BY8A 3CAXA 5HSQA 4HP9A 2YKHA 4HQAA 1GSWA 3K3CA 2R78A
chains in the Genus database with same CATH superfamily
1BTLA 4JGPA 5DF7A 4N1HA 3CWFA 5C5KA 2PHYA 3A3FA 4Z1WA 4EETB 1STZA 4DJ3A 2V20A 3QP8A 1EWZA 1XFNA 1JWPA 2OSUA 3UMDA 3RH8B 1OJ5A 3PTEA 2Y2LA 4BQMA 1F9IA 1LL9A 3ZG8B 1PI4A 5CHUA 3F1PA 3KYQA 4IBRA 2QZ6A 4NK3A 4PM5A 4HEFA 5HAQA 3BECA 4KQQA 1OMEA 2J9OA 3T1QB 4NXGA 1QMEA 4QU3A 2V2FF 3LR4A 1GHPA 1I2WA 3WS1A 5GLCA 4I3JA 3OC2A 4X53A 4YOFA 5DF8A 1D7EA 4JXSA 3VOLA 1ES3A 4HP4A 2L0WA 2J3TC 1K54A 2ZC4B 3VP1A 4WZ5A 4S2LA 3JVUA 4Y13A 3T50A 2B02A 2INWA 5E2HA 1Z09A 2VGLS 2ZC7A 1W5DA 2NUPC 1WYBA 1K25A 4KZAA 2W1TB 4S2PA 3ZQ5A 5FASA 2VV7A 1XJ6A 1MXOA 3A3EA 5F1FA 2VJWA 1KDWA 2HZ5A 3O3VA 4IBXA 1T1CA 3VP3A 3G2ZA 4JBFA 4E3OA 2KDKA 3DTKA 1TD5A 1VEUA 1NXYA 5HPFA 2VK3A 3MBZA 3TW8A 5KMWA 1CF0A 2XD1A 2Y55A 1XX2A 4QY6A 4IHQA 4JGRA 4NEED 5HFOA 3PBQA 3S7OA 4N1XA 2FFYA 3VOYA 2ZQDA 1YLTA 2ZC5B 4GZBA 3B47A 2W0NA 3ZFZA 2JKRM 4BL2A 3N8LA 4MMNA 5HAPA 1JVJA 1K55C 3I7JA 5F6AA 3HVFA 2WGWA 3KSGA 5HZHA 4FH2A 4N9KA 4JXVA 4UAAA 3UE1A 1NYMA 3S22A 4OQ0A 3IF6B 4GS9A 2VGLM 3N4IA 2B5RA 3T1XA 2QKPA 1UGUA 5K5BA 1E25A 1FCMA 3R7WA 4RQ9A 1OT9A 1ZG4A 4Y2FA 4PM7A 1KOUA 4R70A 3MQOA 5FQMA 4O7DA 5EVLA 3E4PA 5HAIA 3LR3A 3VOZA 5FI7A 2XA7S 4CLCB 4GD8A 4NETA 5AQ7A 1GHMA 3O88A 4JPMA 5G4ZA 1H8ZA 4KUOA 2IWDA 3SH8A 1N9BA 3BFFA 1WE4A 3HUMA 2WZXA 3BQAA 4R23A 3NI9A 4I3AA 1G68A 2ZM2A 2B95A 3BJNA 4P85A 4KZ3A 3QNCA 5FQIA 2EWWA 4R1GA 3DBAA 1NLZA 2VEAA 1K56D 3RXXA 3W4QA 2J3TD 5F68A 4P0MA 3T4LA 1V9YA 1FSYA 3WRZA 5GLAA 3UE3A 3LR0A 3PBTA 1BYWA 2XF3A 1MWSA 4GHIB 3A0SA 5F82A 3LEQA 2D01A 3NOPC 4U3TA 3RTYA 4BBTA 4HJ3A 1TF1A 3NDGA 1PWCA 4WN5A 2L1MA 2KLIA 4I5SA 5AQ9A 5TJJA 3FKVA 3MZFA 2XA7M 3EQUA 1KE4A 1W8QA 4E3MA 4L9FA 5GLBA 5A91A 4JF4A 1IELA 4H6JB 1V9ZA 4JGOA 1NZOA 2J7VA 3K3DA 1H8YA 2RCXA 4OQIA 1N4OA 2EX6A 4GB7A 1ERQA 3Q07A 4S2MA 2Q9MA 4II7A 2FZ0A 5FEFA 3MFXA 4QJGA 3UB6A 5CX7A 2PD8A 3O5YA 3CG5A 1E3UA 3CPTA 4K91A 3EQVA 2V0UA 3BFCA 2PYRA 1FCNA 3LICA 3IWOA 3OCNA 4HIAA 3KSFA 3IBRA 4C6YA 3ZG5A 1K54C 1MY8A 1PW8A 3BRMA 3ZVTA 2XEPA 4WZ5C 2BTFP 2XROA 2DNSA 3EGXC 3IT9A 4MLLA 1FR1A 1SHVA 2EFUA 2JE5A 2HDRA 2AVXA 4Y0TA 2GDNA 1NYYA 5CTNA 3MXQA 1S0WA 1YQSA 2HP6A 2CC1A 3QNBA 1IYSA 1T19A 3D9YA 4LRYC 4IUKA 1D06A 3F1OA 4PM6A 4OPZA 2JHEA 1SDEA 2HDSA 5E2GA 2QJ5A 3HLWA 1Z6FA 2EA9A 2XLNA 2XQZA 4PM8A 1W8YA 1FR6A 4AFIA 3IX4A 3TRCA 4ARZB 3TJZC 3IBJA 4WM9A 1XJ3A 3Q1FA 3K2NA 1LL5A 5CGXA 1ES5A 1HVBA 4HBUA 3V50A 1XA1A 5DTTA 2FFFB 1FSWA 2L4RA 2ZD8A 1TS8A 2JKGA 5CGSA 2M1CA 3V67A 4Y17A 3OPHA 2Y79A 4O0PA 2OOLA 1S67L 2XD5A 1L2SA 4DKIA 3FWLA 1WYCA 3QP1A 4HJ4A 3NJAA 4MBKA 3W8KA 2VZWA 4E3JA 4B4XA 2V0WA 3VFFA 2WKIA 4CPKA 1CJFA 3E2KA 2C6WB 3KYEA 1YLJA 2ZOIA 2PD7A 5HSQA 1ZC2A 1YSQA 4HP9A 4HQAA 4UA6A 3K3CA 4O01A 3LIAA 4EUZA 3DAVA 1SKOA 1YT4A 1K0KA 3HLEA 4R38A 2Y59A 4MN7A 3C2WA 3DTIA 5M1AA 4WEKA 1L0FA 3NCKA 4KQRA 4PHTA 1M6KA 4R6LA 2NUTC 1IYQA 2HP9A 3E98A 2J80A 3CI6A 3WS0A 3MSHA 2P04A 4X68A 1XGIA 3BYDA 2WYXA 3SW1A 3ZGAB 3CUEA 1KE3A 1FOFA 1Y4OA 3IXGA 1S66L 3G34A 1KVMA 1VETA 2JCHA 3WS2A 1N9LA 3NY4A 5CHMA 5F1GA 3B3XA 1TVFA 1SZVA 1TEMA 2ZMVA 2EWVA 2W1RA 4HOIA 3W4OA 4F3LA 3ZYTA 4HH2A 1MWUA 2ZQ7A 1OTIA 4LCLA 4WLAA 4B9OA 4D60A 4ZRRA 4WEJA 4GKUA 3LIFA 4DN0A 3QP2A 1BLSA 1S1ZA 3MKFA 3CZDA 2IWCA 4IVKA 3HBRA 2JN7A 5DVAA 3M2KA 2Z6CA 4Q0JA 4RX2A 5CXWA 4EBPA 5A8BA 4HESA 3PAGA 1RGYA 4OLDA 3TOIA 5L10A 1ES4A 5LBRA 3RJUA 5DTKA 1BLCA 3T4SA 5KSCA 3Q81A 4KG6A 5E2EA 2Y2HA 4DJ2A 4X1LA 1IEMA 3OLOA 1GA0A 4XT2B 2XFTA 5TBMB 5AQAA 3KO6A 4Y3IA 2J8YA 2ZL1B 4JF6A 5TFQA 2X02A 1GHIA 2JKFA 3MF0A 1K6RA 3UE0A 4GNUA 2FH5A 2W27A 2Y2QA 1W79A 2EX2A 4ESPA 1HTZA 1K6SA 1DP6A 5IS1A 5DJUA 2A24A 3HREA 1FCOA 3G4PA 4WL9A 2HF6A 4XXRA 5EPHA 4BBVA 4FH4A 1MPLA 3PBOA 5JYOA 3ICYA 2I9VA 3PBRA 2QHKA 1E4DA 3H7WA 5IHVA 5U47A 5FA7A 1YAXA 1ZG6A 3BM6A 4MNRA 1W7FA 4DXBA 3PAEA 3A0VA 2JKRI 3T4KA 2R9WA 3LEZA 1S1YA 4LV0A 4EERA 1GSXA 4OPQA 5L07A 4I38A 1XKZA 2P08A 5DKLA 3F1NB 2A49A 4R4SA 1M40A 5HPIA 1G28A 1ODVA 3Q7VA 3UDFA 1MBLA 4BD1A 3GSGA 2I72A 2H0YA 3WS5A 4G3WA 3RXWA 2K31A 4EWFA 4MDZA 5G4YA 1LHYA 5DFXA 4Y15A 2WGIA 1MWRA 1BULA 3P7NA 1DP9A 3S7NA 3MZEA 1LT0A 2J3WA 3WRTA 4S2IA 5HD5A 4KG2A 5J8XA 4P87A 1U60A 3VP0A 1UWNX 1JTDA 1RCJA 1WA9A 5FSRA 3IXBA 5HL6A 4GD6A 4LRXC 4FOFA 1G5UA 1X0OA 5E43A 4RYEA 1GCEA 4ZBEA 4KG5A 3N6IA 4K08A 1IKGA 4WF0A 1YLYA 4M4XA 1NRJA 3FKWA 2JC7A 4K0XA 1O07A 4EU0A 3LI9A 3LR5A 3PXPA 3AGDA 5J3WA 3ZVWA 1I5QA 1HLUP 3VFHA 4Z9QA 3DTEA 5HX9A 4N9LA 2VGKA 4KENB 4DDYA 4PPRA 4PKYA 1A0KA 4LRZE 4KQDA 1OTDA 3IH8A 3VE3A 3FV7A 2P7JA 2LB5A 4PMAA 4X25A 3RFBA 2D02A 4NKPA 3C5AA 5CEDA 3ZG0A 1IYPA 3UB7A 4LENA 4C75A 4EXOA 2JBFA 2WAEA 3A3JA 1BT5A 3M2JA 1NRFA 4HJ6A 1E3UD 3UN7A 4KZ9A 2VLGA 3L7HA 4CLCE 5J4EA 1YKDA 5EM1A 3CUEC 1H5XA 1MC0A 3E0YA 3F1PB 4KZ6A 2DMWA 4YFMA 1IKIA 5FAOA 3G35A 2ZQ9A 1OTEA 1TDLA 3IX8A 5FQQA 4U0XA 4OPYA 1IOUA 1AWIA 3N8SA 1CK3A 2Y2IA 2BLSA 4Y0UA 5FAQA 2V1AA 2ZQCA 5KIZA 4WELA 3B42A 3GQZA 3CMZA 1LLBA 2V8CA 4WUJA 4ZJ3A 3FC7A 5CHJA 1T1AA 4Y0OA 4E3NA 5EUAA 1L0GA 2H10A 5F5YA 1XJ2A 3PBSA 4E3LA 2RL3A 3S1YA 2GX5A 3SH9A 4QHCA 4JGQA 2PBYA 4E6WA 3LCEA 1OTBA 4GJ4A 4DE0A 3UB5P 5M19A 1VEUB 4JF5A 1PWDA 5FQJA 2ZC3B 2QJ7A 2A2LA 1ZKJA 3MR0A 2Y2NA 3OPPA 1PI5A 3O86A 4D2OA 2WUQA 2OLUA 5I5LA 2YKFA 3QP6A 2EX8A 4RA7A 4WZ4A 2XGNA 4OLGA 4EBNA 3M6HA 4P6ZS 3LIBA 5HDDA 1L0EA 5FDSA 4OQGA 2Q9NA 3QHYA 3JVVA 4X56A 2WGWB 4ZTKA 4IVIA 2ZBBA 4I39A 1CEGA 2PAVP 5GL9A 3OPRA 2P9VA 4QPRA 4GS9B 4OONA 5GHXA 4LV3A 5E2FA 1SCWA 3BY8A 2G2UA 3R7WB 2YKHA 2ZM0A 5L8MA 2WADA 3EOIA 4B93A 2UWXA 3HLGA 2VGJA 1ONHA 3PBNA 4UHUA 3KSIA 5J7EA 3IQAA 3IF6C 2PDRA 4L9EA 3MMHA 3SS5A 1W63Q 1JWZA 2WAFA 3BQ8A 5TR7A 4PKYG 5L09A 2W3FA 2G2WA 2IA2A 4OOYA 3UDXA 3H9WA 3ISGA 5FEGA 1T1BA 3AGEA 1NLYA 3E2LA 2HJEA 4P6ZM 4X55A 4GDBA 4DDSA 3V5MA 3KSHA 5AJGA 3DW0A 1ERMA 1XFQA 1KE0A 4PM9A 1N9NA 2VV6A 3A3IA 3HUNA 3C30A 3HJIA 3U2AA 3BEBA 3LI8A 3DWZA 3N7WA 3FZCA 4BLMA 5HWTA 5EVIA 5CTMA 3H82A 1PRQA 1P9RA 3MKEA 2ZC6B 3IF5A 3HCYA 4WYYA 1BZAA 2PR6A 5L2FA 3EEHA 2M7UA 3UPNA 4ETXA 2PRFA 2HP5A 1W63M 1DRMA 4K0WA 4NXFA 3IS2A 2Z6DA 3IHAA 4EBLA 3LIEA 4BL3A 1NY0A 5FQ9A 1VHMA 5FQKA 5I94A 3MZDA 2VA0A 5CERA 4M3KA 3A3DA 4ZAMA 1LSWA 5BOHA 2ACGA 3NBLA 2H0TA 2ZJ9A 5A93A 4LLOB 1ACFA 3LFVA 3LY3A 2JKTI 1LSXA 3NDEA 4BJPA 3T4JA 3G31A 4KZ8A 3CPTB 1EI5A 1XXMA 3V3RA 4JXWA 1L3LA 1ZTUA 4E3KA 1QMFA 1S6RA 3O87A 2Y2JA 4B88A 5A90A 4KZBA 1ESIA 3VSLA 3SOIA 1JWVA 3V39A 1N9OA 3OBFA 1XA7A 4MEZA 1C3BA 4MN6A 1VQQA 4KZ4A 3C4PA 5DTSA 1FIKA 5F69A 3UDIA 2E8JA 4EESA 5FL3A 3IX3A 2XSSA 2GNXA 2O9AA 2Y91A 2PU2A 3Q82A 1I2SA 4UQIS 2Y2OA 4GDNA 2WKPA 2OV5A 4IEDA 5EVEA 2G7UA 3LUQA 4X69A 3F1OB 5CGWA 2PBDP 4R3AA 4E3IA 3AGFA 2WZZA 1IYOA 4Q0IA 4DE3A 1J3WA 4XUXA 3NECA 4EW7A 4NG2A 1XJ4A 1EROA 3M6BA 1BLHA 2W3DA 3SS4A 3FYZA 2JKTM 4IUHA 4OOLA 2OWHA 1PFLA 2QYBA 1CI8A 1T18A 2EFXA 5HARA 3JPUA 3HUOA 4G3KA 1BUEA 2XFSA 3UPPA 3IWIA 3FPWA 1SDNA 4DXCA 3ULFA 1NJ4A 2W1TA 4OOMA 2E8IA 4ETZA 2Y4AA 3JYIA 3L9KA 4OPRA 3PHYA 3NOUC 2OLVA 3G2YA 1K57A 3ZNYA 2W3GA 5EECA 3IH9A 4MBFA 4OP5A 4XUZA 1SKOB 4O8GA 4Y7PA 3G30A 5GHYA 1AXBA 3MFDA 1PZOA 1LI9A 2Q0OA 2PR5A 5AVFA 2DCFA 4JKTA 2XDMA 4BENA 4GN2A 4Y5FA 4L9GA 4KZ5A 4UA9A 2QPNA 5HW3A 3EGDC 5AVEA 2OWJA 1XPBA 3ZHHA 1YSPA 2K7SA 1VETB 3IXDA 4X1MA 2X71A 2O99A 3IF6A 4OH0A 2PT7A 2ZLYA 5EVIC 3ZCZA 3S4XA 1OPXA 4F3LB 2ZOHA 5KSHA 3MXSA 2LB9A 4LFUA 3GECA 1XP4A 2O0YA 5G18A 3IHBA 4DRTA 2VKSA 2IWBA 5HWVA 2Y2MA 3VV4A 1H3QA 1S4RA 3BY9A 3HLFA 4EUVA 4ZDXA 3C4OA 3ZG7B 3D4FA 4RX3A 1Q2QA 4CLCA 3TSGA 3MQ0A 1Y28A 3NULA 3UMEA 3E4QA 4DF6A 4EEPA 2X01A 5HDSA 3HLBA 3VSKA 3MS6A 3C7VA 1PYYA 3EWKA 4WMCA 2KX6A 4FCFA 2VX8A 3NC8A 3UY6A 4N92A 1OJGA 3D72A 3ITAA 4HBTA 4G3VA 2ZMAA 1NWZA 1KGEA 1MKIA 3Q7ZA 4ZJ2A 3GMWA 4FD8A 4YINA 3VE4A 4GW9A 1H0MA 4BMWA 5FATA 2A24B 3GV9A 2BASA 4OVDA 4HY8A 4GHIA 1GA9A 4UA7A 3H7WB 4H8RA 5AQBA 3G32A 1UWPX 3CAXA 1GSWA 4Q0HA 4S2NA 3D3OA 1YMXA 3W4PA 1MWTA 4HNBA 4R3JA 4H6JA 3P01A 3UE6A 3Q7VB 4GOGA 5FDHA 3FG8A 3DWKA 4Q8IA 3N8RA 2XH9A 5EOEA 3UB8A 1J9MA 3B33A 4X6TA 4NXBA 3MQQA 1ES2A 1YM1A 2PU4A 1P9WA 1MKMA 1FQGA 3PYPA 3KYZA 1RP5A 3C7UA 5EV0A 2EXAA 2QWSA 4HH3A 1BLPA 2GJ3A 2KOIA 3BW6A 2V1ZA 1NZUA 3U4LP 1LI0A 3BFGA 4HI4A 1JNUA 2J9PA 3PR6A 4R0QA 5EVID 1P0ZA 4DE1A 2DRWA 1YLZA 4LV1A 2HV1A 2V9AA 1DY6A 3LYXA 3TE8A 5FAPA 2V1BA 3GDIA 2WKHA 1RGZA 4U0TA 3G6OA 3S7PA 5EM0A 1TS0A 4E6XA 1YPRA 1G6AA 1K57C 4LCMA 4MN5A 4RVAA 4OKPA 1GSVA 4EEUA 1TS7A 1P97A 2Y2KA 1SKFA 3UNWA 3CITA 3E4OA 2HPBA 3CJMA 1O7EA 3OZHA 5A92A 1L0DA 3VP4A 3LY4A 4FSFA 3OCLA 4ARZA 3W2ZA 3HL9A 4JXGA 3LIDA 3CHWP 1IFQA 1ZHHB 2WKQA 4EQIA 1DJCA 5HL1A 1TS6A 4EQ1A 2Y2PA 4BWIA 2OAQ1 2ZMFA 1PZPA 4KZ7A 4R3BA 2XR0A 3C8CA 4YNRA 5GLDA 2EX9A 4MBHA 1D1JA 1HZOA 3QP5A 1K4EA 5FI2A 1CEFA 3T12B 2H5SA 5CRFA 2UV0E 3WS4A 2Y8HA 5GHZA 4QD4A 3V3SA 3LO7A 1Q2PA 3GVBA 3ITBA 5DF9A 2K2NA 4CLCC 2WGVA 2CMNA 4CJNA 4PAUA 5KZHA 4ID4A 1PIOA 4F94A 3SZTA 3WWXA 1JTGA 4HHDA 2OAP1 2WKRA 1XGJA 3TG9A 4I3IA 3A0RA 5F83A 2MJ6A 3FPVA 2O9BA 2O9CA 2PYPA 3P98A 3VMAA 3T4OA 4FTXA 2B18A 3DTMA 1EW0A 5EFWA 4ZJ1A 1G6OA 1FILA 1VB6A 4GCZA 3P09A 1KGGA 3R4KA 2WKEA 1PNEA 1K56A 2P9VB 3UO9A 1F2KA 1F5MA 4DE2A 5DJTA 4S2NC 1KDSA 1DP8A 2HDUA 3GTCA 4ME4A 1ALQA 3HJKA 3KX0X 4QB8A 3OPLA 1Y54A 4C3QA 2C5WB 5DFYA 2M7VA 3EEAA 5CEBA 4MCWA 1H8MA 2W3EA 3SH7A 5HDCA 1DJAA 2XRNA 4S2KA 2HGVA 2P74A 4XT2A 2VV8A 1S4SA 5TBMA 3GR2A 2ZL1A 4OP8A 4R4RA 3IWQA 3C38A 3T4QA 2XK1A 1YMSA 2GZAA 5TGFA 3QP4A 2ZQ8A 4JLFA 2WK0A 2HJ9C 3BFDA 4WBGA 5IT5A 4LGWA 4P6BA 4UEYA 1K55A 4DMZA 3HLDA 4IJGA 2Z2LB 4QWOA 4KQOA 1CI9A 1HD8A 2ZQAA 4S2OA 1OTAA 5EVIB 3SS3A 3MJQA 3CLOA 3H82B 1K4FA 1LL8A 3ZG9B 4BD0A 2EXBA 3ZNTA 4E04A 3F1NA 4L0LA 1F98A 1ONGA 3T1RA 4GLQA 4CQHA 4A5RA 4FUWA 3IS2B 1LSVA 4CLCD 1BSGA 2H28A 1KGFA 1ESUA 5JYPA 1TDGA 4NXEA 4S2JA 2Z2MB 3MXRA 3UPOA 2Y2GA 3OOVA 2W3HA 3HLCA 2HDQA 3NHQA 3UB9A 3LGOA 5DKKA 5EE8A 1OT6A 3BFEA 4KUKA 3BLMA 3IXHA 4WMCD 3T1SA 5HWWA 4YWZA 1YLWA 1KVLA 3T4TA 2R9XA 1VM1A 3BWLA 2ZM8A 5FI6A 4UQIM 2QMIA 2BG1A 5EOOA 1CQAA 3BLSA 1MZUA 4EV4A 4B4ZA 3NOTC 2V8FA 3S7QA 5CECA 4BBUA 3ZDJA 4LV2A 5MC7A 3NIAA 5M18A 1K38A 2A3UA 5HD3A 1PW1A 1YLPA 5D3OA 3GRJA 1DJBA 4QY5A 4OQHA 4LPZA 5IU1A 3VP2A 1PWGA 2R78A
chains in the Genus database with same CATH topology
4HNBA 3PBNA 4O01A 3KSIA 3LIAA 5J7EA 2PDRA 4H6JA 3P01A 4JGPA 4L9EA 3UE6A 3CWFA 5C5KA 2PHYA 3MMHA 1W63Q 4Z1WA 4R38A 4EETB 3BQ8A 1STZA 3FG8A 4DJ3A 4MN7A 3C2WA 4PKYG 4WEKA 1XFNA 2W3FA 2IA2A 3H9WA 3UMDA 4PHTA 3RH8B 3UB8A 4R6LA 2NUTC 1T1BA 1OJ5A 3E98A 2J80A 3B33A 3CI6A 1NLYA 1F9IA 2P04A 2HJEA 3F1PA 3KYQA 4NXBA 4P6ZM 3MQQA 3SW1A 1P9WA 1MKMA 3CUEA 4NXGA 3LR4A 1S66L 3KSHA 3PYPA 5AJGA 3KYZA 1XFQA 2QWSA 4HH3A 4I3JA 1N9LA 3OC2A 4YOFA 2GJ3A 2KOIA 1D7EA 1N9NA 2VV6A 3BW6A 3VOLA 3C30A 3HJIA 4HI4A 1JNUA 3PR6A 3U2AA 2ZMVA 2EWVA 2L0WA 2W1RA 4HP4A 2J3TC 4HOIA 3LI8A 1P0ZA 4F3LA 3ZYTA 4HH2A 2HV1A 2V9AA 5HWTA 3JVUA 3LYXA 3T50A 3TE8A 2B02A 3H82A 1OTIA 2INWA 1P9RA 4WLAA 4B9OA 3HCYA 4ZRRA 4WEJA 2V1BA 2VGLS 2PR6A 3EEHA 2M7UA 3GDIA 3LIFA 4DN0A 4ETXA 2NUPC 1W63M 3G6OA 1DRMA 2W1TB 4NXFA 3IS2A 3S7PA 3ZQ5A 2VV7A 1XJ6A 2Z6DA 1S1ZA 1TS0A 2VJWA 3LIEA 2JN7A 4MN5A 2Z6CA 4Q0JA 1GSVA 1T1CA 4EEUA 1TS7A 1P97A 2KDKA 5A8BA 1TD5A 3CITA 3E4OA 1VHMA 5LBRA 5HPFA 2VA0A 3T4SA 1LSWA 4FSFA 3OCLA 4ARZA 3W2ZA 3TW8A 4DJ2A 4LLOB 3LIDA 4IHQA 4JGRA 4NEED 3OLOA 1IFQA 3LFVA 4XT2B 2JKTI 5TBMB 1LSXA 3KO6A 4Y3IA 3PBQA 1ZHHB 2WKQA 3S7OA 4BJPA 3T4JA 1TS6A 3MF0A 4EQ1A 2FH5A 3B47A 2W27A 2W0NA 4BWIA 2OAQ1 2JKRM 2ZMFA 1DP6A 5IS1A 5DJUA 4MMNA 2A24A 3C8CA 4YNRA 5F6AA 3KSGA 2HF6A 4WL9A 5HZHA 4BBVA 3PBOA 1ZTUA 3ICYA 4GS9A 2I9VA 3PBRA 2QHKA 2VGLM 3H7WA 1YAXA 2QKPA 1UGUA 5K5BA 3A0VA 1N9OA 3OBFA 2JKRI 3R7WA 3T4KA 4RQ9A 4MN6A 2Y8HA 1OT9A 1S1YA 4EERA 1GSXA 4I38A 4Y2FA 5F69A 2P08A 5DKLA 3F1NB 1KOUA 4R70A 3MQOA 4EESA 5DF9A 5FL3A 5HPIA 1G28A 1ODVA 2K2NA 3E4PA 4CLCC 2XSSA 2GNXA 3LR3A 2O9AA 4UQIS 2WKPA 2CMNA 2XA7S 4CLCB 2G7UA 3LUQA 4G3WA 2K31A 4PAUA 3F1OB 4MDZA 5G4YA 5DFXA 4R3AA 5G4ZA 4KUOA 3P7NA 1DP9A 4HHDA 4Q0IA 3S7NA 1LT0A 2J3WA 2OAP1 2WKRA 4I3IA 3BQAA 3A0RA 5HD5A 4I3AA 2MJ6A 3BJNA 3FPVA 2O9BA 2O9CA 2PYPA 3T4OA 1UWNX 2B18A 1EW0A 1WA9A 5EFWA 1G6OA 2EWWA 5HL6A 3DBAA 4EW7A 4LRXC 1XJ4A 1VB6A 4GCZA 1NLZA 4FOFA 2W3DA 2VEAA 1X0OA 2JKTM 3R4KA 4IUHA 4OOLA 2J3TD 2OWHA 4K08A 5F68A 4WF0A 3T4LA 4M4XA 2QYBA 1V9YA 1NRJA 1T18A 3UE3A 4EU0A 4G3KA 3LR0A 3LI9A 3PBTA 3LR5A 3PXPA 1BYWA 3FPWA 5J3WA 1F5MA 4GHIB 3A0SA 5DJTA 3ULFA 2D01A 3NOPC 2W1TA 4OOMA 1DP8A 3RTYA 4BBTA 4HJ3A 1TF1A 4ME4A 4WN5A 2L1MA 2KLIA 4I5SA 3HJKA 4ETZA 4PKYA 4LRZE 4KQDA 1OTDA 5TJJA 3KX0X 2XA7M 3PHYA 3VE3A 3EQUA 3NOUC 4L9FA 2P7JA 2LB5A 4H6JB 5DFYA 1V9ZA 3RFBA 2W3GA 2D02A 3EEAA 4JGOA 2M7VA 4NKPA 3K3DA 4O8GA 3UB7A 4MCWA 1H8MA 2W3EA 4EXOA 5HDCA 2XRNA 4II7A 2FZ0A 3MFXA 2PR5A 2HGVA 5AVFA 4HJ6A 4XT2A 2VV8A 1S4SA 3UB6A 5TBMA 5CX7A 2PD8A 2VLGA 4CLCE 5J4EA 1YKDA 3CUEC 3O5YA 1MC0A 3E0YA 3F1PB 4Y5FA 3C38A 2DMWA 3T4QA 3EQVA 2V0UA 2PYRA 4L9GA 2GZAA 3EGDC 3LICA 5AVEA 3OCNA 4HIAA 2OWJA 1OTEA 3KSFA 1YSPA 2K7SA 3IBRA 1IOUA 2HJ9C 5IT5A 2O99A 2PT7A 4UEYA 2XROA 4DMZA 4IJGA 2V1AA 5KIZA 1OPXA 3EGXC 4KQOA 4WELA 3B42A 4F3LB 2ZOHA 5KSHA 4WUJA 1OTAA 3FC7A 3MJQA 3CLOA 3H82B 1LL8A 2LB9A 4E04A 3F1NA 4L0LA 1T1AA 3GECA 2O0YA 3MXQA 1F98A 4GLQA 2VKSA 4CQHA 5F5YA 1XJ2A 3PBSA 3IS2B 5HWVA 1LSVA 3VV4A 1S4RA 1H3QA 3BY9A 2GX5A 4CLCD 4EUVA 2H28A 4JGQA 4CLCA 1T19A 1OTBA 4LRYC 3MQ0A 4IUKA 4GJ4A 1Y28A 4NXEA 1D06A 3F1OA 3UMEA 3E4QA 3OOVA 2JHEA 2W3HA 4EEPA 3NHQA 2QJ5A 3UB9A 5HDSA 2EA9A 2QJ7A 2A2LA 5DKKA 1OT6A 4AFIA 3MR0A 4KUKA 3TRCA 4ARZB 5HWWA 4YWZA 3EWKA 3K3CA 5I5LA 3T4TA 2KX6A 2YKFA 3TJZC 2VX8A 3IBJA 1XJ3A 3K2NA 3BWLA 1OJGA 3D72A 4P6ZS 3LIBA 4G3VA 1NWZA 2L4RA 4UQIM 5HDDA 1TS8A 1MZUA 2M1CA 3NOTC 3V67A 2Y79A 4O0PA 3S7QA 2OOLA 1S67L 4GW9A 3VE4A 4BMWA 3JVVA 2A24B 4BBUA 5MC7A 4HJ4A 3D3OA 3NJAA 2ZBBA 2BASA 4I39A 2VZWA 5HD3A 4QPRA 4GS9B 4HY8A 2V0WA 4GHIA 3H7WB 4LPZA 1UWPX 2ZOIA 5IU1A 2PD7A 3BY8A 3CAXA 5HSQA 3R7WB 1YSQA 4HP9A 2YKHA 4HQAA 1GSWA 4Q0HA 5L8MA 3EOIA 4B93A 2R78A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HNB A;  3LIA A;  5J7E A;  2PDR A;  4H6J A;  4JGP A;  4L9E A;  3UE6 A;  3CWF A;  2PHY A;  4R38 A;  4EET B;  3FG8 A;  4DJ3 A;  4PKY G;  3C2W A;  1XFN A;  3H9W A;  3UMD A;  3RH8 B;  3UB8 A;  4R6L A;  1T1B A;  1OJ5 A;  2J80 A;  3B33 A;  1F9I A;  3F1P A;  4NXB A;  3MQQ A;  3SW1 A;  4NXG A;  1S66 L;  3PYP A;  1XFQ A;  2QWS A;  4HH3 A;  4I3J A;  1N9L A;  2GJ3 A;  1D7E A;  1N9N A;  2VV6 A;  3VOL A;  3HJI A;  4HI4 A;  1JNU A;  4HP4 A;  2L0W A;  4HOI A;  3LI8 A;  1P0Z A;  4F3L A;  4HH2 A;  2HV1 A;  2V9A A;  5HWT A;  3LYX A;  3T50 A;  2B02 A;  3H82 A;  1OTI A;  2INW A;  4WLA A;  4B9O A;  2V1B A;  2PR6 A;  3EEH A;  3GDI A;  3LIF A;  3G6O A;  1DRM A;  4NXF A;  3IS2 A;  3ZQ5 A;  2VV7 A;  1XJ6 A;  2Z6D A;  1S1Z A;  1TS0 A;  3LIE A;  2JN7 A;  4MN5 A;  2Z6C A;  1GSV A;  1T1C A;  4EEU A;  1TS7 A;  1P97 A;  2KDK A;  5A8B A;  3E4O A;  1LSW A;  4DJ2 A;  4LLO B;  3LID A;  4JGR A;  3OLO A;  4XT2 B;  5TBM B;  1LSX A;  2WKQ A;  1TS6 A;  4EQ1 A;  2W27 A;  2W0N A;  1DP6 A;  5IS1 A;  5DJU A;  2A24 A;  3C8C A;  5F6A A;  4WL9 A;  5HZH A;  4BBV A;  3ICY A;  4GS9 A;  2I9V A;  2QHK A;  3H7W A;  2QKP A;  1UGU A;  3A0V A;  1N9O A;  4RQ9 A;  4MN6 A;  1OT9 A;  1S1Y A;  4EER A;  1GSX A;  4I38 A;  5F69 A;  5DKL A;  3F1N B;  1KOU A;  4R70 A;  3MQO A;  4EES A;  1G28 A;  1ODV A;  3E4P A;  2WKP A;  2CMN A;  3LUQ A;  3F1O B;  5G4Y A;  4R3A A;  5G4Z A;  4KUO A;  3P7N A;  1DP9 A;  4HHD A;  1LT0 A;  2WKR A;  4I3I A;  3A0R A;  5HD5 A;  4I3A A;  2PYP A;  1UWN X;  1EW0 A;  1WA9 A;  5EFW A;  4EW7 A;  4LRX C;  1XJ4 A;  1VB6 A;  4GCZ A;  2VEA A;  1X0O A;  2OWH A;  4K08 A;  5F68 A;  4WF0 A;  4M4X A;  1V9Y A;  1T18 A;  3LI9 A;  1BYW A;  5J3W A;  4GHI B;  3A0S A;  5DJT A;  3ULF A;  2D01 A;  3NOP C;  1DP8 A;  3RTY A;  4BBT A;  4HJ3 A;  4WN5 A;  2L1M A;  4I5S A;  3HJK A;  4PKY A;  4LRZ E;  4KQD A;  1OTD A;  3KX0 X;  3PHY A;  3VE3 A;  3NOU C;  4L9F A;  2P7J A;  4H6J B;  1V9Z A;  2D02 A;  4JGO A;  3K3D A;  3UB7 A;  4EXO A;  5HDC A;  3MFX A;  2PR5 A;  5AVF A;  4HJ6 A;  4XT2 A;  2VV8 A;  1S4S A;  3UB6 A;  5TBM A;  2PD8 A;  2VLG A;  5J4E A;  3F1P B;  2V0U A;  2PYR A;  4L9G A;  3LIC A;  5AVE A;  4HIA A;  2OWJ A;  1OTE A;  2K7S A;  3IBR A;  2V1A A;  5KIZ A;  4F3L B;  2ZOH A;  4WUJ A;  1OTA A;  3FC7 A;  3MJQ A;  3CLO A;  3H82 B;  1LL8 A;  4E04 A;  3F1N A;  1T1A A;  3GEC A;  3MXQ A;  1F98 A;  5F5Y A;  1XJ2 A;  3IS2 B;  5HWV A;  1LSV A;  1S4R A;  3BY9 A;  2H28 A;  4JGQ A;  1T19 A;  1OTB A;  4LRY C;  1Y28 A;  4NXE A;  1D06 A;  3F1O A;  3UME A;  3E4Q A;  2JHE A;  4EEP A;  3NHQ A;  2QJ5 A;  3UB9 A;  5HDS A;  2EA9 A;  2QJ7 A;  5DKK A;  1OT6 A;  3MR0 A;  4KUK A;  5HWW A;  4YWZ A;  3EWK A;  5I5L A;  2KX6 A;  2YKF A;  1XJ3 A;  3BWL A;  1OJG A;  3D72 A;  3LIB A;  1NWZ A;  2L4R A;  5HDD A;  1TS8 A;  1MZU A;  2M1C A;  3NOT C;  2OOL A;  1S67 L;  4GW9 A;  3VE4 A;  2A24 B;  4BBU A;  4HJ4 A;  3NJA A;  2ZBB A;  2BAS A;  4I39 A;  5HD3 A;  4GS9 B;  4HY8 A;  2V0W A;  4GHI A;  3H7W B;  4LPZ A;  1UWP X;  2ZOI A;  5IU1 A;  2PD7 A;  3BY8 A;  3CAX A;  5HSQ A;  4HP9 A;  2YKH A;  4HQA A;  1GSW A;  3K3C A;  2R78 A; 
#chains in the Genus database with same CATH topology
 1BTL A;  4JGP A;  5DF7 A;  4N1H A;  3CWF A;  5C5K A;  2PHY A;  3A3F A;  4Z1W A;  4EET B;  1STZ A;  4DJ3 A;  2V20 A;  3QP8 A;  1EWZ A;  1XFN A;  1JWP A;  2OSU A;  3UMD A;  3RH8 B;  1OJ5 A;  3PTE A;  2Y2L A;  4BQM A;  1F9I A;  1LL9 A;  3ZG8 B;  1PI4 A;  5CHU A;  3F1P A;  3KYQ A;  4IBR A;  2QZ6 A;  4NK3 A;  4PM5 A;  4HEF A;  5HAQ A;  3BEC A;  4KQQ A;  1OME A;  2J9O A;  3T1Q B;  4NXG A;  1QME A;  4QU3 A;  2V2F F;  3LR4 A;  1GHP A;  1I2W A;  3WS1 A;  5GLC A;  4I3J A;  3OC2 A;  4X53 A;  4YOF A;  5DF8 A;  1D7E A;  4JXS A;  3VOL A;  1ES3 A;  4HP4 A;  2L0W A;  2J3T C;  1K54 A;  2ZC4 B;  3VP1 A;  4WZ5 A;  4S2L A;  3JVU A;  4Y13 A;  3T50 A;  2B02 A;  2INW A;  5E2H A;  1Z09 A;  2VGL S;  2ZC7 A;  1W5D A;  2NUP C;  1WYB A;  1K25 A;  4KZA A;  2W1T B;  4S2P A;  3ZQ5 A;  5FAS A;  2VV7 A;  1XJ6 A;  1MXO A;  3A3E A;  5F1F A;  2VJW A;  1KDW A;  2HZ5 A;  3O3V A;  4IBX A;  1T1C A;  3VP3 A;  3G2Z A;  4JBF A;  4E3O A;  2KDK A;  3DTK A;  1TD5 A;  1VEU A;  1NXY A;  5HPF A;  2VK3 A;  3MBZ A;  3TW8 A;  5KMW A;  1CF0 A;  2XD1 A;  2Y55 A;  1XX2 A;  4QY6 A;  4IHQ A;  4JGR A;  4NEE D;  5HFO A;  3PBQ A;  3S7O A;  4N1X A;  2FFY A;  3VOY A;  2ZQD A;  1YLT A;  2ZC5 B;  4GZB A;  3B47 A;  2W0N A;  3ZFZ A;  2JKR M;  4BL2 A;  3N8L A;  4MMN A;  5HAP A;  1JVJ A;  1K55 C;  3I7J A;  5F6A A;  3HVF A;  2WGW A;  3KSG A;  5HZH A;  4FH2 A;  4N9K A;  4JXV A;  4UAA A;  3UE1 A;  1NYM A;  3S22 A;  4OQ0 A;  3IF6 B;  4GS9 A;  2VGL M;  3N4I A;  2B5R A;  3T1X A;  2QKP A;  1UGU A;  5K5B A;  1E25 A;  1FCM A;  3R7W A;  4RQ9 A;  1OT9 A;  1ZG4 A;  4Y2F A;  4PM7 A;  1KOU A;  4R70 A;  3MQO A;  5FQM A;  4O7D A;  5EVL A;  3E4P A;  5HAI A;  3LR3 A;  3VOZ A;  5FI7 A;  2XA7 S;  4CLC B;  4GD8 A;  4NET A;  5AQ7 A;  1GHM A;  3O88 A;  4JPM A;  5G4Z A;  1H8Z A;  4KUO A;  2IWD A;  3SH8 A;  1N9B A;  3BFF A;  1WE4 A;  3HUM A;  2WZX A;  3BQA A;  4R23 A;  3NI9 A;  4I3A A;  1G68 A;  2ZM2 A;  2B95 A;  3BJN A;  4P85 A;  4KZ3 A;  3QNC A;  5FQI A;  2EWW A;  4R1G A;  3DBA A;  1NLZ A;  2VEA A;  1K56 D;  3RXX A;  3W4Q A;  2J3T D;  5F68 A;  4P0M A;  3T4L A;  1V9Y A;  1FSY A;  3WRZ A;  5GLA A;  3UE3 A;  3LR0 A;  3PBT A;  1BYW A;  2XF3 A;  1MWS A;  4GHI B;  3A0S A;  5F82 A;  3LEQ A;  2D01 A;  3NOP C;  4U3T A;  3RTY A;  4BBT A;  4HJ3 A;  1TF1 A;  3NDG A;  1PWC A;  4WN5 A;  2L1M A;  2KLI A;  4I5S A;  5AQ9 A;  5TJJ A;  3FKV A;  3MZF A;  2XA7 M;  3EQU A;  1KE4 A;  1W8Q A;  4E3M A;  4L9F A;  5GLB A;  5A91 A;  4JF4 A;  1IEL A;  4H6J B;  1V9Z A;  4JGO A;  1NZO A;  2J7V A;  3K3D A;  1H8Y A;  2RCX A;  4OQI A;  1N4O A;  2EX6 A;  4GB7 A;  1ERQ A;  3Q07 A;  4S2M A;  2Q9M A;  4II7 A;  2FZ0 A;  5FEF A;  3MFX A;  4QJG A;  3UB6 A;  5CX7 A;  2PD8 A;  3O5Y A;  3CG5 A;  1E3U A;  3CPT A;  4K91 A;  3EQV A;  2V0U A;  3BFC A;  2PYR A;  1FCN A;  3LIC A;  3IWO A;  3OCN A;  4HIA A;  3KSF A;  3IBR A;  4C6Y A;  3ZG5 A;  1K54 C;  1MY8 A;  1PW8 A;  3BRM A;  3ZVT A;  2XEP A;  4WZ5 C;  2BTF P;  2XRO A;  2DNS A;  3EGX C;  3IT9 A;  4MLL A;  1FR1 A;  1SHV A;  2EFU A;  2JE5 A;  2HDR A;  2AVX A;  4Y0T A;  2GDN A;  1NYY A;  5CTN A;  3MXQ A;  1S0W A;  1YQS A;  2HP6 A;  2CC1 A;  3QNB A;  1IYS A;  1T19 A;  3D9Y A;  4LRY C;  4IUK A;  1D06 A;  3F1O A;  4PM6 A;  4OPZ A;  2JHE A;  1SDE A;  2HDS A;  5E2G A;  2QJ5 A;  3HLW A;  1Z6F A;  2EA9 A;  2XLN A;  2XQZ A;  4PM8 A;  1W8Y A;  1FR6 A;  4AFI A;  3IX4 A;  3TRC A;  4ARZ B;  3TJZ C;  3IBJ A;  4WM9 A;  1XJ3 A;  3Q1F A;  3K2N A;  1LL5 A;  5CGX A;  1ES5 A;  1HVB A;  4HBU A;  3V50 A;  1XA1 A;  5DTT A;  2FFF B;  1FSW A;  2L4R A;  2ZD8 A;  1TS8 A;  2JKG A;  5CGS A;  2M1C A;  3V67 A;  4Y17 A;  3OPH A;  2Y79 A;  4O0P A;  2OOL A;  1S67 L;  2XD5 A;  1L2S A;  4DKI A;  3FWL A;  1WYC A;  3QP1 A;  4HJ4 A;  3NJA A;  4MBK A;  3W8K A;  2VZW A;  4E3J A;  4B4X A;  2V0W A;  3VFF A;  2WKI A;  4CPK A;  1CJF A;  3E2K A;  2C6W B;  3KYE A;  1YLJ A;  2ZOI A;  2PD7 A;  5HSQ A;  1ZC2 A;  1YSQ A;  4HP9 A;  4HQA A;  4UA6 A;  3K3C A;  4O01 A;  3LIA A;  4EUZ A;  3DAV A;  1SKO A;  1YT4 A;  1K0K A;  3HLE A;  4R38 A;  2Y59 A;  4MN7 A;  3C2W A;  3DTI A;  5M1A A;  4WEK A;  1L0F A;  3NCK A;  4KQR A;  4PHT A;  1M6K A;  4R6L A;  2NUT C;  1IYQ A;  2HP9 A;  3E98 A;  2J80 A;  3CI6 A;  3WS0 A;  3MSH A;  2P04 A;  4X68 A;  1XGI A;  3BYD A;  2WYX A;  3SW1 A;  3ZGA B;  3CUE A;  1KE3 A;  1FOF A;  1Y4O A;  3IXG A;  1S66 L;  3G34 A;  1KVM A;  1VET A;  2JCH A;  3WS2 A;  1N9L A;  3NY4 A;  5CHM A;  5F1G A;  3B3X A;  1TVF A;  1SZV A;  1TEM A;  2ZMV A;  2EWV A;  2W1R A;  4HOI A;  3W4O A;  4F3L A;  3ZYT A;  4HH2 A;  1MWU A;  2ZQ7 A;  1OTI A;  4LCL A;  4WLA A;  4B9O A;  4D60 A;  4ZRR A;  4WEJ A;  4GKU A;  3LIF A;  4DN0 A;  3QP2 A;  1BLS A;  1S1Z A;  3MKF A;  3CZD A;  2IWC A;  4IVK A;  3HBR A;  2JN7 A;  5DVA A;  3M2K A;  2Z6C A;  4Q0J A;  4RX2 A;  5CXW A;  4EBP A;  5A8B A;  4HES A;  3PAG A;  1RGY A;  4OLD A;  3TOI A;  5L10 A;  1ES4 A;  5LBR A;  3RJU A;  5DTK A;  1BLC A;  3T4S A;  5KSC A;  3Q81 A;  4KG6 A;  5E2E A;  2Y2H A;  4DJ2 A;  4X1L A;  1IEM A;  3OLO A;  1GA0 A;  4XT2 B;  2XFT A;  5TBM B;  5AQA A;  3KO6 A;  4Y3I A;  2J8Y A;  2ZL1 B;  4JF6 A;  5TFQ A;  2X02 A;  1GHI A;  2JKF A;  3MF0 A;  1K6R A;  3UE0 A;  4GNU A;  2FH5 A;  2W27 A;  2Y2Q A;  1W79 A;  2EX2 A;  4ESP A;  1HTZ A;  1K6S A;  1DP6 A;  5IS1 A;  5DJU A;  2A24 A;  3HRE A;  1FCO A;  3G4P A;  4WL9 A;  2HF6 A;  4XXR A;  5EPH A;  4BBV A;  4FH4 A;  1MPL A;  3PBO A;  5JYO A;  3ICY A;  2I9V A;  3PBR A;  2QHK A;  1E4D A;  3H7W A;  5IHV A;  5U47 A;  5FA7 A;  1YAX A;  1ZG6 A;  3BM6 A;  4MNR A;  1W7F A;  4DXB A;  3PAE A;  3A0V A;  2JKR I;  3T4K A;  2R9W A;  3LEZ A;  1S1Y A;  4LV0 A;  4EER A;  1GSX A;  4OPQ A;  5L07 A;  4I38 A;  1XKZ A;  2P08 A;  5DKL A;  3F1N B;  2A49 A;  4R4S A;  1M40 A;  5HPI A;  1G28 A;  1ODV A;  3Q7V A;  3UDF A;  1MBL A;  4BD1 A;  3GSG A;  2I72 A;  2H0Y A;  3WS5 A;  4G3W A;  3RXW A;  2K31 A;  4EWF A;  4MDZ A;  5G4Y A;  1LHY A;  5DFX A;  4Y15 A;  2WGI A;  1MWR A;  1BUL A;  3P7N A;  1DP9 A;  3S7N A;  3MZE A;  1LT0 A;  2J3W A;  3WRT A;  4S2I A;  5HD5 A;  4KG2 A;  5J8X A;  4P87 A;  1U60 A;  3VP0 A;  1UWN X;  1JTD A;  1RCJ A;  1WA9 A;  5FSR A;  3IXB A;  5HL6 A;  4GD6 A;  4LRX C;  4FOF A;  1G5U A;  1X0O A;  5E43 A;  4RYE A;  1GCE A;  4ZBE A;  4KG5 A;  3N6I A;  4K08 A;  1IKG A;  4WF0 A;  1YLY A;  4M4X A;  1NRJ A;  3FKW A;  2JC7 A;  4K0X A;  1O07 A;  4EU0 A;  3LI9 A;  3LR5 A;  3PXP A;  3AGD A;  5J3W A;  3ZVW A;  1I5Q A;  1HLU P;  3VFH A;  4Z9Q A;  3DTE A;  5HX9 A;  4N9L A;  2VGK A;  4KEN B;  4DDY A;  4PPR A;  4PKY A;  1A0K A;  4LRZ E;  4KQD A;  1OTD A;  3IH8 A;  3VE3 A;  3FV7 A;  2P7J A;  2LB5 A;  4PMA A;  4X25 A;  3RFB A;  2D02 A;  4NKP A;  3C5A A;  5CED A;  3ZG0 A;  1IYP A;  3UB7 A;  4LEN A;  4C75 A;  4EXO A;  2JBF A;  2WAE A;  3A3J A;  1BT5 A;  3M2J A;  1NRF A;  4HJ6 A;  1E3U D;  3UN7 A;  4KZ9 A;  2VLG A;  3L7H A;  4CLC E;  5J4E A;  1YKD A;  5EM1 A;  3CUE C;  1H5X A;  1MC0 A;  3E0Y A;  3F1P B;  4KZ6 A;  2DMW A;  4YFM A;  1IKI A;  5FAO A;  3G35 A;  2ZQ9 A;  1OTE A;  1TDL A;  3IX8 A;  5FQQ A;  4U0X A;  4OPY A;  1IOU A;  1AWI A;  3N8S A;  1CK3 A;  2Y2I A;  2BLS A;  4Y0U A;  5FAQ A;  2V1A A;  2ZQC A;  5KIZ A;  4WEL A;  3B42 A;  3GQZ A;  3CMZ A;  1LLB A;  2V8C A;  4WUJ A;  4ZJ3 A;  3FC7 A;  5CHJ A;  1T1A A;  4Y0O A;  4E3N A;  5EUA A;  1L0G A;  2H10 A;  5F5Y A;  1XJ2 A;  3PBS A;  4E3L A;  2RL3 A;  3S1Y A;  2GX5 A;  3SH9 A;  4QHC A;  4JGQ A;  2PBY A;  4E6W A;  3LCE A;  1OTB A;  4GJ4 A;  4DE0 A;  3UB5 P;  5M19 A;  1VEU B;  4JF5 A;  1PWD A;  5FQJ A;  2ZC3 B;  2QJ7 A;  2A2L A;  1ZKJ A;  3MR0 A;  2Y2N A;  3OPP A;  1PI5 A;  3O86 A;  4D2O A;  2WUQ A;  2OLU A;  5I5L A;  2YKF A;  3QP6 A;  2EX8 A;  4RA7 A;  4WZ4 A;  2XGN A;  4OLG A;  4EBN A;  3M6H A;  4P6Z S;  3LIB A;  5HDD A;  1L0E A;  5FDS A;  4OQG A;  2Q9N A;  3QHY A;  3JVV A;  4X56 A;  2WGW B;  4ZTK A;  4IVI A;  2ZBB A;  4I39 A;  1CEG A;  2PAV P;  5GL9 A;  3OPR A;  2P9V A;  4QPR A;  4GS9 B;  4OON A;  5GHX A;  4LV3 A;  5E2F A;  1SCW A;  3BY8 A;  2G2U A;  3R7W B;  2YKH A;  2ZM0 A;  5L8M A;  2WAD A;  3EOI A;  4B93 A;  2UWX A;  3HLG A;  2VGJ A;  1ONH A;  3PBN A;  4UHU A;  3KSI A;  5J7E A;  3IQA A;  3IF6 C;  2PDR A;  4L9E A;  3MMH A;  3SS5 A;  1W63 Q;  1JWZ A;  2WAF A;  3BQ8 A;  5TR7 A;  4PKY G;  5L09 A;  2W3F A;  2G2W A;  2IA2 A;  4OOY A;  3UDX A;  3H9W A;  3ISG A;  5FEG A;  1T1B A;  3AGE A;  1NLY A;  3E2L A;  2HJE A;  4P6Z M;  4X55 A;  4GDB A;  4DDS A;  3V5M A;  3KSH A;  5AJG A;  3DW0 A;  1ERM A;  1XFQ A;  1KE0 A;  4PM9 A;  1N9N A;  2VV6 A;  3A3I A;  3HUN A;  3C30 A;  3HJI A;  3U2A A;  3BEB A;  3LI8 A;  3DWZ A;  3N7W A;  3FZC A;  4BLM A;  5HWT A;  5EVI A;  5CTM A;  3H82 A;  1PRQ A;  1P9R A;  3MKE A;  2ZC6 B;  3IF5 A;  3HCY A;  4WYY A;  1BZA A;  2PR6 A;  5L2F A;  3EEH A;  2M7U A;  3UPN A;  4ETX A;  2PRF A;  2HP5 A;  1W63 M;  1DRM A;  4K0W A;  4NXF A;  3IS2 A;  2Z6D A;  3IHA A;  4EBL A;  3LIE A;  4BL3 A;  1NY0 A;  5FQ9 A;  1VHM A;  5FQK A;  5I94 A;  3MZD A;  2VA0 A;  5CER A;  4M3K A;  3A3D A;  4ZAM A;  1LSW A;  5BOH A;  2ACG A;  3NBL A;  2H0T A;  2ZJ9 A;  5A93 A;  4LLO B;  1ACF A;  3LFV A;  3LY3 A;  2JKT I;  1LSX A;  3NDE A;  4BJP A;  3T4J A;  3G31 A;  4KZ8 A;  3CPT B;  1EI5 A;  1XXM A;  3V3R A;  4JXW A;  1L3L A;  1ZTU A;  4E3K A;  1QMF A;  1S6R A;  3O87 A;  2Y2J A;  4B88 A;  5A90 A;  4KZB A;  1ESI A;  3VSL A;  3SOI A;  1JWV A;  3V39 A;  1N9O A;  3OBF A;  1XA7 A;  4MEZ A;  1C3B A;  4MN6 A;  1VQQ A;  4KZ4 A;  3C4P A;  5DTS A;  1FIK A;  5F69 A;  3UDI A;  2E8J A;  4EES A;  5FL3 A;  3IX3 A;  2XSS A;  2GNX A;  2O9A A;  2Y91 A;  2PU2 A;  3Q82 A;  1I2S A;  4UQI S;  2Y2O A;  4GDN A;  2WKP A;  2OV5 A;  4IED A;  5EVE A;  2G7U A;  3LUQ A;  4X69 A;  3F1O B;  5CGW A;  2PBD P;  4R3A A;  4E3I A;  3AGF A;  2WZZ A;  1IYO A;  4Q0I A;  4DE3 A;  1J3W A;  4XUX A;  3NEC A;  4EW7 A;  4NG2 A;  1XJ4 A;  1ERO A;  3M6B A;  1BLH A;  2W3D A;  3SS4 A;  3FYZ A;  2JKT M;  4IUH A;  4OOL A;  2OWH A;  1PFL A;  2QYB A;  1CI8 A;  1T18 A;  2EFX A;  5HAR A;  3JPU A;  3HUO A;  4G3K A;  1BUE A;  2XFS A;  3UPP A;  3IWI A;  3FPW A;  1SDN A;  4DXC A;  3ULF A;  1NJ4 A;  2W1T A;  4OOM A;  2E8I A;  4ETZ A;  2Y4A A;  3JYI A;  3L9K A;  4OPR A;  3PHY A;  3NOU C;  2OLV A;  3G2Y A;  1K57 A;  3ZNY A;  2W3G A;  5EEC A;  3IH9 A;  4MBF A;  4OP5 A;  4XUZ A;  1SKO B;  4O8G A;  4Y7P A;  3G30 A;  5GHY A;  1AXB A;  3MFD A;  1PZO A;  1LI9 A;  2Q0O A;  2PR5 A;  5AVF A;  2DCF A;  4JKT A;  2XDM A;  4BEN A;  4GN2 A;  4Y5F A;  4L9G A;  4KZ5 A;  4UA9 A;  2QPN A;  5HW3 A;  3EGD C;  5AVE A;  2OWJ A;  1XPB A;  3ZHH A;  1YSP A;  2K7S A;  1VET B;  3IXD A;  4X1M A;  2X71 A;  2O99 A;  3IF6 A;  4OH0 A;  2PT7 A;  2ZLY A;  5EVI C;  3ZCZ A;  3S4X A;  1OPX A;  4F3L B;  2ZOH A;  5KSH A;  3MXS A;  2LB9 A;  4LFU A;  3GEC A;  1XP4 A;  2O0Y A;  5G18 A;  3IHB A;  4DRT A;  2VKS A;  2IWB A;  5HWV A;  2Y2M A;  3VV4 A;  1H3Q A;  1S4R A;  3BY9 A;  3HLF A;  4EUV A;  4ZDX A;  3C4O A;  3ZG7 B;  3D4F A;  4RX3 A;  1Q2Q A;  4CLC A;  3TSG A;  3MQ0 A;  1Y28 A;  3NUL A;  3UME A;  3E4Q A;  4DF6 A;  4EEP A;  2X01 A;  5HDS A;  3HLB A;  3VSK A;  3MS6 A;  3C7V A;  1PYY A;  3EWK A;  4WMC A;  2KX6 A;  4FCF A;  2VX8 A;  3NC8 A;  3UY6 A;  4N92 A;  1OJG A;  3D72 A;  3ITA A;  4HBT A;  4G3V A;  2ZMA A;  1NWZ A;  1KGE A;  1MKI A;  3Q7Z A;  4ZJ2 A;  3GMW A;  4FD8 A;  4YIN A;  3VE4 A;  4GW9 A;  1H0M A;  4BMW A;  5FAT A;  2A24 B;  3GV9 A;  2BAS A;  4OVD A;  4HY8 A;  4GHI A;  1GA9 A;  4UA7 A;  3H7W B;  4H8R A;  5AQB A;  3G32 A;  1UWP X;  3CAX A;  1GSW A;  4Q0H A;  4S2N A;  3D3O A;  1YMX A;  3W4P A;  1MWT A;  4HNB A;  4R3J A;  4H6J A;  3P01 A;  3UE6 A;  3Q7V B;  4GOG A;  5FDH A;  3FG8 A;  3DWK A;  4Q8I A;  3N8R A;  2XH9 A;  5EOE A;  3UB8 A;  1J9M A;  3B33 A;  4X6T A;  4NXB A;  3MQQ A;  1ES2 A;  1YM1 A;  2PU4 A;  1P9W A;  1MKM A;  1FQG A;  3PYP A;  3KYZ A;  1RP5 A;  3C7U A;  5EV0 A;  2EXA A;  2QWS A;  4HH3 A;  1BLP A;  2GJ3 A;  2KOI A;  3BW6 A;  2V1Z A;  1NZU A;  3U4L P;  1LI0 A;  3BFG A;  4HI4 A;  1JNU A;  2J9P A;  3PR6 A;  4R0Q A;  5EVI D;  1P0Z A;  4DE1 A;  2DRW A;  1YLZ A;  4LV1 A;  2HV1 A;  2V9A A;  1DY6 A;  3LYX A;  3TE8 A;  5FAP A;  2V1B A;  3GDI A;  2WKH A;  1RGZ A;  4U0T A;  3G6O A;  3S7P A;  5EM0 A;  1TS0 A;  4E6X A;  1YPR A;  1G6A A;  1K57 C;  4LCM A;  4MN5 A;  4RVA A;  4OKP A;  1GSV A;  4EEU A;  1TS7 A;  1P97 A;  2Y2K A;  1SKF A;  3UNW A;  3CIT A;  3E4O A;  2HPB A;  3CJM A;  1O7E A;  3OZH A;  5A92 A;  1L0D A;  3VP4 A;  3LY4 A;  4FSF A;  3OCL A;  4ARZ A;  3W2Z A;  3HL9 A;  4JXG A;  3LID A;  3CHW P;  1IFQ A;  1ZHH B;  2WKQ A;  4EQI A;  1DJC A;  5HL1 A;  1TS6 A;  4EQ1 A;  2Y2P A;  4BWI A;  2OAQ 1;  2ZMF A;  1PZP A;  4KZ7 A;  4R3B A;  2XR0 A;  3C8C A;  4YNR A;  5GLD A;  2EX9 A;  4MBH A;  1D1J A;  1HZO A;  3QP5 A;  1K4E A;  5FI2 A;  1CEF A;  3T12 B;  2H5S A;  5CRF A;  2UV0 E;  3WS4 A;  2Y8H A;  5GHZ A;  4QD4 A;  3V3S A;  3LO7 A;  1Q2P A;  3GVB A;  3ITB A;  5DF9 A;  2K2N A;  4CLC C;  2WGV A;  2CMN A;  4CJN A;  4PAU A;  5KZH A;  4ID4 A;  1PIO A;  4F94 A;  3SZT A;  3WWX A;  1JTG A;  4HHD A;  2OAP 1;  2WKR A;  1XGJ A;  3TG9 A;  4I3I A;  3A0R A;  5F83 A;  2MJ6 A;  3FPV A;  2O9B A;  2O9C A;  2PYP A;  3P98 A;  3VMA A;  3T4O A;  4FTX A;  2B18 A;  3DTM A;  1EW0 A;  5EFW A;  4ZJ1 A;  1G6O A;  1FIL A;  1VB6 A;  4GCZ A;  3P09 A;  1KGG A;  3R4K A;  2WKE A;  1PNE A;  1K56 A;  2P9V B;  3UO9 A;  1F2K A;  1F5M A;  4DE2 A;  5DJT A;  4S2N C;  1KDS A;  1DP8 A;  2HDU A;  3GTC A;  4ME4 A;  1ALQ A;  3HJK A;  3KX0 X;  4QB8 A;  3OPL A;  1Y54 A;  4C3Q A;  2C5W B;  5DFY A;  2M7V A;  3EEA A;  5CEB A;  4MCW A;  1H8M A;  2W3E A;  3SH7 A;  5HDC A;  1DJA A;  2XRN A;  4S2K A;  2HGV A;  2P74 A;  4XT2 A;  2VV8 A;  1S4S A;  5TBM A;  3GR2 A;  2ZL1 A;  4OP8 A;  4R4R A;  3IWQ A;  3C38 A;  3T4Q A;  2XK1 A;  1YMS A;  2GZA A;  5TGF A;  3QP4 A;  2ZQ8 A;  4JLF A;  2WK0 A;  2HJ9 C;  3BFD A;  4WBG A;  5IT5 A;  4LGW A;  4P6B A;  4UEY A;  1K55 A;  4DMZ A;  3HLD A;  4IJG A;  2Z2L B;  4QWO A;  4KQO A;  1CI9 A;  1HD8 A;  2ZQA A;  4S2O A;  1OTA A;  5EVI B;  3SS3 A;  3MJQ A;  3CLO A;  3H82 B;  1K4F A;  1LL8 A;  3ZG9 B;  4BD0 A;  2EXB A;  3ZNT A;  4E04 A;  3F1N A;  4L0L A;  1F98 A;  1ONG A;  3T1R A;  4GLQ A;  4CQH A;  4A5R A;  4FUW A;  3IS2 B;  1LSV A;  4CLC D;  1BSG A;  2H28 A;  1KGF A;  1ESU A;  5JYP A;  1TDG A;  4NXE A;  4S2J A;  2Z2M B;  3MXR A;  3UPO A;  2Y2G A;  3OOV A;  2W3H A;  3HLC A;  2HDQ A;  3NHQ A;  3UB9 A;  3LGO A;  5DKK A;  5EE8 A;  1OT6 A;  3BFE A;  4KUK A;  3BLM A;  3IXH A;  4WMC D;  3T1S A;  5HWW A;  4YWZ A;  1YLW A;  1KVL A;  3T4T A;  2R9X A;  1VM1 A;  3BWL A;  2ZM8 A;  5FI6 A;  4UQI M;  2QMI A;  2BG1 A;  5EOO A;  1CQA A;  3BLS A;  1MZU A;  4EV4 A;  4B4Z A;  3NOT C;  2V8F A;  3S7Q A;  5CEC A;  4BBU A;  3ZDJ A;  4LV2 A;  5MC7 A;  3NIA A;  5M18 A;  1K38 A;  2A3U A;  5HD3 A;  1PW1 A;  1YLP A;  5D3O A;  3GRJ A;  1DJB A;  4QY5 A;  4OQH A;  4LPZ A;  5IU1 A;  3VP2 A;  1PWG A;  2R78 A; 
#chains in the Genus database with same CATH homology
 4HNB A;  3PBN A;  4O01 A;  3KSI A;  3LIA A;  5J7E A;  2PDR A;  4H6J A;  3P01 A;  4JGP A;  4L9E A;  3UE6 A;  3CWF A;  5C5K A;  2PHY A;  3MMH A;  1W63 Q;  4Z1W A;  4R38 A;  4EET B;  3BQ8 A;  1STZ A;  3FG8 A;  4DJ3 A;  4MN7 A;  3C2W A;  4PKY G;  4WEK A;  1XFN A;  2W3F A;  2IA2 A;  3H9W A;  3UMD A;  4PHT A;  3RH8 B;  3UB8 A;  4R6L A;  2NUT C;  1T1B A;  1OJ5 A;  3E98 A;  2J80 A;  3B33 A;  3CI6 A;  1NLY A;  1F9I A;  2P04 A;  2HJE A;  3F1P A;  3KYQ A;  4NXB A;  4P6Z M;  3MQQ A;  3SW1 A;  1P9W A;  1MKM A;  3CUE A;  4NXG A;  3LR4 A;  1S66 L;  3KSH A;  3PYP A;  5AJG A;  3KYZ A;  1XFQ A;  2QWS A;  4HH3 A;  4I3J A;  1N9L A;  3OC2 A;  4YOF A;  2GJ3 A;  2KOI A;  1D7E A;  1N9N A;  2VV6 A;  3BW6 A;  3VOL A;  3C30 A;  3HJI A;  4HI4 A;  1JNU A;  3PR6 A;  3U2A A;  2ZMV A;  2EWV A;  2L0W A;  2W1R A;  4HP4 A;  2J3T C;  4HOI A;  3LI8 A;  1P0Z A;  4F3L A;  3ZYT A;  4HH2 A;  2HV1 A;  2V9A A;  5HWT A;  3JVU A;  3LYX A;  3T50 A;  3TE8 A;  2B02 A;  3H82 A;  1OTI A;  2INW A;  1P9R A;  4WLA A;  4B9O A;  3HCY A;  4ZRR A;  4WEJ A;  2V1B A;  2VGL S;  2PR6 A;  3EEH A;  2M7U A;  3GDI A;  3LIF A;  4DN0 A;  4ETX A;  2NUP C;  1W63 M;  3G6O A;  1DRM A;  2W1T B;  4NXF A;  3IS2 A;  3S7P A;  3ZQ5 A;  2VV7 A;  1XJ6 A;  2Z6D A;  1S1Z A;  1TS0 A;  2VJW A;  3LIE A;  2JN7 A;  4MN5 A;  2Z6C A;  4Q0J A;  1GSV A;  1T1C A;  4EEU A;  1TS7 A;  1P97 A;  2KDK A;  5A8B A;  1TD5 A;  3CIT A;  3E4O A;  1VHM A;  5LBR A;  5HPF A;  2VA0 A;  3T4S A;  1LSW A;  4FSF A;  3OCL A;  4ARZ A;  3W2Z A;  3TW8 A;  4DJ2 A;  4LLO B;  3LID A;  4IHQ A;  4JGR A;  4NEE D;  3OLO A;  1IFQ A;  3LFV A;  4XT2 B;  2JKT I;  5TBM B;  1LSX A;  3KO6 A;  4Y3I A;  3PBQ A;  1ZHH B;  2WKQ A;  3S7O A;  4BJP A;  3T4J A;  1TS6 A;  3MF0 A;  4EQ1 A;  2FH5 A;  3B47 A;  2W27 A;  2W0N A;  4BWI A;  2OAQ 1;  2JKR M;  2ZMF A;  1DP6 A;  5IS1 A;  5DJU A;  4MMN A;  2A24 A;  3C8C A;  4YNR A;  5F6A A;  3KSG A;  2HF6 A;  4WL9 A;  5HZH A;  4BBV A;  3PBO A;  1ZTU A;  3ICY A;  4GS9 A;  2I9V A;  3PBR A;  2QHK A;  2VGL M;  3H7W A;  1YAX A;  2QKP A;  1UGU A;  5K5B A;  3A0V A;  1N9O A;  3OBF A;  2JKR I;  3R7W A;  3T4K A;  4RQ9 A;  4MN6 A;  2Y8H A;  1OT9 A;  1S1Y A;  4EER A;  1GSX A;  4I38 A;  4Y2F A;  5F69 A;  2P08 A;  5DKL A;  3F1N B;  1KOU A;  4R70 A;  3MQO A;  4EES A;  5DF9 A;  5FL3 A;  5HPI A;  1G28 A;  1ODV A;  2K2N A;  3E4P A;  4CLC C;  2XSS A;  2GNX A;  3LR3 A;  2O9A A;  4UQI S;  2WKP A;  2CMN A;  2XA7 S;  4CLC B;  2G7U A;  3LUQ A;  4G3W A;  2K31 A;  4PAU A;  3F1O B;  4MDZ A;  5G4Y A;  5DFX A;  4R3A A;  5G4Z A;  4KUO A;  3P7N A;  1DP9 A;  4HHD A;  4Q0I A;  3S7N A;  1LT0 A;  2J3W A;  2OAP 1;  2WKR A;  4I3I A;  3BQA A;  3A0R A;  5HD5 A;  4I3A A;  2MJ6 A;  3BJN A;  3FPV A;  2O9B A;  2O9C A;  2PYP A;  3T4O A;  1UWN X;  2B18 A;  1EW0 A;  1WA9 A;  5EFW A;  1G6O A;  2EWW A;  5HL6 A;  3DBA A;  4EW7 A;  4LRX C;  1XJ4 A;  1VB6 A;  4GCZ A;  1NLZ A;  4FOF A;  2W3D A;  2VEA A;  1X0O A;  2JKT M;  3R4K A;  4IUH A;  4OOL A;  2J3T D;  2OWH A;  4K08 A;  5F68 A;  4WF0 A;  3T4L A;  4M4X A;  2QYB A;  1V9Y A;  1NRJ A;  1T18 A;  3UE3 A;  4EU0 A;  4G3K A;  3LR0 A;  3LI9 A;  3PBT A;  3LR5 A;  3PXP A;  1BYW A;  3FPW A;  5J3W A;  1F5M A;  4GHI B;  3A0S A;  5DJT A;  3ULF A;  2D01 A;  3NOP C;  2W1T A;  4OOM A;  1DP8 A;  3RTY A;  4BBT A;  4HJ3 A;  1TF1 A;  4ME4 A;  4WN5 A;  2L1M A;  2KLI A;  4I5S A;  3HJK A;  4ETZ A;  4PKY A;  4LRZ E;  4KQD A;  1OTD A;  5TJJ A;  3KX0 X;  2XA7 M;  3PHY A;  3VE3 A;  3EQU A;  3NOU C;  4L9F A;  2P7J A;  2LB5 A;  4H6J B;  5DFY A;  1V9Z A;  3RFB A;  2W3G A;  2D02 A;  3EEA A;  4JGO A;  2M7V A;  4NKP A;  3K3D A;  4O8G A;  3UB7 A;  4MCW A;  1H8M A;  2W3E A;  4EXO A;  5HDC A;  2XRN A;  4II7 A;  2FZ0 A;  3MFX A;  2PR5 A;  2HGV A;  5AVF A;  4HJ6 A;  4XT2 A;  2VV8 A;  1S4S A;  3UB6 A;  5TBM A;  5CX7 A;  2PD8 A;  2VLG A;  4CLC E;  5J4E A;  1YKD A;  3CUE C;  3O5Y A;  1MC0 A;  3E0Y A;  3F1P B;  4Y5F A;  3C38 A;  2DMW A;  3T4Q A;  3EQV A;  2V0U A;  2PYR A;  4L9G A;  2GZA A;  3EGD C;  3LIC A;  5AVE A;  3OCN A;  4HIA A;  2OWJ A;  1OTE A;  3KSF A;  1YSP A;  2K7S A;  3IBR A;  1IOU A;  2HJ9 C;  5IT5 A;  2O99 A;  2PT7 A;  4UEY A;  2XRO A;  4DMZ A;  4IJG A;  2V1A A;  5KIZ A;  1OPX A;  3EGX C;  4KQO A;  4WEL A;  3B42 A;  4F3L B;  2ZOH A;  5KSH A;  4WUJ A;  1OTA A;  3FC7 A;  3MJQ A;  3CLO A;  3H82 B;  1LL8 A;  2LB9 A;  4E04 A;  3F1N A;  4L0L A;  1T1A A;  3GEC A;  2O0Y A;  3MXQ A;  1F98 A;  4GLQ A;  2VKS A;  4CQH A;  5F5Y A;  1XJ2 A;  3PBS A;  3IS2 B;  5HWV A;  1LSV A;  3VV4 A;  1S4R A;  1H3Q A;  3BY9 A;  2GX5 A;  4CLC D;  4EUV A;  2H28 A;  4JGQ A;  4CLC A;  1T19 A;  1OTB A;  4LRY C;  3MQ0 A;  4IUK A;  4GJ4 A;  1Y28 A;  4NXE A;  1D06 A;  3F1O A;  3UME A;  3E4Q A;  3OOV A;  2JHE A;  2W3H A;  4EEP A;  3NHQ A;  2QJ5 A;  3UB9 A;  5HDS A;  2EA9 A;  2QJ7 A;  2A2L A;  5DKK A;  1OT6 A;  4AFI A;  3MR0 A;  4KUK A;  3TRC A;  4ARZ B;  5HWW A;  4YWZ A;  3EWK A;  3K3C A;  5I5L A;  3T4T A;  2KX6 A;  2YKF A;  3TJZ C;  2VX8 A;  3IBJ A;  1XJ3 A;  3K2N A;  3BWL A;  1OJG A;  3D72 A;  4P6Z S;  3LIB A;  4G3V A;  1NWZ A;  2L4R A;  4UQI M;  5HDD A;  1TS8 A;  1MZU A;  2M1C A;  3NOT C;  3V67 A;  2Y79 A;  4O0P A;  3S7Q A;  2OOL A;  1S67 L;  4GW9 A;  3VE4 A;  4BMW A;  3JVV A;  2A24 B;  4BBU A;  5MC7 A;  4HJ4 A;  3D3O A;  3NJA A;  2ZBB A;  2BAS A;  4I39 A;  2VZW A;  5HD3 A;  4QPR A;  4GS9 B;  4HY8 A;  2V0W A;  4GHI A;  3H7W B;  4LPZ A;  1UWP X;  2ZOI A;  5IU1 A;  2PD7 A;  3BY8 A;  3CAX A;  5HSQ A;  3R7W B;  1YSQ A;  4HP9 A;  2YKH A;  4HQA A;  1GSW A;  4Q0H A;  5L8M A;  3EOI A;  4B93 A;  2R78 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...