3LI9A

Crystal structure of the extracellular domain of the putative histidine kinase mmhk1s-z2
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
262
structure length
262
Chain Sequence
KLAYEKSIEMAGNYANQFDAQMEANQAIARTLACTMAEYGSQDREEAMSIIKRILNENPQLIGVYLGYEPDAFDGRDKNYINAPGHDSTGRFVPYCNKINGPVIIEPLVHYDSSDYYQLPKTTGKDTLTEPYFYEGIFMVSYDSPIFKNGEFAGIAGVDVPLEYVDDVASSIRTFDTGYAFMVSNTGIFLSHPTQKNWIGEKSLSDFDVEEIKNAASDIREGIGGHVEIKDPITGKTVIMFYEPVKTGDFSFVLVVPKEEML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Hypothetical sensory transduction histidine kinase
publication title Structural characterization of the predominant family of histidine kinase sensor domains.
pubmed doi rcsb
source organism Methanosarcina mazei
total genus 69
structure length 262
sequence length 262
ec nomenclature
pdb deposition date 2010-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02743 dCache_1 Cache domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3li9A01
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3li9A02
1T1BA 3F1OA 3MR0A 2Z6DA 1N9OA 2YKFA 5A8BA 1S1YA 4YWZA 4GHIB 2VEAA 2PYPA 1OTDA 1S4RA 1XJ2A 4H6JA 5HDCA 4HJ6A 3F1NB 2QHKA 2ZBBA 4L9EA 1N9LA 3NOUC 2PD7A 3LUQA 4HJ3A 4HI4A 1UWPX 2R78A 1N9NA 5DJTA 4KQDA 3P7NA 2I9VA 4DJ3A 1V9ZA 2V9AA 4R38A 5F68A 4B9OA 4KUKA 4WF0A 3CLOA 4I3JA 4I3AA 4GS9A 3F1OB 3FC7A 1S1ZA 4WN5A 3LICA 4BBTA 3GECA 1T1CA 5G4ZA 1OTAA 2QJ5A 2JN7A 4BBVA 1XFNA 4R6LA 1XJ3A 1OJ5A 3ICYA 2GJ3A 3H9WA 2PR6A 1NWZA 5HD5A 4HOIA 3UE6A 3VOLA 4JGQA 1D7EA 5EFWA 1X0OA 2KDKA 5AVFA 2M1CA 5HZHA 3C2WA 1UWNX 3H7WA 3UB6A 4PKYG 1XJ4A 3BY9A 3A0VA 4EETB 1XFQA 1TS6A 4GHIA 1V9YA 1T1AA 1JNUA 3F1NA 4RQ9A 4HIAA 3VE4A 3PYPA 4L9GA 2BASA 2ZOHA 3VE3A 1TS7A 3T50A 4R3AA 4JGOA 2PR5A 5IS1A 1MZUA 2W27A 3BY8A 2H28A 3MFXA 3MQQA 2WKRA 4R70A 1F98A 1XJ6A 3UMDA 3ZQ5A 2Z6CA 2L0WA 3G6OA 1Y28A 4HHDA 2V1BA 2VV7A 4I39A 1P0ZA 3CWFA 5HD3A 1OTBA 3LIDA 2WKQA 5IU1A 1GSVA 4MN5A 3RTYA 3LIFA 3F1PB 4BBUA 2ZOIA 4DJ2A 2VLGA 2VV6A 1S66L 1F9IA 3GDIA 4K08A 1T19A 1OTIA 2CMNA 3C8CA 4LLOB 4LPZA 4EW7A 4MN6A 4XT2A 2PD8A 4WL9A 3HJKA 1DRMA 2QWSA 2QJ7A 1KOUA 4GCZA 4HP4A 3ULFA 1EW0A 3EEHA 3E4OA 4JGPA 3SW1A 3MJQA 3NHQA 3MXQA 1OJGA 5HDSA 2PYRA 3K3DA 2QKPA 2A24B 1LT0A 3LIEA 1LSWA 4HNBA 3UMEA 1LSVA 2INWA 1G28A 5HDDA 4HP9A 4KUOA 4LRYC 3UB9A 3NOTC 4XT2B 5I5LA 1GSWA 2JHEA 3LIAA 4E04A 3H82A 2V0WA 3UB7A 5F6AA 1OTEA 5G4YA 3A0SA 1TS0A 3A0RA 4I5SA 2OWHA 4M4XA 3EWKA 4WUJA 3UB8A 5HWWA 5TBMB 1P97A 2V0UA 5J4EA 3LYXA 4EXOA 3LI9A 1WA9A 5J3WA 3F1PA 4GW9A 3B33A 3H82B 2D02A 2J80A 1OT6A 4EEPA 1S67L 3PHYA 3E4PA 1TS8A 2L1MA 1DP8A 2PDRA 1ODVA 5DJUA 2K7SA 4HJ4A 3MQOA 4PKYA 3K3CA 2HV1A 5F69A 4WLAA 3LIBA 2VV8A 4EESA 4F3LA 2A24A 3RH8B 3LI8A 4HH2A 2L4RA 1DP9A 4JGRA 3D72A 4H6JB 3IS2A 3FG8A 1OT9A 4I3IA 3NOPC 1T18A 4EQ1A 4LRXC 4F3LB 4HQAA 2EA9A 5TBMA 3HJIA 2OOLA 1VB6A 4GS9B 4L9FA 2PHYA 2WKPA 2KX6A 3CAXA 1S4SA 3IS2B 2OWJA 2W0NA 3E4QA 2V1AA 1LSXA 5DKLA 4NXGA 5HSQA 3OLOA 3KX0X 1DP6A 4EERA 1D06A 2B02A 1BYWA 2D01A 4NXFA 5F5YA 5KIZA 4HY8A 5AVEA 4LRZE 1GSXA 5DKKA 4HH3A 1LL8A 3BWLA 5HWVA 3IBRA 2YKHA 3H7WB 4NXBA 4I38A 1UGUA 5HWTA 5J7EA 3NJAA 4EEUA 4NXEA 2P7JA
chains in the Genus database with same CATH superfamily
1T1BA 3MR0A 1N9OA 4GLQA 2XDMA 5A8BA 4DKIA 1I5QA 2O0YA 1PRQA 2ZC4B 5DFXA 1G6OA 3IWQA 3T1RA 3VSKA 3GR2A 4HI4A 3SZTA 2ZMVA 3FKVA 1VHMA 3PBSA 2R78A 1HVBA 1N9NA 2GNXA 4KQDA 3P7NA 3GMWA 4DJ3A 5FASA 4S2PA 1V9ZA 3O3VA 4PHTA 5F68A 3Q7ZA 4B9OA 3E98A 4WF0A 1K25A 1YSQA 3PBRA 2V8CA 4DE3A 4I3AA 3F1OB 3FC7A 1S1ZA 4LV0A 3BW6A 4Y15A 1GA9A 1NRJA 1RCJA 1XA1A 1BLCA 4FH4A 4BBTA 4E3JA 3Q81A 3A3IA 2QJ5A 4JF4A 1KE3A 4F94A 1NLYA 1HLUP 2ZC7A 4BBVA 1CI9A 2PU4A 4K0WA 3FWLA 4S2KA 4IUHA 4RA7A 3EQVA 5CTMA 4U3TA 4JKTA 4OQ0A 4JGQA 4FSFA 4KZ7A 3NECA 4KENB 4Z9QA 1NRFA 3C2WA 3H7WA 3UB6A 4ZDXA 3V5MA 1Y4OA 3HUNA 1CEGA 2Q9MA 1TS6A 5CHUA 4EUZA 3BFEA 2WUQA 3F1NA 4KG2A 1SZVA 3WS0A 4RQ9A 2EX2A 4HIAA 1MWRA 1VEUB 1L0GA 1VETA 4L9GA 2WAEA 2ZOHA 4JLFA 1TS7A 5DFYA 1CF0A 1FR1A 1VQQA 4P85A 2PAVP 2Y2PA 1DJAA 4OOLA 1IYOA 5IS1A 4MMNA 1RP5A 1W5DA 4KQQA 2DMWA 3GRJA 2H28A 4X55A 2IWCA 4R4RA 4UA7A 4R70A 5JYOA 3C7UA 5CERA 4B4XA 3ZQ5A 3LEQA 4E3LA 4MCWA 3CITA 3DWZA 5GHXA 3G31A 4E6WA 4P87A 1PWDA 3PBOA 1TVFA 2Y2MA 2WKQA 2P9VB 5GLCA 4R3JA 4MN5A 3F1PB 2IWBA 2ZQ8A 1PZPA 4BBUA 3MBZA 2WGWA 2ZOIA 2VLGA 5F83A 2VV6A 1T19A 3IF6C 2J9OA 1OTIA 1LLBA 1PW1A 3CUEC 3ISGA 3S7PA 3GVBA 4OP5A 1RGZA 2PD8A 4OQHA 2VGJA 1K6RA 4DXBA 2QWSA 5DTKA 3B3XA 2XA7S 1ERQA 2A3UA 4P6ZM 3EEHA 5KZHA 3W4QA 1OJGA 3WS2A 4IVKA 2PYRA 2ZL1A 5FAOA 1PIOA 5L8MA 1PW8A 5FQMA 2H0TA 3C4OA 4UQIM 3UMEA 1BT5A 1G6AA 3TRCA 2I72A 4II7A 4GZBA 4WM9A 1QMEA 3VP1A 3OPHA 3NOTC 5I5LA 1GSWA 2HDSA 2JHEA 1ES3A 5FQIA 3H82A 4PMAA 2V0WA 3UB7A 1ACFA 1E3UD 2ZM0A 3BECA 4Y2FA 3E0YA 3CUEA 5F6AA 1KDWA 1OTEA 2Y91A 4GD6A 2KOIA 3A0RA 3KYZA 4EU0A 3JVUA 4YINA 4MBKA 5HL1A 3UPNA 2ZQ7A 1Q2QA 5EOEA 3LYXA 4K91A 4U0XA 3LI9A 2R9XA 1WA9A 1IOUA 2EXBA 5J3WA 3Q82A 4DN0A 2RCXA 3AGFA 1OT6A 3N8RA 3NIAA 3PHYA 1K55A 2K31A 3G2ZA 2ZQAA 3SS4A 5E2EA 1DP8A 1FCMA 3HLBA 5GHYA 4GOGA 4WELA 5DJUA 3BRMA 3D9YA 3ZVWA 1MWUA 3LO7A 2K7SA 4HJ4A 5A93A 1H8ZA 3CZDA 3CPTB 4R1GA 1SHVA 4R0QA 2X01A 5L2FA 4UAAA 3S4XA 1XKZA 1W63Q 3S7NA 3OPPA 4IVIA 3R7WA 5F1FA 4GDNA 5C5KA 4Y0OA 4WZ5C 2WYXA 1OT9A 4I3IA 1JTGA 4QPRA 1YMSA 4JF5A 4EQ1A 4K0XA 4O01A 3MKFA 3NY4A 4LRXC 3BYDA 4CPKA 3DTEA 4Q0JA 4F3LB 4CQHA 4HQAA 3HLFA 2JKTI 2EA9A 3EEAA 3HLGA 2Y2OA 5TBMA 4IBXA 3PBTA 2QYBA 1ALQA 3LY3A 4L9FA 4Q0IA 4X53A 2PHYA 2KX6A 3CHWP 3CAXA 4FOFA 3IS2B 4QB8A 3W2ZA 3KO6A 4S2NC 2V1AA 2ZMAA 4FD8A 2VJWA 1BUEA 1A0KA 1BLSA 5FDSA 4EERA 1DJCA 3BFCA 3SS3A 1Z09A 1BYWA 4WMCA 4NXFA 1STZA 2KLIA 1NZUA 1Z6FA 1YPRA 5KIZA 1BLHA 4LRZE 3UE0A 5D3OA 3BWLA 5HWVA 2W1RA 3H7WB 3BFDA 1UGUA 4LV3A 4NK3A 5CGSA 3NJAA 1N4OA 5DVAA 2P7JA 4NXEA 3V50A 2YKFA 1TEMA 4YWZA 2MJ6A 4WBGA 3MZDA 1H8MA 4NG2A 5EVEA 4HJ6A 3F1NB 1K54A 3AGEA 2Y59A 3ZNTA 2JC7A 1VETB 1ERMA 3LCEA 2I9VA 2V20A 4KUKA 4G3WA 3CLOA 1L0FA 1BZAA 4ME4A 4NKPA 3HLCA 1MPLA 1ZG4A 3P98A 4WN5A 4G3KA 4E3NA 4DE0A 2C5WB 4P6BA 5G4ZA 3M6HA 2JN7A 2XK1A 1XFNA 3IHBA 1YLYA 4S2OA 1ZG6A 1SKFA 2GJ3A 2PR6A 3HREA 4MBFA 1NWZA 5FQQA 1TD5A 4ZJ3A 5HD5A 4HOIA 3UE6A 3UDIA 5EV0A 3NC8A 3VOLA 2BG1A 3W4OA 1D7EA 1D1JA 4O8GA 2XR0A 3LY4A 5HZHA 1UWNX 5EVIA 4PKYG 1XJ4A 2HP5A 5L07A 4BLMA 4S2LA 2EXAA 3BY9A 3OCLA 5HL6A 5U47A 2G7UA 5FA7A 1E4DA 2W3DA 2QMIA 2FH5A 4JBFA 1TDGA 4GHIA 3O5YA 3ZG7B 3RFBA 3Q07A 3V3RA 2JBFA 1KGEA 2J7VA 2UWXA 2VGKA 3A3JA 3BQ8A 4IUKA 1XGJA 2BASA 2ZL1B 5TR7A 3VE3A 2WKEA 5AQ9A 3V67A 4GD8A 2VGLS 4RX2A 1ESIA 2A2LA 2HF6A 3MS6A 4PM7A 3T4KA 5DTTA 2W27A 3MFXA 2OV5A 2WKRA 3N8LA 4R4SA 1DJBA 1F98A 1XJ6A 3UMDA 3DTKA 1AWIA 2Z2LB 1HTZA 3IH9A 1SDNA 1VM1A 2L0WA 1S0WA 3NDGA 4HHDA 1W63M 4I39A 1JWPA 4B4ZA 3CWFA 5HD3A 1OTBA 5HPFA 3EGDC 4OOYA 4HBUA 3L7HA 3RXXA 4BD0A 4KZ4A 2B95A 2E8JA 3RTYA 3LIFA 1PI4A 1PNEA 2B18A 5E2GA 3QNBA 3QP2A 3IX4A 2HPBA 4DJ2A 1ZTUA 3G2YA 2XD1A 5F1GA 3BEBA 1F9IA 3GDIA 1FR6A 4K08A 5GL9A 5I94A 1KE4A 4BMWA 3BM6A 2CMNA 3ITAA 3W4PA 4EW7A 5CGWA 1E25A 2XFSA 4XT2A 1XXMA 4WL9A 3OPRA 1W8QA 4GCZA 4AFIA 1KGGA 5FSRA 1WE4A 3Q7VA 2P74A 3UDXA 3NHQA 3MXQA 3FZCA 3K3DA 2QKPA 2Q9NA 1LT0A 3OOVA 5IHVA 1BLPA 1YLWA 1G28A 3PAEA 3R7WB 1K4EA 3P09A 4Q8IA 4KQRA 2O99A 3SH7A 3Q1FA 4PM8A 3LIAA 4KZ8A 5TJJA 4OPYA 1MC0A 1ZKJA 4XUZA 4Y0UA 2ZM8A 4IJGA 3ZFZA 4RVAA 3LR0A 1K56A 3M2JA 5BOHA 2Y2JA 3JPUA 5TBMB 2Y8HA 5GHZA 2J9PA 2V0UA 3K2NA 3O86A 4EXOA 1L0DA 1EROA 4GW9A 1H8YA 4OH0A 1MBLA 1S67L 4JXVA 3ZYTA 1PYYA 4GDBA 4A5RA 1E3UA 1ODVA 3IXGA 4E3OA 3LGOA 3AGDA 2OLUA 3NI9A 3IWOA 4XXRA 5FATA 4HESA 2M7UA 3HLWA 3QP5A 3T1SA 2X02A 1YLZA 2HV1A 3UDFA 4KZ3A 5EOOA 4OKPA 2A24A 3HBRA 1ES4A 3RH8B 3LI8A 2L4RA 5E43A 5FQ9A 2W3GA 2EX9A 2WZXA 3A3FA 4JXWA 4JGRA 1IYPA 2Y2QA 5TFQA 2XRNA 2ZM2A 3WRTA 1EWZA 2H10A 1ONGA 3O88A 4OQIA 4OOMA 2BTFP 5DTSA 5FEGA 1TDLA 1YT4A 4ARZA 2NUPC 5J8XA 3E2KA 2XH9A 4UEYA 4Y13A 3BLMA 2CC1A 4DF6A 4KZ5A 1F2KA 4X68A 1I2WA 2O9BA 4C75A 4P6ZS 2OWJA 4ETZA 1BTLA 2W0NA 3QP1A 5HFOA 3E4QA 4CLCB 2Y2NA 5A91A 3IF6A 3JVVA 4WEJA 2OAP1 3KX0X 4UQIS 1SKOA 2FZ0A 3BLSA 1D06A 2D01A 2PBYA 4HY8A 4GN2A 4E3KA 5AVEA 4EWFA 3T4LA 3V39A 5DKKA 2W1TA 4HH3A 3ZG9B 4QD4A 1LL8A 4XUXA 4X25A 3IBRA 3EQUA 4PPRA 2YKHA 5EVIB 3QP6A 1H3QA 2HJ9C 4EEUA 4BWIA 2J3TC 3F1OA 4ESPA 2VA0A 2Z6DA 3PAGA 1S1YA 4GHIB 1S4RA 1XJ2A 1SCWA 3ZDJA 2QHKA 2ZBBA 4L9EA 1LL9A 3ITBA 3TW8A 3PBQA 3LUQA 1UWPX 2W3FA 1K57C 5DJTA 5GLBA 3SOIA 2ZD8A 1NJ4A 2V9AA 2EX8A 1FCNA 5CTNA 1CI8A 4KG5A 5CHJA 3TE8A 4I3JA 4GS9A 3HVFA 1Y54A 3IBJA 4KZ6A 3UE3A 2P08A 5EM1A 1YAXA 3LR4A 2WK0A 1LI9A 4ZRRA 4BL2A 2C6WB 4JXSA 3MFDA 4FUWA 3S22A 2VZWA 3A3DA 1K0KA 3TSGA 1NZOA 1OJ5A 2JKTM 3ZCZA 1PI5A 3HCYA 2ZQDA 1K6SA 4YFMA 1IKIA 2IA2A 4RX3A 1K57A 1W7FA 3SH9A 2E8IA 1MXOA 3G32A 1VEUA 5M18A 3FYZA 2ZQCA 5AVFA 3UNWA 2M1CA 1G68A 3MF0A 3S7OA 3ZGAB 3W8KA 4EBPA 1M40A 3T4OA 4WZ5A 3B42A 3A0VA 5FAPA 4EETB 3LR5A 1XFQA 4D60A 3IT9A 1V9YA 2EWWA 1T1AA 4X1LA 1JNUA 5TGFA 2LB5A 3WS1A 5A92A 1XP4A 2WGIA 3VE4A 1MKIA 2GX5A 2DNSA 5HARA 3VV4A 3ZVTA 3E2LA 1IKGA 2V8FA 2J3TD 4OVDA 5M19A 2XLNA 4S2NA 1TF1A 2PR5A 2V1ZA 1ONHA 2Q0OA 3EGXC 3P01A 5CXWA 1MZUA 3WS4A 2WAFA 3BY8A 4OLDA 4OLGA 2WADA 3U4LP 4BQMA 3BQAA 2VK3A 3MQQA 2Y2HA 4P0MA 3WS5A 4X6TA 1M6KA 4KZAA 4DE1A 3TG9A 3VP3A 4GB7A 4CLCC 2K2NA 3OCNA 1G5UA 3QHYA 5GLDA 3VFHA 2Z6CA 4D2OA 1XX2A 1Y28A 3M2KA 2V1BA 2HJEA 2VV7A 3UN7A 3IWIA 1ES2A 1JTDA 5L10A 3T4SA 4MN7A 5IU1A 4U0TA 3T12B 3TJZC 2XFTA 1WYCA 4CLCE 4QWOA 5FQJA 4GNUA 3N6IA 5FI6A 2JKRI 3DTIA 2O9AA 3C8CA 2ZC6B 4ZJ2A 4MN6A 3VFFA 4S2MA 1XGIA 3HJKA 3RXWA 1DRMA 2H5SA 1O07A 2ZC5B 4HP4A 1EW0A 3E4OA 4G3VA 3MJQA 3IX8A 2VX8A 4BD1A 3OBFA 4IHQA 3I7JA 2A24B 3VOYA 2WGWB 5HPIA 3ZHHA 2WZZA 3MXRA 5HDDA 2R9WA 4S2IA 4HP9A 4KUOA 3DBAA 3MXSA 3FV7A 4E04A 3VP2A 4DXCA 2OAQ1 5EPHA 3T4JA 4WZ4A 3CG5A 4O0PA 5G4YA 3A0SA 1Q2PA 4N92A 5L09A 4I5SA 4M4XA 4ARZB 3EWKA 4DMZA 3UB8A 5HWWA 3C7VA 5FI2A 3HUOA 2HZ5A 1P97A 4Y3IA 3DAVA 1U60A 4JPMA 3ZNYA 4KG6A 3GSGA 3VP4A 5G18A 5AJGA 3VP0A 3KSIA 3H82B 2XSSA 5M1AA 2J80A 3IF6B 5EVLA 1KGFA 4KZ9A 1OPXA 2XEPA 1CQAA 1W79A 1H5XA 3PBNA 4CLCD 1PZOA 4ETXA 3IHAA 1N9BA 1K38A 3GV9A 5FDHA 3UE1A 4BJPA 2WKIA 4Y5FA 5AQAA 1H0MA 5DF8A 2JKFA 4LV2A 2W1TB 2G2UA 1FQGA 1WYBA 5F69A 3NCKA 2WGVA 2VV8A 4EESA 4F3LA 1BULA 4YNRA 3BFFA 1JWZA 4HH2A 4QU3A 1PWGA 2HGVA 3MMHA 1CK3A 2PRFA 5EVID 1YLTA 1YQSA 1DP9A 4GJ4A 1YSPA 1IFQA 2Y2GA 3IF5A 3A3EA 3WWXA 3IS2A 3FG8A 3SH8A 3ZG5A 1KVMA 4RYEA 3CMZA 1T18A 5HX9A 2JKGA 2XGNA 1P9RA 4QJGA 4NETA 2PU2A 3HJIA 2OOLA 1VB6A 4EQIA 4GS9B 2XD5A 1PWCA 2EX6A 1J9MA 1BSGA 1S4SA 4MNRA 4PM6A 2GDNA 4DE2A 4EBLA 4MEZA 1LSXA 5HSQA 3OLOA 2Y2LA 4LCLA 5FEFA 3DW0A 1DP6A 1GHPA 3UO9A 3T1QB 4H8RA 5FL3A 2XROA 3PXPA 5LBRA 4E3IA 5F5YA 1ZHHB 4L0LA 4OONA 5DF9A 2DRWA 5EECA 1HZOA 1GSXA 3HL9A 3JYIA 3G34A 3N7WA 4QY6A 5E2FA 3MZFA 3G30A 2J8YA 1L3LA 4NXBA 1XA7A 1QMFA 5HWTA 4WEKA 4KQOA 2Y79A 1KVLA 2Y55A 5HW3A 2VEAA 2PYPA 1OTDA 3OC2A 3QNCA 4H6JA 3KSFA 5HDCA 4B93A 2AVXA 4ID4A 1MWSA 4B88A 3VOZA 2LB9A 3G35A 1N9LA 3MKEA 5CHMA 3NOUC 2PD7A 1KDSA 4HJ3A 4Y7PA 4R38A 4UA6A 1SDEA 2HDUA 1I2SA 2QPNA 1RGYA 5K5BA 1OMEA 3UPOA 1FSYA 4HBTA 1IYSA 4OP8A 3KSHA 3O87A 4ZBEA 3LICA 1L0EA 4JF6A 3GECA 2XA7M 1T1CA 2Z2MB 1OTAA 2OSUA 1P9WA 3T4TA 5JYPA 4C6YA 4R6LA 1AXBA 1XJ3A 1C3BA 3ICYA 2M7VA 4EBNA 2PT7A 3H9WA 2ZQ9A 4N9KA 4C3QA 3MZEA 3GQZA 1K56D 3FKWA 5DF7A 3N8SA 4FTXA 5EFWA 1X0OA 1YMXA 3KSGA 2KDKA 3OPLA 4FH2A 4MDZA 1DY6A 1FIKA 2Y2KA 1LL5A 4IBRA 1NLZA 4NEED 2ZLYA 1ZC2A 2JE5A 4ZTKA 2HP9A 3B47A 3CI6A 4DDSA 4UA9A 1NYMA 5F82A 1K55C 3R4KA 1JVJA 4QY5A 4LGWA 4Q0HA 1NYYA 1HD8A 5CGXA 1IELA 3SS5A 3PYPA 3HUMA 1FILA 2HP6A 3IXHA 3LFVA 1XPBA 3D4FA 2FFYA 3U2AA 4E6XA 3T50A 4E3MA 1FSWA 2UV0E 4CJNA 1LHYA 3TOIA 4R3AA 4HEFA 5CEDA 4JGOA 4OPZA 4EUVA 1MY8A 1IYQA 2P04A 4EV4A 1F5MA 2IWDA 5CEBA 5AQ7A 3QP8A 2ZC3B 1ES5A 2JCHA 4IEDA 3G4PA 3G6OA 1YLPA 2G2WA 1P0ZA 5EUAA 4Z1WA 3LIDA 5IT5A 3UY6A 4LCMA 1GSVA 2ZMFA 4PM5A 3DWKA 2DCFA 1S6RA 4X69A 2Y2IA 3RJUA 2V2FF 3MQ0A 5HAIA 2PBDP 4KZBA 1S66L 1O7EA 2WKHA 2XF3A 4LPZA 4LLOB 3UPPA 5KSCA 3V3SA 4FCFA 3IH8A 4X56A 3S1YA 4JXGA 1YM1A 2BLSA 2QJ7A 3FPWA 1KOUA 3ULFA 4JGPA 3IQAA 3SW1A 3BJNA 3LR3A 4UHUA 5HDSA 3LEZA 5CX7A 4ZJ1A 3LIEA 1LSWA 4HNBA 5AQBA 1LSVA 4X1MA 5HAQA 2INWA 4BL3A 5EE8A 3WRZA 1NY0A 1EI5A 5EM0A 2O9CA 5CECA 4LRYC 1J3WA 3UB9A 3PTEA 4XT2B 4N1XA 1GHIA 4YOFA 3D3OA 2Y4AA 3OZHA 2NUTC 3Q7VB 3NULA 1TS0A 2X71A 1K54C 2FFFB 3C30A 4N1HA 2OWHA 2XQZA 2GZAA 5MC7A 4WUJA 3C4PA 1YLJA 3T1XA 1PFLA 5J4EA 4N9LA 1ESUA 4LFUA 2P9VA 4MBHA 3DTMA 3F1PA 2QZ6A 3B33A 2D02A 2ZJ9A 1KE0A 4PAUA 2H0YA 3ZG8B 1JWVA 4EEPA 3MSHA 3E4PA 1TS8A 3C38A 2HDRA 4M3KA 1GHMA 4R3BA 3C5AA 2L1MA 5FAQA 2PDRA 1L2SA 3KYQA 3BFGA 5KMWA 4S2JA 3MQOA 4PKYA 3HLDA 2W3HA 3QP4A 3K3CA 3IXDA 3CJMA 1CEFA 2W3EA 4WLAA 3LIBA 1IEMA 1MKMA 2EWVA 2JKRM 1GCEA 2EFXA 4ZAMA 2ACGA 3HLEA 5EVIC 3N4IA 3S7QA 1NXYA 5FQKA 3D72A 3PR6A 4MLLA 5A90A 4H6JB 3NOPC 3IXBA 4CLCA 3EOIA 4WMCD 1YKDA 4OPQA 4R23A 3IX3A 4PM9A 4Y17A 5FI7A 4WYYA 5KSHA 2J3WA 3VMAA 4OPRA 2A49A 3ZG0A 3VSLA 3FPVA 3KYEA 2RL3A 1FCOA 4QHCA 3GTCA 5E2HA 2WKPA 3UB5P 4DDYA 1W8YA 5HAPA 1MWTA 4Y0TA 4O7DA 4GKUA 4NXGA 5DKLA 1LI0A 1CJFA 2VGLM 5CRFA 2B02A 1FOFA 2EFUA 4DRTA 2VKSA 2HDQA 3M6BA 4OQGA 3L9KA 4LV1A 2B5RA 3CPTA 1K4FA 1GA0A 4I38A 3NBLA 4LENA 3T4QA 5GLAA 5J7EA 2OLVA 4BENA 3NDEA 1SKOB
chains in the Genus database with same CATH topology
2J3TC 1T1BA 3F1OA 3MR0A 2VA0A 1N9OA 2YKFA 2Z6DA 4GLQA 5A8BA 1S1YA 4YWZA 4GHIB 2MJ6A 2VEAA 2PYPA 1OTDA 3OC2A 2O0YA 1S4RA 1XJ2A 1H8MA 4H6JA 3KSFA 5HDCA 4B93A 4HJ6A 3F1NB 5DFXA 1G6OA 2LB9A 2QHKA 2ZBBA 4L9EA 1N9LA 3NOUC 3PBQA 2PD7A 3LUQA 4HJ3A 4HI4A 3TW8A 2ZMVA 1VHMA 1UWPX 2W3FA 2R78A 3PBSA 1N9NA 5DJTA 2GNXA 4KQDA 3P7NA 2I9VA 4DJ3A 1V9ZA 2V9AA 4PHTA 4R38A 5F68A 4B9OA 4KUKA 3E98A 4WF0A 1YSQA 4G3WA 3CLOA 3PBRA 5K5BA 3TE8A 4ME4A 4I3JA 4I3AA 4NKPA 4GS9A 3F1OB 3FC7A 1S1ZA 3IBJA 3BW6A 4WN5A 4G3KA 3UE3A 3KSHA 1NRJA 2P08A 3LICA 1YAXA 3LR4A 4BBTA 3GECA 2XA7M 1T1CA 4ZRRA 5G4ZA 1OTAA 2QJ5A 1P9WA 2VZWA 3T4TA 1NLYA 2JN7A 4BBVA 1XFNA 4R6LA 1XJ3A 1OJ5A 2JKTM 3ICYA 2M7VA 2GJ3A 2PT7A 3H9WA 4IUHA 2PR6A 3HCYA 1NWZA 1TD5A 3EQVA 2IA2A 4HOIA 5HD5A 3UE6A 3VOLA 4JGQA 1D7EA 5EFWA 1X0OA 4FSFA 3KSGA 4O8GA 2KDKA 5AVFA 4MDZA 2M1CA 3MF0A 3S7OA 5HZHA 3C2WA 1UWNX 3H7WA 1NLZA 3UB6A 4NEED 4PKYG 1XJ4A 3T4OA 3BY9A 3OCLA 5HL6A 3B47A 2G7UA 3B42A 3A0VA 3CI6A 4EETB 2W3DA 3R4KA 3LR5A 1XFQA 2FH5A 1TS6A 4GHIA 3O5YA 1V9YA 3RFBA 2EWWA 1T1AA 1JNUA 2LB5A 3F1NA 4Q0HA 4RQ9A 4HIAA 3VE4A 3BQ8A 3PYPA 4L9GA 4IUKA 2BASA 2GX5A 3LFVA 2ZOHA 3VE3A 3U2AA 1TS7A 3V67A 3VV4A 5DFYA 2VGLS 3T50A 4R3AA 4OOLA 2A2LA 2HF6A 2J3TD 4JGOA 1TF1A 2PR5A 5IS1A 4MMNA 3T4KA 4EUVA 3P01A 3EGXC 1MZUA 2W27A 3BY8A 2P04A 2DMWA 2H28A 3MFXA 3BQAA 3MQQA 2WKRA 4R70A 1F5MA 1F98A 1XJ6A 3UMDA 3ZQ5A 4MCWA 4CLCC 2K2NA 3CITA 3OCNA 2Z6CA 2L0WA 3G6OA 1Y28A 4HHDA 2V1BA 1W63M 2HJEA 2VV7A 4I39A 1P0ZA 3PBOA 3CWFA 5HD3A 1OTBA 5HPFA 3EGDC 4Z1WA 3LIDA 3T4SA 4MN7A 5IT5A 2WKQA 5IU1A 1GSVA 4MN5A 2ZMFA 3LIFA 3F1PB 3RTYA 3TJZC 4BBUA 4CLCE 2B18A 2ZOIA 4DJ2A 2VLGA 1ZTUA 3MQ0A 2VV6A 2JKRI 1S66L 1F9IA 3GDIA 4K08A 1T19A 2O9AA 4BMWA 1OTIA 3CUEC 2CMNA 3S7PA 3C8CA 4LLOB 4LPZA 4EW7A 4MN6A 4XT2A 2PD8A 4WL9A 3HJKA 1DRMA 2QWSA 2XA7S 3FPWA 2QJ7A 1KOUA 4GCZA 4HP4A 3ULFA 1EW0A 3EEHA 3E4OA 4G3VA 4JGPA 4P6ZM 4AFIA 3SW1A 3MJQA 2VX8A 3BJNA 3NHQA 3MXQA 3LR3A 1OJGA 3OBFA 5HDSA 2PYRA 5L8MA 3K3DA 4IHQA 2QKPA 2A24B 5CX7A 1LT0A 3OOVA 3LIEA 1LSWA 4HNBA 4UQIM 3UMEA 1LSVA 5HPIA 2INWA 3TRCA 1G28A 3R7WB 4II7A 5HDDA 2O99A 4HP9A 4KUOA 2O9CA 4LRYC 3UB9A 3DBAA 3NOTC 4XT2B 5I5LA 1GSWA 2JHEA 3LIAA 5TJJA 4E04A 3H82A 2V0WA 1MC0A 3UB7A 2OAQ1 4Y2FA 3E0YA 3CUEA 5F6AA 4YOFA 3T4JA 1OTEA 3D3OA 2NUTC 4O0PA 5G4YA 3A0SA 4IJGA 2KOIA 1TS0A 3A0RA 3C30A 4I5SA 3KYZA 4EU0A 2OWHA 4M4XA 4ARZB 2GZAA 3EWKA 3JVUA 3LR0A 4DMZA 4WUJA 5MC7A 3UB8A 5HWWA 5TBMB 1P97A 2Y8HA 4Y3IA 2V0UA 5J4EA 3K2NA 3LYXA 4EXOA 3LI9A 1WA9A 1IOUA 5AJGA 5J3WA 3F1PA 3KSIA 4GW9A 4DN0A 3B33A 3H82B 2D02A 2XSSA 2J80A 4PAUA 1OT6A 1OPXA 4EEPA 1S67L 3PHYA 2K31A 3ZYTA 3E4PA 3PBNA 1TS8A 4CLCD 3C38A 4ETXA 2L1MA 1DP8A 2PDRA 1ODVA 4WELA 5DJUA 3KYQA 4BJPA 2K7SA 4HJ4A 3MQOA 4PKYA 2W3HA 4Y5FA 3K3CA 2M7UA 2W1TB 2W3EA 2HV1A 5F69A 4WLAA 3LIBA 2VV8A 1MKMA 4EESA 4F3LA 2A24A 2EWVA 2JKRM 3RH8B 3LI8A 4YNRA 4HH2A 2L4RA 1W63Q 2W3GA 2HGVA 3S7NA 3MMHA 3R7WA 1DP9A 4GJ4A 5C5KA 1YSPA 1IFQA 4JGRA 3S7QA 3D72A 3PR6A 2XRNA 3IS2A 4H6JB 3FG8A 1OT9A 4I3IA 3NOPC 4CLCA 3EOIA 4QPRA 4OOMA 1YKDA 1T18A 4EQ1A 4O01A 5KSHA 2J3WA 1P9RA 4LRXC 4Q0JA 4F3LB 4CQHA 4HQAA 3FPVA 4ARZA 2NUPC 2JKTI 2EA9A 3EEAA 5TBMA 3HJIA 2OOLA 3PBTA 1VB6A 4UEYA 4GS9B 2QYBA 4L9FA 4Q0IA 2PHYA 2O9BA 2WKPA 2KX6A 3CAXA 4FOFA 1S4SA 3IS2B 4P6ZS 2OWJA 3W2ZA 4ETZA 2W0NA 3KO6A 4CLCB 3E4QA 2V1AA 1LSXA 5DKLA 4NXGA 5HSQA 3JVVA 2VJWA 3OLOA 4WEJA 2OAP1 3KX0X 1DP6A 4UQIS 2FZ0A 4EERA 2VGLM 1D06A 2B02A 5FL3A 2XROA 1BYWA 2D01A 3PXPA 2VKSA 4NXFA 5LBRA 5F5YA 1STZA 1ZHHB 2KLIA 4L0LA 5DF9A 5KIZA 4HY8A 5AVEA 4LRZE 3T4LA 1GSXA 5DKKA 2W1TA 4HH3A 1LL8A 3BWLA 5HWVA 3IBRA 3EQUA 2W1RA 2YKHA 3H7WB 4NXBA 4I38A 1UGUA 5HWTA 3T4QA 4WEKA 5J7EA 4KQOA 3NJAA 1H3QA 2HJ9C 4EEUA 4BWIA 2Y79A 4NXEA 2P7JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T1B A;  3F1O A;  3MR0 A;  2Z6D A;  1N9O A;  2YKF A;  5A8B A;  1S1Y A;  4YWZ A;  4GHI B;  2VEA A;  2PYP A;  1OTD A;  1S4R A;  1XJ2 A;  4H6J A;  5HDC A;  4HJ6 A;  3F1N B;  2QHK A;  2ZBB A;  4L9E A;  1N9L A;  3NOU C;  2PD7 A;  3LUQ A;  4HJ3 A;  4HI4 A;  1UWP X;  2R78 A;  1N9N A;  5DJT A;  4KQD A;  3P7N A;  2I9V A;  4DJ3 A;  1V9Z A;  2V9A A;  4R38 A;  5F68 A;  4B9O A;  4KUK A;  4WF0 A;  3CLO A;  4I3J A;  4I3A A;  4GS9 A;  3F1O B;  3FC7 A;  1S1Z A;  4WN5 A;  3LIC A;  4BBT A;  3GEC A;  1T1C A;  5G4Z A;  1OTA A;  2QJ5 A;  2JN7 A;  4BBV A;  1XFN A;  4R6L A;  1XJ3 A;  1OJ5 A;  3ICY A;  2GJ3 A;  3H9W A;  2PR6 A;  1NWZ A;  5HD5 A;  4HOI A;  3UE6 A;  3VOL A;  4JGQ A;  1D7E A;  5EFW A;  1X0O A;  2KDK A;  5AVF A;  2M1C A;  5HZH A;  3C2W A;  1UWN X;  3H7W A;  3UB6 A;  4PKY G;  1XJ4 A;  3BY9 A;  3A0V A;  4EET B;  1XFQ A;  1TS6 A;  4GHI A;  1V9Y A;  1T1A A;  1JNU A;  3F1N A;  4RQ9 A;  4HIA A;  3VE4 A;  3PYP A;  4L9G A;  2BAS A;  2ZOH A;  3VE3 A;  1TS7 A;  3T50 A;  4R3A A;  4JGO A;  2PR5 A;  5IS1 A;  1MZU A;  2W27 A;  3BY8 A;  2H28 A;  3MFX A;  3MQQ A;  2WKR A;  4R70 A;  1F98 A;  1XJ6 A;  3UMD A;  3ZQ5 A;  2Z6C A;  2L0W A;  3G6O A;  1Y28 A;  4HHD A;  2V1B A;  2VV7 A;  4I39 A;  1P0Z A;  3CWF A;  5HD3 A;  1OTB A;  3LID A;  2WKQ A;  5IU1 A;  1GSV A;  4MN5 A;  3RTY A;  3LIF A;  3F1P B;  4BBU A;  2ZOI A;  4DJ2 A;  2VLG A;  2VV6 A;  1S66 L;  1F9I A;  3GDI A;  4K08 A;  1T19 A;  1OTI A;  2CMN A;  3C8C A;  4LLO B;  4LPZ A;  4EW7 A;  4MN6 A;  4XT2 A;  2PD8 A;  4WL9 A;  3HJK A;  1DRM A;  2QWS A;  2QJ7 A;  1KOU A;  4GCZ A;  4HP4 A;  3ULF A;  1EW0 A;  3EEH A;  3E4O A;  4JGP A;  3SW1 A;  3MJQ A;  3NHQ A;  3MXQ A;  1OJG A;  5HDS A;  2PYR A;  3K3D A;  2QKP A;  2A24 B;  1LT0 A;  3LIE A;  1LSW A;  4HNB A;  3UME A;  1LSV A;  2INW A;  1G28 A;  5HDD A;  4HP9 A;  4KUO A;  4LRY C;  3UB9 A;  3NOT C;  4XT2 B;  5I5L A;  1GSW A;  2JHE A;  3LIA A;  4E04 A;  3H82 A;  2V0W A;  3UB7 A;  5F6A A;  1OTE A;  5G4Y A;  3A0S A;  1TS0 A;  3A0R A;  4I5S A;  2OWH A;  4M4X A;  3EWK A;  4WUJ A;  3UB8 A;  5HWW A;  5TBM B;  1P97 A;  2V0U A;  5J4E A;  3LYX A;  4EXO A;  3LI9 A;  1WA9 A;  5J3W A;  3F1P A;  4GW9 A;  3B33 A;  3H82 B;  2D02 A;  2J80 A;  1OT6 A;  4EEP A;  1S67 L;  3PHY A;  3E4P A;  1TS8 A;  2L1M A;  1DP8 A;  2PDR A;  1ODV A;  5DJU A;  2K7S A;  4HJ4 A;  3MQO A;  4PKY A;  3K3C A;  2HV1 A;  5F69 A;  4WLA A;  3LIB A;  2VV8 A;  4EES A;  4F3L A;  2A24 A;  3RH8 B;  3LI8 A;  4HH2 A;  2L4R A;  1DP9 A;  4JGR A;  3D72 A;  4H6J B;  3IS2 A;  3FG8 A;  1OT9 A;  4I3I A;  3NOP C;  1T18 A;  4EQ1 A;  4LRX C;  4F3L B;  4HQA A;  2EA9 A;  5TBM A;  3HJI A;  2OOL A;  1VB6 A;  4GS9 B;  4L9F A;  2PHY A;  2WKP A;  2KX6 A;  3CAX A;  1S4S A;  3IS2 B;  2OWJ A;  2W0N A;  3E4Q A;  2V1A A;  1LSX A;  5DKL A;  4NXG A;  5HSQ A;  3OLO A;  3KX0 X;  1DP6 A;  4EER A;  1D06 A;  2B02 A;  1BYW A;  2D01 A;  4NXF A;  5F5Y A;  5KIZ A;  4HY8 A;  5AVE A;  4LRZ E;  1GSX A;  5DKK A;  4HH3 A;  1LL8 A;  3BWL A;  5HWV A;  3IBR A;  2YKH A;  3H7W B;  4NXB A;  4I38 A;  1UGU A;  5HWT A;  5J7E A;  3NJA A;  4EEU A;  4NXE A;  2P7J A; 
#chains in the Genus database with same CATH topology
 1T1B A;  3MR0 A;  1N9O A;  4GLQ A;  2XDM A;  5A8B A;  4DKI A;  1I5Q A;  2O0Y A;  1PRQ A;  2ZC4 B;  5DFX A;  1G6O A;  3IWQ A;  3T1R A;  3VSK A;  3GR2 A;  4HI4 A;  3SZT A;  2ZMV A;  3FKV A;  1VHM A;  3PBS A;  2R78 A;  1HVB A;  1N9N A;  2GNX A;  4KQD A;  3P7N A;  3GMW A;  4DJ3 A;  5FAS A;  4S2P A;  1V9Z A;  3O3V A;  4PHT A;  5F68 A;  3Q7Z A;  4B9O A;  3E98 A;  4WF0 A;  1K25 A;  1YSQ A;  3PBR A;  2V8C A;  4DE3 A;  4I3A A;  3F1O B;  3FC7 A;  1S1Z A;  4LV0 A;  3BW6 A;  4Y15 A;  1GA9 A;  1NRJ A;  1RCJ A;  1XA1 A;  1BLC A;  4FH4 A;  4BBT A;  4E3J A;  3Q81 A;  3A3I A;  2QJ5 A;  4JF4 A;  1KE3 A;  4F94 A;  1NLY A;  1HLU P;  2ZC7 A;  4BBV A;  1CI9 A;  2PU4 A;  4K0W A;  3FWL A;  4S2K A;  4IUH A;  4RA7 A;  3EQV A;  5CTM A;  4U3T A;  4JKT A;  4OQ0 A;  4JGQ A;  4FSF A;  4KZ7 A;  3NEC A;  4KEN B;  4Z9Q A;  1NRF A;  3C2W A;  3H7W A;  3UB6 A;  4ZDX A;  3V5M A;  1Y4O A;  3HUN A;  1CEG A;  2Q9M A;  1TS6 A;  5CHU A;  4EUZ A;  3BFE A;  2WUQ A;  3F1N A;  4KG2 A;  1SZV A;  3WS0 A;  4RQ9 A;  2EX2 A;  4HIA A;  1MWR A;  1VEU B;  1L0G A;  1VET A;  4L9G A;  2WAE A;  2ZOH A;  4JLF A;  1TS7 A;  5DFY A;  1CF0 A;  1FR1 A;  1VQQ A;  4P85 A;  2PAV P;  2Y2P A;  1DJA A;  4OOL A;  1IYO A;  5IS1 A;  4MMN A;  1RP5 A;  1W5D A;  4KQQ A;  2DMW A;  3GRJ A;  2H28 A;  4X55 A;  2IWC A;  4R4R A;  4UA7 A;  4R70 A;  5JYO A;  3C7U A;  5CER A;  4B4X A;  3ZQ5 A;  3LEQ A;  4E3L A;  4MCW A;  3CIT A;  3DWZ A;  5GHX A;  3G31 A;  4E6W A;  4P87 A;  1PWD A;  3PBO A;  1TVF A;  2Y2M A;  2WKQ A;  2P9V B;  5GLC A;  4R3J A;  4MN5 A;  3F1P B;  2IWB A;  2ZQ8 A;  1PZP A;  4BBU A;  3MBZ A;  2WGW A;  2ZOI A;  2VLG A;  5F83 A;  2VV6 A;  1T19 A;  3IF6 C;  2J9O A;  1OTI A;  1LLB A;  1PW1 A;  3CUE C;  3ISG A;  3S7P A;  3GVB A;  4OP5 A;  1RGZ A;  2PD8 A;  4OQH A;  2VGJ A;  1K6R A;  4DXB A;  2QWS A;  5DTK A;  3B3X A;  2XA7 S;  1ERQ A;  2A3U A;  4P6Z M;  3EEH A;  5KZH A;  3W4Q A;  1OJG A;  3WS2 A;  4IVK A;  2PYR A;  2ZL1 A;  5FAO A;  1PIO A;  5L8M A;  1PW8 A;  5FQM A;  2H0T A;  3C4O A;  4UQI M;  3UME A;  1BT5 A;  1G6A A;  3TRC A;  2I72 A;  4II7 A;  4GZB A;  4WM9 A;  1QME A;  3VP1 A;  3OPH A;  3NOT C;  5I5L A;  1GSW A;  2HDS A;  2JHE A;  1ES3 A;  5FQI A;  3H82 A;  4PMA A;  2V0W A;  3UB7 A;  1ACF A;  1E3U D;  2ZM0 A;  3BEC A;  4Y2F A;  3E0Y A;  3CUE A;  5F6A A;  1KDW A;  1OTE A;  2Y91 A;  4GD6 A;  2KOI A;  3A0R A;  3KYZ A;  4EU0 A;  3JVU A;  4YIN A;  4MBK A;  5HL1 A;  3UPN A;  2ZQ7 A;  1Q2Q A;  5EOE A;  3LYX A;  4K91 A;  4U0X A;  3LI9 A;  2R9X A;  1WA9 A;  1IOU A;  2EXB A;  5J3W A;  3Q82 A;  4DN0 A;  2RCX A;  3AGF A;  1OT6 A;  3N8R A;  3NIA A;  3PHY A;  1K55 A;  2K31 A;  3G2Z A;  2ZQA A;  3SS4 A;  5E2E A;  1DP8 A;  1FCM A;  3HLB A;  5GHY A;  4GOG A;  4WEL A;  5DJU A;  3BRM A;  3D9Y A;  3ZVW A;  1MWU A;  3LO7 A;  2K7S A;  4HJ4 A;  5A93 A;  1H8Z A;  3CZD A;  3CPT B;  4R1G A;  1SHV A;  4R0Q A;  2X01 A;  5L2F A;  4UAA A;  3S4X A;  1XKZ A;  1W63 Q;  3S7N A;  3OPP A;  4IVI A;  3R7W A;  5F1F A;  4GDN A;  5C5K A;  4Y0O A;  4WZ5 C;  2WYX A;  1OT9 A;  4I3I A;  1JTG A;  4QPR A;  1YMS A;  4JF5 A;  4EQ1 A;  4K0X A;  4O01 A;  3MKF A;  3NY4 A;  4LRX C;  3BYD A;  4CPK A;  3DTE A;  4Q0J A;  4F3L B;  4CQH A;  4HQA A;  3HLF A;  2JKT I;  2EA9 A;  3EEA A;  3HLG A;  2Y2O A;  5TBM A;  4IBX A;  3PBT A;  2QYB A;  1ALQ A;  3LY3 A;  4L9F A;  4Q0I A;  4X53 A;  2PHY A;  2KX6 A;  3CHW P;  3CAX A;  4FOF A;  3IS2 B;  4QB8 A;  3W2Z A;  3KO6 A;  4S2N C;  2V1A A;  2ZMA A;  4FD8 A;  2VJW A;  1BUE A;  1A0K A;  1BLS A;  5FDS A;  4EER A;  1DJC A;  3BFC A;  3SS3 A;  1Z09 A;  1BYW A;  4WMC A;  4NXF A;  1STZ A;  2KLI A;  1NZU A;  1Z6F A;  1YPR A;  5KIZ A;  1BLH A;  4LRZ E;  3UE0 A;  5D3O A;  3BWL A;  5HWV A;  2W1R A;  3H7W B;  3BFD A;  1UGU A;  4LV3 A;  4NK3 A;  5CGS A;  3NJA A;  1N4O A;  5DVA A;  2P7J A;  4NXE A;  3V50 A;  2YKF A;  1TEM A;  4YWZ A;  2MJ6 A;  4WBG A;  3MZD A;  1H8M A;  4NG2 A;  5EVE A;  4HJ6 A;  3F1N B;  1K54 A;  3AGE A;  2Y59 A;  3ZNT A;  2JC7 A;  1VET B;  1ERM A;  3LCE A;  2I9V A;  2V20 A;  4KUK A;  4G3W A;  3CLO A;  1L0F A;  1BZA A;  4ME4 A;  4NKP A;  3HLC A;  1MPL A;  1ZG4 A;  3P98 A;  4WN5 A;  4G3K A;  4E3N A;  4DE0 A;  2C5W B;  4P6B A;  5G4Z A;  3M6H A;  2JN7 A;  2XK1 A;  1XFN A;  3IHB A;  1YLY A;  4S2O A;  1ZG6 A;  1SKF A;  2GJ3 A;  2PR6 A;  3HRE A;  4MBF A;  1NWZ A;  5FQQ A;  1TD5 A;  4ZJ3 A;  5HD5 A;  4HOI A;  3UE6 A;  3UDI A;  5EV0 A;  3NC8 A;  3VOL A;  2BG1 A;  3W4O A;  1D7E A;  1D1J A;  4O8G A;  2XR0 A;  3LY4 A;  5HZH A;  1UWN X;  5EVI A;  4PKY G;  1XJ4 A;  2HP5 A;  5L07 A;  4BLM A;  4S2L A;  2EXA A;  3BY9 A;  3OCL A;  5HL6 A;  5U47 A;  2G7U A;  5FA7 A;  1E4D A;  2W3D A;  2QMI A;  2FH5 A;  4JBF A;  1TDG A;  4GHI A;  3O5Y A;  3ZG7 B;  3RFB A;  3Q07 A;  3V3R A;  2JBF A;  1KGE A;  2J7V A;  2UWX A;  2VGK A;  3A3J A;  3BQ8 A;  4IUK A;  1XGJ A;  2BAS A;  2ZL1 B;  5TR7 A;  3VE3 A;  2WKE A;  5AQ9 A;  3V67 A;  4GD8 A;  2VGL S;  4RX2 A;  1ESI A;  2A2L A;  2HF6 A;  3MS6 A;  4PM7 A;  3T4K A;  5DTT A;  2W27 A;  3MFX A;  2OV5 A;  2WKR A;  3N8L A;  4R4S A;  1DJB A;  1F98 A;  1XJ6 A;  3UMD A;  3DTK A;  1AWI A;  2Z2L B;  1HTZ A;  3IH9 A;  1SDN A;  1VM1 A;  2L0W A;  1S0W A;  3NDG A;  4HHD A;  1W63 M;  4I39 A;  1JWP A;  4B4Z A;  3CWF A;  5HD3 A;  1OTB A;  5HPF A;  3EGD C;  4OOY A;  4HBU A;  3L7H A;  3RXX A;  4BD0 A;  4KZ4 A;  2B95 A;  2E8J A;  3RTY A;  3LIF A;  1PI4 A;  1PNE A;  2B18 A;  5E2G A;  3QNB A;  3QP2 A;  3IX4 A;  2HPB A;  4DJ2 A;  1ZTU A;  3G2Y A;  2XD1 A;  5F1G A;  3BEB A;  1F9I A;  3GDI A;  1FR6 A;  4K08 A;  5GL9 A;  5I94 A;  1KE4 A;  4BMW A;  3BM6 A;  2CMN A;  3ITA A;  3W4P A;  4EW7 A;  5CGW A;  1E25 A;  2XFS A;  4XT2 A;  1XXM A;  4WL9 A;  3OPR A;  1W8Q A;  4GCZ A;  4AFI A;  1KGG A;  5FSR A;  1WE4 A;  3Q7V A;  2P74 A;  3UDX A;  3NHQ A;  3MXQ A;  3FZC A;  3K3D A;  2QKP A;  2Q9N A;  1LT0 A;  3OOV A;  5IHV A;  1BLP A;  1YLW A;  1G28 A;  3PAE A;  3R7W B;  1K4E A;  3P09 A;  4Q8I A;  4KQR A;  2O99 A;  3SH7 A;  3Q1F A;  4PM8 A;  3LIA A;  4KZ8 A;  5TJJ A;  4OPY A;  1MC0 A;  1ZKJ A;  4XUZ A;  4Y0U A;  2ZM8 A;  4IJG A;  3ZFZ A;  4RVA A;  3LR0 A;  1K56 A;  3M2J A;  5BOH A;  2Y2J A;  3JPU A;  5TBM B;  2Y8H A;  5GHZ A;  2J9P A;  2V0U A;  3K2N A;  3O86 A;  4EXO A;  1L0D A;  1ERO A;  4GW9 A;  1H8Y A;  4OH0 A;  1MBL A;  1S67 L;  4JXV A;  3ZYT A;  1PYY A;  4GDB A;  4A5R A;  1E3U A;  1ODV A;  3IXG A;  4E3O A;  3LGO A;  3AGD A;  2OLU A;  3NI9 A;  3IWO A;  4XXR A;  5FAT A;  4HES A;  2M7U A;  3HLW A;  3QP5 A;  3T1S A;  2X02 A;  1YLZ A;  2HV1 A;  3UDF A;  4KZ3 A;  5EOO A;  4OKP A;  2A24 A;  3HBR A;  1ES4 A;  3RH8 B;  3LI8 A;  2L4R A;  5E43 A;  5FQ9 A;  2W3G A;  2EX9 A;  2WZX A;  3A3F A;  4JXW A;  4JGR A;  1IYP A;  2Y2Q A;  5TFQ A;  2XRN A;  2ZM2 A;  3WRT A;  1EWZ A;  2H10 A;  1ONG A;  3O88 A;  4OQI A;  4OOM A;  2BTF P;  5DTS A;  5FEG A;  1TDL A;  1YT4 A;  4ARZ A;  2NUP C;  5J8X A;  3E2K A;  2XH9 A;  4UEY A;  4Y13 A;  3BLM A;  2CC1 A;  4DF6 A;  4KZ5 A;  1F2K A;  4X68 A;  1I2W A;  2O9B A;  4C75 A;  4P6Z S;  2OWJ A;  4ETZ A;  1BTL A;  2W0N A;  3QP1 A;  5HFO A;  3E4Q A;  4CLC B;  2Y2N A;  5A91 A;  3IF6 A;  3JVV A;  4WEJ A;  2OAP 1;  3KX0 X;  4UQI S;  1SKO A;  2FZ0 A;  3BLS A;  1D06 A;  2D01 A;  2PBY A;  4HY8 A;  4GN2 A;  4E3K A;  5AVE A;  4EWF A;  3T4L A;  3V39 A;  5DKK A;  2W1T A;  4HH3 A;  3ZG9 B;  4QD4 A;  1LL8 A;  4XUX A;  4X25 A;  3IBR A;  3EQU A;  4PPR A;  2YKH A;  5EVI B;  3QP6 A;  1H3Q A;  2HJ9 C;  4EEU A;  4BWI A;  2J3T C;  3F1O A;  4ESP A;  2VA0 A;  2Z6D A;  3PAG A;  1S1Y A;  4GHI B;  1S4R A;  1XJ2 A;  1SCW A;  3ZDJ A;  2QHK A;  2ZBB A;  4L9E A;  1LL9 A;  3ITB A;  3TW8 A;  3PBQ A;  3LUQ A;  1UWP X;  2W3F A;  1K57 C;  5DJT A;  5GLB A;  3SOI A;  2ZD8 A;  1NJ4 A;  2V9A A;  2EX8 A;  1FCN A;  5CTN A;  1CI8 A;  4KG5 A;  5CHJ A;  3TE8 A;  4I3J A;  4GS9 A;  3HVF A;  1Y54 A;  3IBJ A;  4KZ6 A;  3UE3 A;  2P08 A;  5EM1 A;  1YAX A;  3LR4 A;  2WK0 A;  1LI9 A;  4ZRR A;  4BL2 A;  2C6W B;  4JXS A;  3MFD A;  4FUW A;  3S22 A;  2VZW A;  3A3D A;  1K0K A;  3TSG A;  1NZO A;  1OJ5 A;  2JKT M;  3ZCZ A;  1PI5 A;  3HCY A;  2ZQD A;  1K6S A;  4YFM A;  1IKI A;  2IA2 A;  4RX3 A;  1K57 A;  1W7F A;  3SH9 A;  2E8I A;  1MXO A;  3G32 A;  1VEU A;  5M18 A;  3FYZ A;  2ZQC A;  5AVF A;  3UNW A;  2M1C A;  1G68 A;  3MF0 A;  3S7O A;  3ZGA B;  3W8K A;  4EBP A;  1M40 A;  3T4O A;  4WZ5 A;  3B42 A;  3A0V A;  5FAP A;  4EET B;  3LR5 A;  1XFQ A;  4D60 A;  3IT9 A;  1V9Y A;  2EWW A;  1T1A A;  4X1L A;  1JNU A;  5TGF A;  2LB5 A;  3WS1 A;  5A92 A;  1XP4 A;  2WGI A;  3VE4 A;  1MKI A;  2GX5 A;  2DNS A;  5HAR A;  3VV4 A;  3ZVT A;  3E2L A;  1IKG A;  2V8F A;  2J3T D;  4OVD A;  5M19 A;  2XLN A;  4S2N A;  1TF1 A;  2PR5 A;  2V1Z A;  1ONH A;  2Q0O A;  3EGX C;  3P01 A;  5CXW A;  1MZU A;  3WS4 A;  2WAF A;  3BY8 A;  4OLD A;  4OLG A;  2WAD A;  3U4L P;  4BQM A;  3BQA A;  2VK3 A;  3MQQ A;  2Y2H A;  4P0M A;  3WS5 A;  4X6T A;  1M6K A;  4KZA A;  4DE1 A;  3TG9 A;  3VP3 A;  4GB7 A;  4CLC C;  2K2N A;  3OCN A;  1G5U A;  3QHY A;  5GLD A;  3VFH A;  2Z6C A;  4D2O A;  1XX2 A;  1Y28 A;  3M2K A;  2V1B A;  2HJE A;  2VV7 A;  3UN7 A;  3IWI A;  1ES2 A;  1JTD A;  5L10 A;  3T4S A;  4MN7 A;  5IU1 A;  4U0T A;  3T12 B;  3TJZ C;  2XFT A;  1WYC A;  4CLC E;  4QWO A;  5FQJ A;  4GNU A;  3N6I A;  5FI6 A;  2JKR I;  3DTI A;  2O9A A;  3C8C A;  2ZC6 B;  4ZJ2 A;  4MN6 A;  3VFF A;  4S2M A;  1XGI A;  3HJK A;  3RXW A;  1DRM A;  2H5S A;  1O07 A;  2ZC5 B;  4HP4 A;  1EW0 A;  3E4O A;  4G3V A;  3MJQ A;  3IX8 A;  2VX8 A;  4BD1 A;  3OBF A;  4IHQ A;  3I7J A;  2A24 B;  3VOY A;  2WGW B;  5HPI A;  3ZHH A;  2WZZ A;  3MXR A;  5HDD A;  2R9W A;  4S2I A;  4HP9 A;  4KUO A;  3DBA A;  3MXS A;  3FV7 A;  4E04 A;  3VP2 A;  4DXC A;  2OAQ 1;  5EPH A;  3T4J A;  4WZ4 A;  3CG5 A;  4O0P A;  5G4Y A;  3A0S A;  1Q2P A;  4N92 A;  5L09 A;  4I5S A;  4M4X A;  4ARZ B;  3EWK A;  4DMZ A;  3UB8 A;  5HWW A;  3C7V A;  5FI2 A;  3HUO A;  2HZ5 A;  1P97 A;  4Y3I A;  3DAV A;  1U60 A;  4JPM A;  3ZNY A;  4KG6 A;  3GSG A;  3VP4 A;  5G18 A;  5AJG A;  3VP0 A;  3KSI A;  3H82 B;  2XSS A;  5M1A A;  2J80 A;  3IF6 B;  5EVL A;  1KGF A;  4KZ9 A;  1OPX A;  2XEP A;  1CQA A;  1W79 A;  1H5X A;  3PBN A;  4CLC D;  1PZO A;  4ETX A;  3IHA A;  1N9B A;  1K38 A;  3GV9 A;  5FDH A;  3UE1 A;  4BJP A;  2WKI A;  4Y5F A;  5AQA A;  1H0M A;  5DF8 A;  2JKF A;  4LV2 A;  2W1T B;  2G2U A;  1FQG A;  1WYB A;  5F69 A;  3NCK A;  2WGV A;  2VV8 A;  4EES A;  4F3L A;  1BUL A;  4YNR A;  3BFF A;  1JWZ A;  4HH2 A;  4QU3 A;  1PWG A;  2HGV A;  3MMH A;  1CK3 A;  2PRF A;  5EVI D;  1YLT A;  1YQS A;  1DP9 A;  4GJ4 A;  1YSP A;  1IFQ A;  2Y2G A;  3IF5 A;  3A3E A;  3WWX A;  3IS2 A;  3FG8 A;  3SH8 A;  3ZG5 A;  1KVM A;  4RYE A;  3CMZ A;  1T18 A;  5HX9 A;  2JKG A;  2XGN A;  1P9R A;  4QJG A;  4NET A;  2PU2 A;  3HJI A;  2OOL A;  1VB6 A;  4EQI A;  4GS9 B;  2XD5 A;  1PWC A;  2EX6 A;  1J9M A;  1BSG A;  1S4S A;  4MNR A;  4PM6 A;  2GDN A;  4DE2 A;  4EBL A;  4MEZ A;  1LSX A;  5HSQ A;  3OLO A;  2Y2L A;  4LCL A;  5FEF A;  3DW0 A;  1DP6 A;  1GHP A;  3UO9 A;  3T1Q B;  4H8R A;  5FL3 A;  2XRO A;  3PXP A;  5LBR A;  4E3I A;  5F5Y A;  1ZHH B;  4L0L A;  4OON A;  5DF9 A;  2DRW A;  5EEC A;  1HZO A;  1GSX A;  3HL9 A;  3JYI A;  3G34 A;  3N7W A;  4QY6 A;  5E2F A;  3MZF A;  3G30 A;  2J8Y A;  1L3L A;  4NXB A;  1XA7 A;  1QMF A;  5HWT A;  4WEK A;  4KQO A;  2Y79 A;  1KVL A;  2Y55 A;  5HW3 A;  2VEA A;  2PYP A;  1OTD A;  3OC2 A;  3QNC A;  4H6J A;  3KSF A;  5HDC A;  4B93 A;  2AVX A;  4ID4 A;  1MWS A;  4B88 A;  3VOZ A;  2LB9 A;  3G35 A;  1N9L A;  3MKE A;  5CHM A;  3NOU C;  2PD7 A;  1KDS A;  4HJ3 A;  4Y7P A;  4R38 A;  4UA6 A;  1SDE A;  2HDU A;  1I2S A;  2QPN A;  1RGY A;  5K5B A;  1OME A;  3UPO A;  1FSY A;  4HBT A;  1IYS A;  4OP8 A;  3KSH A;  3O87 A;  4ZBE A;  3LIC A;  1L0E A;  4JF6 A;  3GEC A;  2XA7 M;  1T1C A;  2Z2M B;  1OTA A;  2OSU A;  1P9W A;  3T4T A;  5JYP A;  4C6Y A;  4R6L A;  1AXB A;  1XJ3 A;  1C3B A;  3ICY A;  2M7V A;  4EBN A;  2PT7 A;  3H9W A;  2ZQ9 A;  4N9K A;  4C3Q A;  3MZE A;  3GQZ A;  1K56 D;  3FKW A;  5DF7 A;  3N8S A;  4FTX A;  5EFW A;  1X0O A;  1YMX A;  3KSG A;  2KDK A;  3OPL A;  4FH2 A;  4MDZ A;  1DY6 A;  1FIK A;  2Y2K A;  1LL5 A;  4IBR A;  1NLZ A;  4NEE D;  2ZLY A;  1ZC2 A;  2JE5 A;  4ZTK A;  2HP9 A;  3B47 A;  3CI6 A;  4DDS A;  4UA9 A;  1NYM A;  5F82 A;  1K55 C;  3R4K A;  1JVJ A;  4QY5 A;  4LGW A;  4Q0H A;  1NYY A;  1HD8 A;  5CGX A;  1IEL A;  3SS5 A;  3PYP A;  3HUM A;  1FIL A;  2HP6 A;  3IXH A;  3LFV A;  1XPB A;  3D4F A;  2FFY A;  3U2A A;  4E6X A;  3T50 A;  4E3M A;  1FSW A;  2UV0 E;  4CJN A;  1LHY A;  3TOI A;  4R3A A;  4HEF A;  5CED A;  4JGO A;  4OPZ A;  4EUV A;  1MY8 A;  1IYQ A;  2P04 A;  4EV4 A;  1F5M A;  2IWD A;  5CEB A;  5AQ7 A;  3QP8 A;  2ZC3 B;  1ES5 A;  2JCH A;  4IED A;  3G4P A;  3G6O A;  1YLP A;  2G2W A;  1P0Z A;  5EUA A;  4Z1W A;  3LID A;  5IT5 A;  3UY6 A;  4LCM A;  1GSV A;  2ZMF A;  4PM5 A;  3DWK A;  2DCF A;  1S6R A;  4X69 A;  2Y2I A;  3RJU A;  2V2F F;  3MQ0 A;  5HAI A;  2PBD P;  4KZB A;  1S66 L;  1O7E A;  2WKH A;  2XF3 A;  4LPZ A;  4LLO B;  3UPP A;  5KSC A;  3V3S A;  4FCF A;  3IH8 A;  4X56 A;  3S1Y A;  4JXG A;  1YM1 A;  2BLS A;  2QJ7 A;  3FPW A;  1KOU A;  3ULF A;  4JGP A;  3IQA A;  3SW1 A;  3BJN A;  3LR3 A;  4UHU A;  5HDS A;  3LEZ A;  5CX7 A;  4ZJ1 A;  3LIE A;  1LSW A;  4HNB A;  5AQB A;  1LSV A;  4X1M A;  5HAQ A;  2INW A;  4BL3 A;  5EE8 A;  3WRZ A;  1NY0 A;  1EI5 A;  5EM0 A;  2O9C A;  5CEC A;  4LRY C;  1J3W A;  3UB9 A;  3PTE A;  4XT2 B;  4N1X A;  1GHI A;  4YOF A;  3D3O A;  2Y4A A;  3OZH A;  2NUT C;  3Q7V B;  3NUL A;  1TS0 A;  2X71 A;  1K54 C;  2FFF B;  3C30 A;  4N1H A;  2OWH A;  2XQZ A;  2GZA A;  5MC7 A;  4WUJ A;  3C4P A;  1YLJ A;  3T1X A;  1PFL A;  5J4E A;  4N9L A;  1ESU A;  4LFU A;  2P9V A;  4MBH A;  3DTM A;  3F1P A;  2QZ6 A;  3B33 A;  2D02 A;  2ZJ9 A;  1KE0 A;  4PAU A;  2H0Y A;  3ZG8 B;  1JWV A;  4EEP A;  3MSH A;  3E4P A;  1TS8 A;  3C38 A;  2HDR A;  4M3K A;  1GHM A;  4R3B A;  3C5A A;  2L1M A;  5FAQ A;  2PDR A;  1L2S A;  3KYQ A;  3BFG A;  5KMW A;  4S2J A;  3MQO A;  4PKY A;  3HLD A;  2W3H A;  3QP4 A;  3K3C A;  3IXD A;  3CJM A;  1CEF A;  2W3E A;  4WLA A;  3LIB A;  1IEM A;  1MKM A;  2EWV A;  2JKR M;  1GCE A;  2EFX A;  4ZAM A;  2ACG A;  3HLE A;  5EVI C;  3N4I A;  3S7Q A;  1NXY A;  5FQK A;  3D72 A;  3PR6 A;  4MLL A;  5A90 A;  4H6J B;  3NOP C;  3IXB A;  4CLC A;  3EOI A;  4WMC D;  1YKD A;  4OPQ A;  4R23 A;  3IX3 A;  4PM9 A;  4Y17 A;  5FI7 A;  4WYY A;  5KSH A;  2J3W A;  3VMA A;  4OPR A;  2A49 A;  3ZG0 A;  3VSL A;  3FPV A;  3KYE A;  2RL3 A;  1FCO A;  4QHC A;  3GTC A;  5E2H A;  2WKP A;  3UB5 P;  4DDY A;  1W8Y A;  5HAP A;  1MWT A;  4Y0T A;  4O7D A;  4GKU A;  4NXG A;  5DKL A;  1LI0 A;  1CJF A;  2VGL M;  5CRF A;  2B02 A;  1FOF A;  2EFU A;  4DRT A;  2VKS A;  2HDQ A;  3M6B A;  4OQG A;  3L9K A;  4LV1 A;  2B5R A;  3CPT A;  1K4F A;  1GA0 A;  4I38 A;  3NBL A;  4LEN A;  3T4Q A;  5GLA A;  5J7E A;  2OLV A;  4BEN A;  3NDE A;  1SKO B; 
#chains in the Genus database with same CATH homology
 2J3T C;  1T1B A;  3F1O A;  3MR0 A;  2VA0 A;  1N9O A;  2YKF A;  2Z6D A;  4GLQ A;  5A8B A;  1S1Y A;  4YWZ A;  4GHI B;  2MJ6 A;  2VEA A;  2PYP A;  1OTD A;  3OC2 A;  2O0Y A;  1S4R A;  1XJ2 A;  1H8M A;  4H6J A;  3KSF A;  5HDC A;  4B93 A;  4HJ6 A;  3F1N B;  5DFX A;  1G6O A;  2LB9 A;  2QHK A;  2ZBB A;  4L9E A;  1N9L A;  3NOU C;  3PBQ A;  2PD7 A;  3LUQ A;  4HJ3 A;  4HI4 A;  3TW8 A;  2ZMV A;  1VHM A;  1UWP X;  2W3F A;  2R78 A;  3PBS A;  1N9N A;  5DJT A;  2GNX A;  4KQD A;  3P7N A;  2I9V A;  4DJ3 A;  1V9Z A;  2V9A A;  4PHT A;  4R38 A;  5F68 A;  4B9O A;  4KUK A;  3E98 A;  4WF0 A;  1YSQ A;  4G3W A;  3CLO A;  3PBR A;  5K5B A;  3TE8 A;  4ME4 A;  4I3J A;  4I3A A;  4NKP A;  4GS9 A;  3F1O B;  3FC7 A;  1S1Z A;  3IBJ A;  3BW6 A;  4WN5 A;  4G3K A;  3UE3 A;  3KSH A;  1NRJ A;  2P08 A;  3LIC A;  1YAX A;  3LR4 A;  4BBT A;  3GEC A;  2XA7 M;  1T1C A;  4ZRR A;  5G4Z A;  1OTA A;  2QJ5 A;  1P9W A;  2VZW A;  3T4T A;  1NLY A;  2JN7 A;  4BBV A;  1XFN A;  4R6L A;  1XJ3 A;  1OJ5 A;  2JKT M;  3ICY A;  2M7V A;  2GJ3 A;  2PT7 A;  3H9W A;  4IUH A;  2PR6 A;  3HCY A;  1NWZ A;  1TD5 A;  3EQV A;  2IA2 A;  4HOI A;  5HD5 A;  3UE6 A;  3VOL A;  4JGQ A;  1D7E A;  5EFW A;  1X0O A;  4FSF A;  3KSG A;  4O8G A;  2KDK A;  5AVF A;  4MDZ A;  2M1C A;  3MF0 A;  3S7O A;  5HZH A;  3C2W A;  1UWN X;  3H7W A;  1NLZ A;  3UB6 A;  4NEE D;  4PKY G;  1XJ4 A;  3T4O A;  3BY9 A;  3OCL A;  5HL6 A;  3B47 A;  2G7U A;  3B42 A;  3A0V A;  3CI6 A;  4EET B;  2W3D A;  3R4K A;  3LR5 A;  1XFQ A;  2FH5 A;  1TS6 A;  4GHI A;  3O5Y A;  1V9Y A;  3RFB A;  2EWW A;  1T1A A;  1JNU A;  2LB5 A;  3F1N A;  4Q0H A;  4RQ9 A;  4HIA A;  3VE4 A;  3BQ8 A;  3PYP A;  4L9G A;  4IUK A;  2BAS A;  2GX5 A;  3LFV A;  2ZOH A;  3VE3 A;  3U2A A;  1TS7 A;  3V67 A;  3VV4 A;  5DFY A;  2VGL S;  3T50 A;  4R3A A;  4OOL A;  2A2L A;  2HF6 A;  2J3T D;  4JGO A;  1TF1 A;  2PR5 A;  5IS1 A;  4MMN A;  3T4K A;  4EUV A;  3P01 A;  3EGX C;  1MZU A;  2W27 A;  3BY8 A;  2P04 A;  2DMW A;  2H28 A;  3MFX A;  3BQA A;  3MQQ A;  2WKR A;  4R70 A;  1F5M A;  1F98 A;  1XJ6 A;  3UMD A;  3ZQ5 A;  4MCW A;  4CLC C;  2K2N A;  3CIT A;  3OCN A;  2Z6C A;  2L0W A;  3G6O A;  1Y28 A;  4HHD A;  2V1B A;  1W63 M;  2HJE A;  2VV7 A;  4I39 A;  1P0Z A;  3PBO A;  3CWF A;  5HD3 A;  1OTB A;  5HPF A;  3EGD C;  4Z1W A;  3LID A;  3T4S A;  4MN7 A;  5IT5 A;  2WKQ A;  5IU1 A;  1GSV A;  4MN5 A;  2ZMF A;  3LIF A;  3F1P B;  3RTY A;  3TJZ C;  4BBU A;  4CLC E;  2B18 A;  2ZOI A;  4DJ2 A;  2VLG A;  1ZTU A;  3MQ0 A;  2VV6 A;  2JKR I;  1S66 L;  1F9I A;  3GDI A;  4K08 A;  1T19 A;  2O9A A;  4BMW A;  1OTI A;  3CUE C;  2CMN A;  3S7P A;  3C8C A;  4LLO B;  4LPZ A;  4EW7 A;  4MN6 A;  4XT2 A;  2PD8 A;  4WL9 A;  3HJK A;  1DRM A;  2QWS A;  2XA7 S;  3FPW A;  2QJ7 A;  1KOU A;  4GCZ A;  4HP4 A;  3ULF A;  1EW0 A;  3EEH A;  3E4O A;  4G3V A;  4JGP A;  4P6Z M;  4AFI A;  3SW1 A;  3MJQ A;  2VX8 A;  3BJN A;  3NHQ A;  3MXQ A;  3LR3 A;  1OJG A;  3OBF A;  5HDS A;  2PYR A;  5L8M A;  3K3D A;  4IHQ A;  2QKP A;  2A24 B;  5CX7 A;  1LT0 A;  3OOV A;  3LIE A;  1LSW A;  4HNB A;  4UQI M;  3UME A;  1LSV A;  5HPI A;  2INW A;  3TRC A;  1G28 A;  3R7W B;  4II7 A;  5HDD A;  2O99 A;  4HP9 A;  4KUO A;  2O9C A;  4LRY C;  3UB9 A;  3DBA A;  3NOT C;  4XT2 B;  5I5L A;  1GSW A;  2JHE A;  3LIA A;  5TJJ A;  4E04 A;  3H82 A;  2V0W A;  1MC0 A;  3UB7 A;  2OAQ 1;  4Y2F A;  3E0Y A;  3CUE A;  5F6A A;  4YOF A;  3T4J A;  1OTE A;  3D3O A;  2NUT C;  4O0P A;  5G4Y A;  3A0S A;  4IJG A;  2KOI A;  1TS0 A;  3A0R A;  3C30 A;  4I5S A;  3KYZ A;  4EU0 A;  2OWH A;  4M4X A;  4ARZ B;  2GZA A;  3EWK A;  3JVU A;  3LR0 A;  4DMZ A;  4WUJ A;  5MC7 A;  3UB8 A;  5HWW A;  5TBM B;  1P97 A;  2Y8H A;  4Y3I A;  2V0U A;  5J4E A;  3K2N A;  3LYX A;  4EXO A;  3LI9 A;  1WA9 A;  1IOU A;  5AJG A;  5J3W A;  3F1P A;  3KSI A;  4GW9 A;  4DN0 A;  3B33 A;  3H82 B;  2D02 A;  2XSS A;  2J80 A;  4PAU A;  1OT6 A;  1OPX A;  4EEP A;  1S67 L;  3PHY A;  2K31 A;  3ZYT A;  3E4P A;  3PBN A;  1TS8 A;  4CLC D;  3C38 A;  4ETX A;  2L1M A;  1DP8 A;  2PDR A;  1ODV A;  4WEL A;  5DJU A;  3KYQ A;  4BJP A;  2K7S A;  4HJ4 A;  3MQO A;  4PKY A;  2W3H A;  4Y5F A;  3K3C A;  2M7U A;  2W1T B;  2W3E A;  2HV1 A;  5F69 A;  4WLA A;  3LIB A;  2VV8 A;  1MKM A;  4EES A;  4F3L A;  2A24 A;  2EWV A;  2JKR M;  3RH8 B;  3LI8 A;  4YNR A;  4HH2 A;  2L4R A;  1W63 Q;  2W3G A;  2HGV A;  3S7N A;  3MMH A;  3R7W A;  1DP9 A;  4GJ4 A;  5C5K A;  1YSP A;  1IFQ A;  4JGR A;  3S7Q A;  3D72 A;  3PR6 A;  2XRN A;  3IS2 A;  4H6J B;  3FG8 A;  1OT9 A;  4I3I A;  3NOP C;  4CLC A;  3EOI A;  4QPR A;  4OOM A;  1YKD A;  1T18 A;  4EQ1 A;  4O01 A;  5KSH A;  2J3W A;  1P9R A;  4LRX C;  4Q0J A;  4F3L B;  4CQH A;  4HQA A;  3FPV A;  4ARZ A;  2NUP C;  2JKT I;  2EA9 A;  3EEA A;  5TBM A;  3HJI A;  2OOL A;  3PBT A;  1VB6 A;  4UEY A;  4GS9 B;  2QYB A;  4L9F A;  4Q0I A;  2PHY A;  2O9B A;  2WKP A;  2KX6 A;  3CAX A;  4FOF A;  1S4S A;  3IS2 B;  4P6Z S;  2OWJ A;  3W2Z A;  4ETZ A;  2W0N A;  3KO6 A;  4CLC B;  3E4Q A;  2V1A A;  1LSX A;  5DKL A;  4NXG A;  5HSQ A;  3JVV A;  2VJW A;  3OLO A;  4WEJ A;  2OAP 1;  3KX0 X;  1DP6 A;  4UQI S;  2FZ0 A;  4EER A;  2VGL M;  1D06 A;  2B02 A;  5FL3 A;  2XRO A;  1BYW A;  2D01 A;  3PXP A;  2VKS A;  4NXF A;  5LBR A;  5F5Y A;  1STZ A;  1ZHH B;  2KLI A;  4L0L A;  5DF9 A;  5KIZ A;  4HY8 A;  5AVE A;  4LRZ E;  3T4L A;  1GSX A;  5DKK A;  2W1T A;  4HH3 A;  1LL8 A;  3BWL A;  5HWV A;  3IBR A;  3EQU A;  2W1R A;  2YKH A;  3H7W B;  4NXB A;  4I38 A;  1UGU A;  5HWT A;  3T4Q A;  4WEK A;  5J7E A;  4KQO A;  3NJA A;  1H3Q A;  2HJ9 C;  4EEU A;  4BWI A;  2Y79 A;  4NXE A;  2P7J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...