3LI9A

Crystal structure of the extracellular domain of the putative histidine kinase mmhk1s-z2
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
262
structure length
262
Chain Sequence
KLAYEKSIEMAGNYANQFDAQMEANQAIARTLACTMAEYGSQDREEAMSIIKRILNENPQLIGVYLGYEPDAFDGRDKNYINAPGHDSTGRFVPYCNKINGPVIIEPLVHYDSSDYYQLPKTTGKDTLTEPYFYEGIFMVSYDSPIFKNGEFAGIAGVDVPLEYVDDVASSIRTFDTGYAFMVSNTGIFLSHPTQKNWIGEKSLSDFDVEEIKNAASDIREGIGGHVEIKDPITGKTVIMFYEPVKTGDFSFVLVVPKEEML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical sensory transduction histidine kinase
publication title Structural characterization of the predominant family of histidine kinase sensor domains.
pubmed doi rcsb
source organism Methanosarcina mazei
molecule tags Signaling protein
total genus 69
structure length 262
sequence length 262
ec nomenclature
pdb deposition date 2010-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02743 dCache_1 Cache domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3li9A01
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3li9A02
3D72A 3FC7A 3H82B 3IS2A 2V1BA 4EERA 2PHYA 1V9YA 4R38A 3BWLA 4NXFA 4PKYA 3UB6A 3LICA 2KX6A 4HQAA 3MXQA 3K3DA 3HJKA 3PYPA 1XJ4A 4F3LB 1MZUA 4EETB 4HJ4A 2PDRA 2W27A 1X0OA 2GJ3A 2WKPA 1F98A 3KX0X 4LPZA 2YKHA 1S67L 5KIZA 1VB6A 2OWJA 4HNBA 5TBMA 5IU1A 1N9OA 4BBUA 5HDCA 4MN5A 2JHEA 3UB8A 5DJUA 3T50A 5HZHA 2QHKA 3VE4A 4HHDA 2QKPA 1DRMA 2QJ7A 3F1PA 4NXBA 3NOTC 3B33A 4K08A 1OJGA 1NWZA 1XJ3A 5DKLA 3NHQA 3GDIA 2V1AA 1S1YA 5G4YA 1GSVA 3A0VA 4LRZE 3LI8A 4H6JA 1OTEA 1OTAA 5AVEA 4E04A 4M4XA 2P7JA 4GS9A 4HP9A 2VLGA 1TS7A 2JN7A 5DKKA 4DJ3A 1XFNA 1P0ZA 4XT2A 3F1OB 4BBVA 4HY8A 3ICYA 4NXGA 4I3JA 4LRXC 3UMDA 1UWPX 4B9OA 4EW7A 3LYXA 1S4RA 4KUOA 1TS0A 2VEAA 2WKRA 3NOUC 4WN5A 4I39A 4EEUA 2B02A 3UB9A 4L9EA 3ZQ5A 4I3IA 1LSXA 3H7WB 4GHIA 1OT9A 2A24A 3MQOA 1T1AA 3C8CA 3HJIA 2J80A 2WKQA 3E4OA 1WA9A 3RH8B 1OTBA 1DP6A 1T18A 3MFXA 2VV7A 4JGPA 3CLOA 2VV8A 4WF0A 4EESA 1T1BA 1LSWA 3LIBA 2ZOIA 4I38A 5F5YA 3E4PA 4JGOA 3H82A 3BY8A 1GSWA 3F1PB 5F6AA 4JGRA 2ZOHA 4HJ3A 2K7SA 1LT0A 4LLOB 3MQQA 4F3LA 1S4SA 3A0RA 4HJ6A 2OWHA 3PHYA 4L9GA 4KQDA 4GS9B 5HDSA 2M1CA 4I5SA 1T19A 5J7EA 3VOLA 1OTIA 3F1NA 4XT2B 4HH3A 4MN6A 3BY9A 4NXEA 2VV6A 4JGQA 2D02A 3LUQA 1UGUA 1XJ6A 5DJTA 1TS6A 2KDKA 4GHIB 2R78A 3NJAA 3A0SA 4HI4A 3RTYA 4EXOA 1EW0A 2PYRA 1S66L 3IS2B 5J4EA 2PR5A 5HWVA 3LIFA 3CWFA 5AVFA 4PKYG 4LRYC 4EQ1A 3F1OA 3UE6A 1F9IA 3OLOA 2PR6A 2H28A 1UWNX 3EEHA 2PD8A 3LIAA 4RQ9A 5TBMB 1V9ZA 4WL9A 1ODVA 3LIDA 4R70A 1D7EA 5HWTA 4WUJA 4HP4A 2L4RA 3H7WA 4L9FA 3LI9A 1LL8A 1N9LA 1BYWA 4HH2A 4R6LA 1JNUA 2PYPA 3NOPC 2EA9A 2CMNA 4I3AA 3SW1A 3FG8A 1OJ5A 5J3WA 2L1MA 2PD7A 4YWZA 4H6JB 3EWKA 3E4QA 1G28A 3F1NB 5HD5A 1OT6A 3K3CA 4KUKA 5I5LA 1D06A 5A8BA 2BASA 1P97A 1T1CA 2QJ5A 1DP9A 3IBRA 1DP8A 2HV1A 4HOIA 1LSVA 4DJ2A 2D01A 5HD3A 4GW9A 3G6OA 5HDDA 1OTDA 3CAXA 3MJQA 2YKFA 1S1ZA 3UMEA 4EEPA 5F68A 5HSQA 1XJ2A 3UB7A 3H9WA 1TS8A 2INWA 2V9AA 2QWSA 2W0NA 2OOLA 3GECA 1XFQA 2L0WA 2A24B 2V0UA 2Z6CA 3LIEA 1Y28A 2Z6DA 5HWWA 5IS1A 1KOUA 4HIAA 1N9NA 3P7NA 5F69A 5EFWA 3VE3A 3C2WA 3MR0A 5G4ZA 4WLAA 2I9VA 4GCZA 4R3AA 4BBTA 3ULFA 2V0WA 2ZBBA 1GSXA
chains in the Genus database with same CATH superfamily
5EM0A 1XPBA 3FC7A 3V50A 1IEMA 2PHYA 3OCNA 4R38A 4NXFA 3UB6A 4PKYA 4DKIA 4NETA 3VP2A 1H3QA 3MXQA 3K3DA 5HPIA 3CITA 3OC2A 1K57C 4F3LB 1MZUA 2JBFA 4EETB 4HJ4A 1SKOB 4HESA 1X0OA 2EXBA 2EX2A 2GNXA 1ES2A 3C38A 1YMXA 1W8YA 4HNBA 2GDNA 4Z9QA 2HP9A 2BTFP 2XGNA 4WELA 2VX8A 4BBUA 4LCLA 3IWOA 2W1TB 3T4JA 2WZZA 3T50A 2QHKA 3VE4A 4ID4A 1PWCA 4GDBA 5MC7A 3OCLA 1BTLA 4NXBA 3B33A 3TE8A 3HLEA 1KE4A 2HJ9C 1C3BA 3GDIA 3R7WB 3L7HA 5J8XA 5G4YA 1GSVA 3A0VA 1P9RA 4GZBA 4E04A 2ZQDA 2WAEA 2QYBA 2P7JA 5EVIA 5FQMA 3DTIA 3VP1A 1GA0A 3UN7A 3G35A 2K31A 2JN7A 3HBRA 3UE3A 3OBFA 3IT9A 1JVJA 1FCMA 2XEPA 4BBVA 4HY8A 1VM1A 3WS2A 2EX8A 5C5KA 3ICYA 4I3JA 3UMDA 3MMHA 4C75A 5TFQA 4EW7A 1S4RA 2R9XA 2VEAA 1NLYA 3HUMA 4WN5A 3ZNTA 4K91A 2XF3A 3BLSA 4I3IA 4KZ7A 1LSXA 5DF9A 5L2FA 1K4FA 3MQOA 4EUVA 1K55C 3VSLA 3G34A 1PZPA 1BZAA 3EGXC 2Y2PA 2ZLYA 3BM6A 2XLNA 3U2AA 1BLPA 1N4OA 4II7A 4UA9A 3IF6A 2VK3A 2X02A 3CMZA 2WKQA 1WA9A 4OPYA 2K2NA 1GA9A 3Q82A 2WGWB 4IHQA 2VV7A 4JXGA 1KVMA 4WF0A 3VOZA 1K25A 3IQAA 3ZCZA 4I38A 2HDUA 5F5YA 4D60A 2Z2LB 1ZG6A 1Y54A 3BY8A 3QP1A 3ZDJA 1GSWA 2G2WA 4HBUA 4UQIM 5EOOA 4E3MA 1HVBA 4JF5A 5AQ7A 3KSHA 4HJ3A 4K0WA 4UA6A 2IWBA 1XA1A 2Y2OA 1MPLA 4PMAA 4DE0A 3TOIA 2FFYA 4KZ4A 3V3RA 3O86A 3WWXA 2HP6A 1K57A 2OWHA 3VFHA 5EUAA 2W3DA 5CTMA 4KQDA 2Y2IA 1CF0A 1SKFA 3LR4A 2W1RA 5FAQA 5FAOA 4S2OA 1OTIA 3F1NA 5F1GA 4K0XA 5DFXA 1IOUA 3UPNA 4DN0A 4XXRA 1SDNA 2W3GA 4NXEA 4QU3A 4OQIA 2H0TA 4JGQA 4UEYA 3EQUA 2D02A 3LUQA 1E3UA 2JKTI 4X1LA 5IHVA 4BLMA 1UGUA 4WZ5C 1XJ6A 3VMAA 2GX5A 4E3KA 4JPMA 5AJGA 1L0FA 2ZL1B 4P87A 3BLMA 3LEZA 3QP5A 4GHIB 5TR7A 5CHMA 2P04A 1NRJA 1PNEA 4DXCA 2Y2QA 2O0YA 1STZA 2VGLS 2ZC3B 2OLUA 1PFLA 3T1RA 1ZG4A 3MKFA 3OLOA 2E8JA 3WRTA 2H28A 5IT5A 3Q7ZA 4E6WA 3EEHA 3LIAA 3CZDA 3MZEA 4FD8A 5U47A 4LV3A 3Q7VB 3VSKA 5FDSA 4Q0IA 1NYYA 4OONA 3KYQA 1L0DA 4WUJA 2L4RA 3ISGA 2JKGA 3LI9A 1LL8A 2UV0E 1RCJA 4JXVA 1BYWA 3FWLA 5DTSA 1K55A 4BD1A 1JNUA 1IYOA 3QP2A 5DTKA 1HTZA 4WBGA 4DE3A 2CMNA 3MQ0A 2J7VA 5FI6A 1EROA 3ZG8B 4YWZA 1CJFA 1FQGA 1F5MA 2JKRM 3A3IA 3A3DA 3Q07A 3G32A 2XQZA 4ZDXA 2HJEA 3LO7A 1KE3A 2WKIA 1W63Q 2V2FF 4KUKA 2BASA 1P97A 3BFDA 2VGKA 1KGFA 2HGVA 1XXMA 4GW9A 4S2KA 1ZKJA 3V39A 4HEFA 3OPHA 4PM5A 3DW0A 5AQ9A 3T4OA 4OPZA 5HSQA 1MXOA 1XJ2A 4NK3A 1MWTA 4OOYA 1NJ4A 3BFCA 1LL9A 5HAPA 1L2SA 5KZHA 2OOLA 1XGIA 3GECA 1XFQA 1L0EA 2Y91A 1MY8A 4U3TA 2JKFA 1PWGA 2A24B 3LIEA 2Z6CA 4R4RA 1IYQA 2G7UA 1YSPA 4DDYA 2DCFA 3D4FA 3R4KA 2RCXA 1ES3A 5FI2A 3RXXA 1N9NA 4Q0HA 5D3OA 3NECA 5F69A 5EFWA 1OPXA 1ACFA 4GCZA 4EV4A 1XKZA 1TD5A 3HLDA 4WZ5A 4XUXA 3ULFA 4KZ5A 1HZOA 3CPTA 1TDLA 4ZTKA 3D72A 3H82B 3TW8A 5FI7A 4FH4A 3IS2A 2ZM0A 3NIAA 1RGZA 4EERA 3ZG7B 3CUEC 3FPWA 3BWLA 1MKMA 4NEED 1PI4A 3VFFA 3TJZC 1L3LA 3N8SA 5CX7A 4E3LA 4D2OA 3HJKA 1XJ4A 5JYPA 4YINA 3QNCA 1NLZA 4QY5A 4KG2A 4OOLA 2DMWA 2W27A 3BFGA 3A3JA 4S2JA 2GJ3A 3D3OA 2WKPA 3KX0X 2YKHA 1MBLA 4GN2A 3PBNA 5KIZA 1M40A 1N9OA 3P01A 4L0LA 3O88A 5FQIA 4MN5A 2JHEA 5DJUA 1SZVA 4HHDA 4QPRA 4JXWA 4ZJ3A 2QKPA 2GZAA 4KZBA 3C4OA 3SOIA 1BUEA 4GD6A 3F1PA 3JVVA 4OVDA 1OJGA 4QHCA 1XJ3A 1SDEA 3NHQA 2C5WB 1S1YA 3WS5A 2XK1A 2OSUA 1LI9A 3VV4A 3LI8A 3FPVA 1VEUA 1OTEA 3IX4A 1OTAA 3HCYA 3OZHA 5HAQA 1CQAA 1K6RA 3PAEA 4QWOA 3UNWA 1I2SA 4HP9A 4E3IA 3LR5A 1TS7A 4LV0A 4DJ3A 4UQIS 1JWVA 1XFNA 1P0ZA 3HREA 3F1OB 4OH0A 2O99A 4P6BA 2PU2A 3FV7A 3WS4A 2PBYA 2ZM8A 4LRXC 4IUKA 3LYXA 3E2KA 2X71A 4CLCD 5DVAA 3G2YA 3IWQA 4EEUA 4QY6A 2O9CA 3W4QA 1CI8A 4MBKA 5GLDA 3UB9A 5L09A 5KSCA 3ZQ5A 3ZYTA 1Q2PA 1O7EA 3H7WB 1OT9A 4IJGA 5EVID 4ETXA 5GLAA 1YAXA 2XSSA 4LFUA 3T1QB 3HJIA 5CEDA 1GCEA 4WEKA 4WMCA 5HAIA 2ZQAA 4PM9A 4MEZA 1A0KA 4GNUA 3RJUA 3ZVTA 4KQQA 2FH5A 2ZQCA 3MXSA 3IWIA 2VV8A 4LCMA 4X68A 1LSWA 2HF6A 3LIBA 4OQHA 5DFYA 1MWSA 3E4PA 1DJBA 4HBTA 1RP5A 2VKSA 5F6AA 5CGSA 1Q2QA 2H0YA 1YLYA 1LT0A 2W3HA 1JWPA 2EFUA 1DY6A 5FSRA 4F3LA 1AWIA 4MN7A 2WK0A 4C3QA 4CLCA 1G6AA 3LFVA 5HL1A 3SZTA 4S2MA 3NBLA 4R3BA 1PRQA 3BEBA 2M1CA 3AGFA 4ETZA 1K38A 1H8ZA 5EM1A 4BQMA 2W1TA 3VOLA 2NUTC 3M2JA 4KZ6A 4BWIA 1NRFA 1YLZA 5GHZA 4R1GA 3EQVA 2VV6A 2EX9A 3R7WA 4OPRA 1ES5A 5FDHA 4MDZA 5DJTA 1TS6A 2EXAA 2VZWA 1D1JA 2KDKA 4NKPA 3ZVWA 3NJAA 2ZC7A 2Y55A 1EW0A 2PYRA 5J4EA 1U60A 1BULA 1IFQA 3PAGA 2HDRA 4OKPA 4BENA 2QZ6A 3LIFA 1LLBA 2NUPC 4Q8IA 1YM1A 1JWZA 3UE6A 1YLWA 3W8KA 2W3EA 1UWNX 3C5AA 4DRTA 3L9KA 3GVBA 1E3UD 5G18A 3IH8A 5TBMB 1V9ZA 4RX3A 3UE0A 1TF1A 2JCHA 4U0TA 3GR2A 1XA7A 3DAVA 4Y15A 1LHYA 2M7VA 3V67A 5K5BA 3HLWA 3NDGA 4EU0A 1IYPA 2H10A 3HVFA 3VOYA 5AQAA 4WYYA 2Q9NA 2B5RA 3B3XA 5L8MA 3SW1A 2FFFB 1OJ5A 2V8CA 2L1MA 3O5YA 4LV2A 4H6JB 1XGJA 2WGWA 1YQSA 3EWKA 4QJGA 1G28A 3F1NB 5A93A 5HD5A 5I5LA 2J3TC 1QMFA 1T1CA 1DP9A 2DNSA 4EQIA 1DP8A 1ZTUA 3HLCA 4HOIA 1YLPA 1LSVA 1VHMA 1HLUP 2B18A 2D01A 2WADA 4YFMA 3G30A 5GL9A 4OP8A 4O0PA 4S2LA 5CRFA 1XP4A 2Y59A 3CAXA 5KSHA 3MJQA 3UMEA 4EEPA 5F68A 2P9VA 3KSIA 3UB7A 3PBOA 1KDSA 3H9WA 4Y0UA 1IELA 1H0MA 1TS8A 2INWA 2W0NA 2EFXA 5HL6A 3DBAA 3MS6A 2L0WA 2V0UA 2J3WA 4GLQA 1Y28A 5FEFA 3HUOA 4G3KA 3KYZA 5IS1A 4KZ8A 4IVIA 1P9WA 3LR3A 2XD5A 4UA7A 2B95A 1MWUA 3VE3A 4H8RA 3QP4A 3C2WA 5JYOA 5A90A 2ZC6B 3HLFA 3DWKA 5HPFA 2IWDA 4ZJ2A 3P98A 4B4XA 4R3AA 4N92A 5GHXA 2ZL1A 3S7NA 2V0WA 2ZBBA 3IXGA 2WGVA 1GSXA 4BMWA 4N9LA 4PM7A 4WZ4A 3D9YA 2IA2A 4E3JA 4FH2A 2WYXA 2C6WB 3T4KA 5CGXA 3IX3A 3LICA 2KX6A 4JLFA 4Y7PA 4LV1A 4HQAA 4LGWA 3BECA 3NDEA 3PYPA 5M19A 2JC7A 5F82A 3O3VA 1ERQA 2X01A 3C30A 3GRJA 4KZ9A 4GOGA 3FZCA 2Y2MA 3JYIA 2MJ6A 4LPZA 1S67L 1VB6A 1K4EA 1VQQA 3OPLA 5IU1A 4P85A 4P0MA 2Y79A 3AGDA 5HDCA 3UB8A 4P6ZM 1MC0A 1NY0A 5GHYA 5HZHA 3LR0A 1ONGA 3S22A 2I72A 3ZG0A 4KZ3A 5HX9A 4ZBEA 1N9BA 3PXPA 4MCWA 3EGDC 1ERMA 1K54C 4PHTA 3MZDA 4CPKA 3BJNA 3BQ8A 2ZQ7A 2V1AA 1L0GA 4Y2FA 4LRZE 3FYZA 5AVEA 3ZFZA 1BLCA 4GS9A 4ARZB 1I5QA 2M7UA 1PI5A 4WM9A 2FZ0A 2VLGA 1S6RA 3ZHHA 4PM8A 3EEAA 2ZMFA 1G68A 4XT2A 4Y13A 2KOIA 4E6XA 5FQKA 2XFTA 5FA7A 3OPPA 4FCFA 1J3WA 4DMZA 3NC8A 1UWPX 1TS0A 5EV0A 1YT4A 4I39A 3CPTB 3PBQA 4IEDA 3MFDA 1FCNA 3QP8A 3RFBA 2J8YA 2PU4A 4FSFA 2A24A 3LEQA 1AXBA 3KSFA 2WKHA 2ZC5B 3GSGA 3IXHA 3C8CA 2XA7M 3CG5A 3CJMA 2A3UA 2V8FA 2J80A 1G5UA 1W7FA 1K6SA 2G2UA 3RH8B 5GLBA 1DP6A 4ZRRA 3WS0A 1Z6FA 2A49A 3MFXA 4KG6A 1CI9A 1EI5A 2OLVA 3C7VA 1YLTA 4JGOA 1PZOA 1VETB 3H82A 1E4DA 5FQ9A 3N8RA 3F1PB 3V3SA 1OMEA 4F94A 4CJNA 4JBFA 4M3KA 2K7SA 2HDQA 2XR0A 1IKGA 1H8YA 2Q9MA 3MQQA 3U4LP 1YKDA 1HD8A 5CECA 2ZMAA 1S4SA 1VEUB 1PIOA 2KLIA 4HJ6A 4WMCD 3IXBA 4RYEA 3PHYA 4ZAMA 5FATA 2BG1A 4DXBA 1T19A 5A91A 3W4OA 4Y0TA 1KVLA 3T4TA 4HH3A 3TSGA 5F1FA 2HDSA 4MN6A 5CTNA 3TG9A 1ZHHB 1G6OA 3P09A 2PAVP 3DTKA 5L10A 1KE0A 2Y2HA 1H8MA 3T4QA 5E2EA 5EVEA 3A0SA 3RTYA 4X69A 4EXOA 2PR5A 3N4IA 3KYEA 2RL3A 4S2IA 3ITBA 2ZMVA 4FOFA 4BJPA 3BFEA 3CWFA 4N9KA 4PKYG 2EWWA 2JKRI 3F1OA 1MKIA 2PR6A 1LI0A 3BQAA 4OQGA 4EWFA 2QMIA 3KSGA 4N1XA 4OQ0A 4OP5A 2PD8A 3S7OA 5GLCA 4FTXA 2Y2NA 1FOFA 4G3VA 1RGYA 2JKTM 1D7EA 1YLJA 4HP4A 1SHVA 3H7WA 1CEGA 1H5XA 3GMWA 5DF7A 1BLHA 1JTDA 1N9LA 5DF8A 3QNBA 4R6LA 3QHYA 5EE8A 2PYPA 4GDNA 5KMWA 3NOPC 1YSQA 4CLCB 3CUEA 3E98A 5FAPA 1W8QA 4PM6A 4KQRA 3E0YA 5J3WA 4DE2A 5TGFA 2Q0OA 5F83A 3UPPA 3VP3A 4ME4A 1SKOA 3UB5P 3UDXA 2CC1A 2ZD8A 5EVIB 5EOEA 1OT6A 3K3CA 5EPHA 1KGGA 1D06A 5A8BA 1QMEA 3MF0A 3UDIA 5E43A 3IBRA 2HV1A 2IWCA 2XRNA 1I2WA 5HD3A 4OLDA 1K0KA 2VA0A 4YNRA 3FKWA 3G6OA 1KGEA 3BFFA 5E2GA 1OTDA 2BLSA 4MNRA 2J9PA 2Y2LA 1S1ZA 4C6YA 5FASA 4UAAA 3JVUA 3PBSA 1NZUA 3IH9A 2V9AA 2QWSA 3M6BA 5TJJA 1FR1A 4RX2A 1ZC2A 4P6ZS 1ALQA 4KG5A 5HWWA 1EWZA 3HLGA 3B47A 4OOMA 3S7PA 5FEGA 2OAP1 4JF6A 4Y5FA 3IF6B 3P7NA 5BOHA 1S0WA 4OLGA 1PWDA 5G4ZA 4WLAA 3HLBA 5CHJA 4X25A 4KENB 4BBTA 1NXYA 4PAUA 2XD1A 2XROA 2EX6A 2PT7A 2WZXA 4GB7A 5L07A 4DF6A 5CGWA 2EWVA 1NYMA 2V1BA 4E3NA 1V9YA 3RXWA 3BYDA 3MKEA 5HW3A 4X6TA 2V20A 3ZGAB 1E25A 1WYCA 1DJCA 5CXWA 5I94A 2PDRA 4IUHA 1F98A 2OWJA 4RVAA 4B4ZA 5TBMA 4ESPA 3I7JA 2OAQ1 3Q1FA 3E2LA 3JPUA 3LY4A 3K2NA 2XFSA 4X53A 3T1XA 3V5MA 1DRMA 4GD8A 2VJWA 2QJ7A 5EVLA 3S1YA 2XA7S 3NOTC 4K08A 4S2NC 1NWZA 3BW6A 3WS1A 2O9AA 2P9VB 5DKLA 1M6KA 4A5RA 1W63M 4GKUA 1FILA 4MBFA 4H6JA 2JE5A 4IBXA 3UO9A 4M4XA 4Y0OA 4O8GA 4DDSA 1YPRA 4JXSA 3IX8A 1ES4A 5CEBA 3GV9A 4FUWA 1BLSA 5DKKA 5DTTA 4UHUA 3VP0A 2ZQ9A 4IVKA 3T4LA 1FCOA 3O87A 1ESIA 1PW1A 2H5SA 4NG2A 4KQOA 3T4SA 4NXGA 4B9OA 4KUOA 2Y2JA 2V1ZA 2WKRA 3NOUC 1W5DA 4MLLA 3S4XA 3W4PA 2B02A 3C4PA 3AGEA 5AQBA 3IHBA 4L9EA 4B88A 4GHIA 3IF5A 4EBNA 4Y17A 3PBTA 4XUZA 2Y2KA 4S2PA 2QPNA 1GHPA 4AFIA 1T1AA 1TEMA 3ITAA 1K56D 4GJ4A 2PRFA 3B42A 5HFOA 4EBLA 2J3TD 5FL3A 1ESUA 2ZJ9A 2E8IA 4ZJ1A 1GHMA 3E4OA 2DRWA 1OTBA 5M18A 1T18A 5A92A 2J9OA 4EUZA 3KO6A 4JGPA 1BT5A 3CLOA 4EESA 4MBHA 1T1BA 3N8LA 2ZOIA 1Z09A 2UWXA 3Q7VA 3PR6A 3NY4A 1CEFA 4MMNA 1FR6A 4JGRA 4CQHA 4R3JA 3W2ZA 2ZOHA 1MWRA 3SS4A 2WKEA 2VGJA 3ZNYA 4LLOB 1SCWA 2Y8HA 4R4SA 1WYBA 2PBDP 2LB5A 3NULA 3A0RA 1PYYA 2WUQA 5EECA 3EOIA 3SS3A 4O01A 4L9GA 4R23A 4X1MA 2ZC4B 4GS9B 4PPRA 5HDSA 2OV5A 4I5SA 2AVXA 5J7EA 3CHWP 3OPRA 4JKTA 4LENA 4O7DA 4WEJA 3MZFA 3SH9A 4XT2B 1DJAA 1GHIA 1J9MA 1K56A 3BY9A 4OPQA 4U0XA 3WRZA 3S7QA 4S2NA 4KZAA 4BD0A 3IHAA 3PTEA 3MXRA 5FQJA 5CERA 1NZOA 2R78A 3UDFA 3UY6A 4HI4A 1FIKA 1S66L 3IS2B 4ARZA 5HWVA 3N6IA 3NI9A 2HPBA 1O07A 4X56A 5FQQA 4IBRA 3CI6A 2ZQ8A 5E2HA 5AVFA 2Z2MB 4LRYC 4EQ1A 4QD4A 3C7UA 3G2ZA 3G31A 1F9IA 4BL2A 4JF4A 1KDWA 2Y4AA 3TRCA 5E2FA 4X55A 5CHUA 4RQ9A 3IBJA 4WL9A 1ODVA 3LIDA 4R70A 3ZG9B 4RA7A 1YMSA 5HWTA 3T12B 1JTGA 4L9FA 4DE1A 3LCEA 4BL3A 4CLCE 5LBRA 4HH2A 4CLCC 3G4PA 1BSGA 2P08A 3MSHA 3FKVA 5M1AA 3QP6A 2R9WA 2EA9A 2W3FA 3SH8A 3MBZA 4I3AA 2LB9A 3FG8A 3BRMA 3GQZA 1Y4OA 4QB8A 2PD7A 4Y3IA 1CK3A 3UE1A 5EVIC 3E4QA 1TVFA 1FSWA 3GTCA 3NCKA 4G3WA 3M6HA 3LGOA 1VETA 2Y2GA 2XH9A 2QJ5A 3DWZA 3HL9A 4Z1WA 2HZ5A 2VGLM 4YOFA 1TDGA 3M2KA 2A2LA 5HARA 1IYSA 2XDMA 4DJ2A 1IKIA 4Q0JA 1XX2A 4E3OA 1FSYA 5HDDA 3SS5A 3T1SA 3IXDA 3DTMA 2WGIA 2YKFA 1PW8A 3LY3A 3ZG5A 3SH7A 1W79A 1K54A 4EBPA 4B93A 2P74A 3PBRA 2ZM2A 3OOVA 3UPOA 2O9BA 1F2KA 1WE4A 2HP5A 2Z6DA 4R0QA 3IF6C 1KOUA 4HIAA 3HUNA 1ONHA 3A3EA 2ACGA 1LL5A 3MR0A 3Q81A 2I9VA 4N1HA 2WAFA 3A3FA 3VP4A 3N7WA 3DTEA
chains in the Genus database with same CATH topology
2PT7A 3D72A 3FC7A 3H82B 3TW8A 3IS2A 2IA2A 2EWVA 2V1BA 4EERA 2PHYA 3CUEC 3FPWA 1V9YA 3OCNA 4R38A 3T4KA 3BWLA 1MKMA 4NXFA 4NEED 4PKYA 3UB6A 3LICA 2KX6A 4HQAA 3TJZC 5CX7A 1H3QA 3MXQA 3K3DA 3HJKA 3PYPA 1XJ4A 5HPIA 3CITA 3OC2A 1NLZA 4F3LB 1MZUA 4EETB 3C30A 4OOLA 2DMWA 4HJ4A 2PDRA 2W27A 4IUHA 1X0OA 2GJ3A 3D3OA 2WKPA 1F98A 2GNXA 3KX0X 2MJ6A 4LPZA 2YKHA 1S67L 3C38A 1VB6A 3PBNA 2OWJA 5KIZA 4HNBA 5TBMA 5IU1A 1N9OA 3P01A 4L0LA 4WELA 2VX8A 2Y79A 2OAQ1 4BBUA 5HDCA 2W1TB 4MN5A 2JHEA 3T4JA 5DJUA 3UB8A 4P6ZM 1MC0A 3T50A 5HZHA 2QHKA 4HHDA 4QPRA 3LR0A 3VE4A 2QKPA 2GZAA 3K2NA 5MC7A 1DRMA 3OCLA 2VJWA 2QJ7A 3PXPA 4MCWA 3EGDC 3F1PA 4NXBA 2XA7S 4PHTA 3JVVA 3NOTC 3B33A 4K08A 3BJNA 3BQ8A 1OJGA 1NWZA 3TE8A 3BW6A 1XJ3A 2O9AA 5DKLA 3NHQA 2HJ9C 3GDIA 3R7WB 2V1AA 1S1YA 5G4YA 1GSVA 3A0VA 4Y2FA 3VV4A 4LRZE 1W63M 3LI8A 3FPVA 4H6JA 1OTEA 1OTAA 1P9RA 5AVEA 4E04A 3HCYA 4M4XA 4O8GA 2QYBA 2P7JA 4GS9A 4ARZB 2M7UA 4HP9A 2FZ0A 2VLGA 3LR5A 2K31A 1TS7A 2JN7A 5DKKA 4DJ3A 4UQIS 3EEAA 2ZMFA 3UE3A 1XFNA 3OBFA 1P0ZA 4XT2A 3F1OB 2O99A 2KOIA 3T4LA 4BBVA 4HY8A 5C5KA 4DMZA 3ICYA 4KQOA 3T4SA 4NXGA 4I3JA 4LRXC 3MMHA 1UWPX 4IUKA 3UMDA 4B9OA 4EW7A 3LYXA 1S4RA 4KUOA 1TS0A 2VEAA 2WKRA 3NOUC 4CLCD 1NLYA 4WN5A 4I39A 4EEUA 2B02A 2O9CA 3PBQA 3UB9A 3RFBA 4L9EA 3ZQ5A 4I3IA 3ZYTA 4FSFA 1LSXA 5DF9A 3H7WB 4GHIA 1OT9A 2A24A 3MQOA 4IJGA 3PBTA 4EUVA 4AFIA 3KSFA 4ETXA 1T1AA 1YAXA 3C8CA 2XSSA 3HJIA 2XA7M 3EGXC 4WEKA 3U2AA 4GJ4A 2J80A 3B42A 4II7A 2J3TD 5FL3A 2WKQA 3E4OA 1WA9A 3RH8B 1OTBA 2K2NA 1DP6A 4ZRRA 1T18A 4IHQA 3MFXA 2VV7A 2FH5A 3KO6A 4JGPA 3CLOA 2VV8A 4WF0A 4EESA 1T1BA 1LSWA 2HF6A 3LIBA 2ZOIA 4I38A 5F5YA 5DFYA 3E4PA 4JGOA 3H82A 3PR6A 3BY8A 1GSWA 3F1PB 2VKSA 4UQIM 4MMNA 5F6AA 4JGRA 4CQHA 3W2ZA 2ZOHA 3KSHA 4HJ3A 2K7SA 1LT0A 4LLOB 2W3HA 2Y8HA 3MQQA 1YKDA 2LB5A 4F3LA 1S4SA 3A0RA 4MN7A 2KLIA 4HJ6A 4CLCA 3LFVA 3EOIA 4O01A 2OWHA 3PHYA 4L9GA 2W3DA 4KQDA 4GS9B 5HDSA 2M1CA 4I5SA 3LR4A 4ETZA 1T19A 5J7EA 2W1RA 4WEJA 2W1TA 3VOLA 1OTIA 3F1NA 4XT2B 2NUTC 3T4TA 4BWIA 4HH3A 5DFXA 1IOUA 4DN0A 4MN6A 3EQVA 2W3GA 3BY9A 4NXEA 1ZHHB 1G6OA 2VV6A 4JGQA 4UEYA 3EQUA 2D02A 3LUQA 3S7QA 2JKTI 1UGUA 3R7WA 1XJ6A 2GX5A 4MDZA 5DJTA 1TS6A 1H8MA 2VZWA 5AJGA 2KDKA 3T4QA 4NKPA 4GHIB 2R78A 3NJAA 3A0SA 2P04A 4HI4A 3RTYA 4EXOA 1EW0A 2PYRA 1S66L 3IS2B 5J4EA 2PR5A 1NRJA 4ARZA 1IFQA 5HWVA 2O0YA 1STZA 2VGLS 2ZMVA 4FOFA 3LIFA 4BJPA 3CWFA 2NUPC 3CI6A 5AVFA 4PKYG 4LRYC 2EWWA 4EQ1A 2JKRI 3F1OA 3UE6A 1F9IA 3OLOA 2PR6A 2H28A 5IT5A 3BQAA 3TRCA 2W3EA 1UWNX 3EEHA 3KSGA 2PD8A 3LIAA 3S7OA 4RQ9A 5TBMB 3IBJA 1V9ZA 4WL9A 1ODVA 3LIDA 1TF1A 4R70A 4G3VA 4Q0IA 2JKTM 1D7EA 3KYQA 5HWTA 2M7VA 4WUJA 4HP4A 2L4RA 3H7WA 4L9FA 3V67A 3LI9A 4CLCE 1LL8A 1N9LA 5LBRA 1BYWA 5K5BA 4HH2A 4EU0A 4CLCC 4R6LA 2P08A 1JNUA 2PYPA 3NOPC 1YSQA 4CLCB 3CUEA 3E98A 2EA9A 2W3FA 2CMNA 5L8MA 4I3AA 3MQ0A 2LB9A 3SW1A 3FG8A 1OJ5A 3E0YA 5J3WA 2L1MA 2PD7A 3O5YA 4Y3IA 4YWZA 4H6JB 1F5MA 2JKRM 4ME4A 3EWKA 3E4QA 2HJEA 1G28A 3F1NB 1W63Q 5HD5A 4G3WA 4BMWA 1OT6A 3K3CA 4KUKA 5I5LA 1D06A 2J3TC 5A8BA 2BASA 3MF0A 1P97A 1T1CA 2QJ5A 4Z1WA 2VGLM 4YOFA 1DP9A 3IBRA 1DP8A 1ZTUA 2HV1A 2A2LA 2HGVA 4HOIA 1LSVA 2XRNA 4DJ2A 1VHMA 2B18A 2D01A 4Q0JA 5HD3A 4GW9A 2VA0A 4YNRA 3G6OA 4O0PA 5HDDA 1OTDA 3CAXA 5KSHA 3MJQA 2YKFA 1S1ZA 3T4OA 3UMEA 4EEPA 5F68A 5HSQA 3KSIA 1XJ2A 3UB7A 3PBOA 3H9WA 3JVUA 3PBSA 1TS8A 2INWA 2V9AA 4B93A 2QWSA 2W0NA 2OOLA 3GECA 1XFQA 3PBRA 5HL6A 5TJJA 3OOVA 3DBAA 2L0WA 2A24B 2V0UA 2Z6CA 2J3WA 3LIEA 4GLQA 4P6ZS 2O9BA 1Y28A 2G7UA 1YSPA 2Z6DA 5HWWA 3B47A 3KYZA 4G3KA 5IS1A 3R4KA 4OOMA 3S7PA 1KOUA 4HIAA 2OAP1 1P9WA 3LR3A 1N9NA 4Q0HA 4Y5FA 3P7NA 5F69A 5EFWA 3VE3A 3C2WA 3MR0A 5G4ZA 4WLAA 1OPXA 2I9VA 4GCZA 5HPFA 1TD5A 4R3AA 4BBTA 4PAUA 3ULFA 2XROA 3S7NA 2V0WA 2ZBBA 1GSXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D72 A;  3FC7 A;  3H82 B;  3IS2 A;  2V1B A;  4EER A;  2PHY A;  1V9Y A;  4R38 A;  3BWL A;  4NXF A;  4PKY A;  3UB6 A;  3LIC A;  2KX6 A;  4HQA A;  3MXQ A;  3K3D A;  3HJK A;  3PYP A;  1XJ4 A;  4F3L B;  1MZU A;  4EET B;  4HJ4 A;  2PDR A;  2W27 A;  1X0O A;  2GJ3 A;  2WKP A;  1F98 A;  3KX0 X;  4LPZ A;  2YKH A;  1S67 L;  5KIZ A;  1VB6 A;  2OWJ A;  4HNB A;  5TBM A;  5IU1 A;  1N9O A;  4BBU A;  5HDC A;  4MN5 A;  2JHE A;  3UB8 A;  5DJU A;  3T50 A;  5HZH A;  2QHK A;  3VE4 A;  4HHD A;  2QKP A;  1DRM A;  2QJ7 A;  3F1P A;  4NXB A;  3NOT C;  3B33 A;  4K08 A;  1OJG A;  1NWZ A;  1XJ3 A;  5DKL A;  3NHQ A;  3GDI A;  2V1A A;  1S1Y A;  5G4Y A;  1GSV A;  3A0V A;  4LRZ E;  3LI8 A;  4H6J A;  1OTE A;  1OTA A;  5AVE A;  4E04 A;  4M4X A;  2P7J A;  4GS9 A;  4HP9 A;  2VLG A;  1TS7 A;  2JN7 A;  5DKK A;  4DJ3 A;  1XFN A;  1P0Z A;  4XT2 A;  3F1O B;  4BBV A;  4HY8 A;  3ICY A;  4NXG A;  4I3J A;  4LRX C;  3UMD A;  1UWP X;  4B9O A;  4EW7 A;  3LYX A;  1S4R A;  4KUO A;  1TS0 A;  2VEA A;  2WKR A;  3NOU C;  4WN5 A;  4I39 A;  4EEU A;  2B02 A;  3UB9 A;  4L9E A;  3ZQ5 A;  4I3I A;  1LSX A;  3H7W B;  4GHI A;  1OT9 A;  2A24 A;  3MQO A;  1T1A A;  3C8C A;  3HJI A;  2J80 A;  2WKQ A;  3E4O A;  1WA9 A;  3RH8 B;  1OTB A;  1DP6 A;  1T18 A;  3MFX A;  2VV7 A;  4JGP A;  3CLO A;  2VV8 A;  4WF0 A;  4EES A;  1T1B A;  1LSW A;  3LIB A;  2ZOI A;  4I38 A;  5F5Y A;  3E4P A;  4JGO A;  3H82 A;  3BY8 A;  1GSW A;  3F1P B;  5F6A A;  4JGR A;  2ZOH A;  4HJ3 A;  2K7S A;  1LT0 A;  4LLO B;  3MQQ A;  4F3L A;  1S4S A;  3A0R A;  4HJ6 A;  2OWH A;  3PHY A;  4L9G A;  4KQD A;  4GS9 B;  5HDS A;  2M1C A;  4I5S A;  1T19 A;  5J7E A;  3VOL A;  1OTI A;  3F1N A;  4XT2 B;  4HH3 A;  4MN6 A;  3BY9 A;  4NXE A;  2VV6 A;  4JGQ A;  2D02 A;  3LUQ A;  1UGU A;  1XJ6 A;  5DJT A;  1TS6 A;  2KDK A;  4GHI B;  2R78 A;  3NJA A;  3A0S A;  4HI4 A;  3RTY A;  4EXO A;  1EW0 A;  2PYR A;  1S66 L;  3IS2 B;  5J4E A;  2PR5 A;  5HWV A;  3LIF A;  3CWF A;  5AVF A;  4PKY G;  4LRY C;  4EQ1 A;  3F1O A;  3UE6 A;  1F9I A;  3OLO A;  2PR6 A;  2H28 A;  1UWN X;  3EEH A;  2PD8 A;  3LIA A;  4RQ9 A;  5TBM B;  1V9Z A;  4WL9 A;  1ODV A;  3LID A;  4R70 A;  1D7E A;  5HWT A;  4WUJ A;  4HP4 A;  2L4R A;  3H7W A;  4L9F A;  3LI9 A;  1LL8 A;  1N9L A;  1BYW A;  4HH2 A;  4R6L A;  1JNU A;  2PYP A;  3NOP C;  2EA9 A;  2CMN A;  4I3A A;  3SW1 A;  3FG8 A;  1OJ5 A;  5J3W A;  2L1M A;  2PD7 A;  4YWZ A;  4H6J B;  3EWK A;  3E4Q A;  1G28 A;  3F1N B;  5HD5 A;  1OT6 A;  3K3C A;  4KUK A;  5I5L A;  1D06 A;  5A8B A;  2BAS A;  1P97 A;  1T1C A;  2QJ5 A;  1DP9 A;  3IBR A;  1DP8 A;  2HV1 A;  4HOI A;  1LSV A;  4DJ2 A;  2D01 A;  5HD3 A;  4GW9 A;  3G6O A;  5HDD A;  1OTD A;  3CAX A;  3MJQ A;  2YKF A;  1S1Z A;  3UME A;  4EEP A;  5F68 A;  5HSQ A;  1XJ2 A;  3UB7 A;  3H9W A;  1TS8 A;  2INW A;  2V9A A;  2QWS A;  2W0N A;  2OOL A;  3GEC A;  1XFQ A;  2L0W A;  2A24 B;  2V0U A;  2Z6C A;  3LIE A;  1Y28 A;  2Z6D A;  5HWW A;  5IS1 A;  1KOU A;  4HIA A;  1N9N A;  3P7N A;  5F69 A;  5EFW A;  3VE3 A;  3C2W A;  3MR0 A;  5G4Z A;  4WLA A;  2I9V A;  4GCZ A;  4R3A A;  4BBT A;  3ULF A;  2V0W A;  2ZBB A;  1GSX A; 
#chains in the Genus database with same CATH topology
 5EM0 A;  1XPB A;  3FC7 A;  3V50 A;  1IEM A;  2PHY A;  3OCN A;  4R38 A;  4NXF A;  3UB6 A;  4PKY A;  4DKI A;  4NET A;  3VP2 A;  1H3Q A;  3MXQ A;  3K3D A;  5HPI A;  3CIT A;  3OC2 A;  1K57 C;  4F3L B;  1MZU A;  2JBF A;  4EET B;  4HJ4 A;  1SKO B;  4HES A;  1X0O A;  2EXB A;  2EX2 A;  2GNX A;  1ES2 A;  3C38 A;  1YMX A;  1W8Y A;  4HNB A;  2GDN A;  4Z9Q A;  2HP9 A;  2BTF P;  2XGN A;  4WEL A;  2VX8 A;  4BBU A;  4LCL A;  3IWO A;  2W1T B;  3T4J A;  2WZZ A;  3T50 A;  2QHK A;  3VE4 A;  4ID4 A;  1PWC A;  4GDB A;  5MC7 A;  3OCL A;  1BTL A;  4NXB A;  3B33 A;  3TE8 A;  3HLE A;  1KE4 A;  2HJ9 C;  1C3B A;  3GDI A;  3R7W B;  3L7H A;  5J8X A;  5G4Y A;  1GSV A;  3A0V A;  1P9R A;  4GZB A;  4E04 A;  2ZQD A;  2WAE A;  2QYB A;  2P7J A;  5EVI A;  5FQM A;  3DTI A;  3VP1 A;  1GA0 A;  3UN7 A;  3G35 A;  2K31 A;  2JN7 A;  3HBR A;  3UE3 A;  3OBF A;  3IT9 A;  1JVJ A;  1FCM A;  2XEP A;  4BBV A;  4HY8 A;  1VM1 A;  3WS2 A;  2EX8 A;  5C5K A;  3ICY A;  4I3J A;  3UMD A;  3MMH A;  4C75 A;  5TFQ A;  4EW7 A;  1S4R A;  2R9X A;  2VEA A;  1NLY A;  3HUM A;  4WN5 A;  3ZNT A;  4K91 A;  2XF3 A;  3BLS A;  4I3I A;  4KZ7 A;  1LSX A;  5DF9 A;  5L2F A;  1K4F A;  3MQO A;  4EUV A;  1K55 C;  3VSL A;  3G34 A;  1PZP A;  1BZA A;  3EGX C;  2Y2P A;  2ZLY A;  3BM6 A;  2XLN A;  3U2A A;  1BLP A;  1N4O A;  4II7 A;  4UA9 A;  3IF6 A;  2VK3 A;  2X02 A;  3CMZ A;  2WKQ A;  1WA9 A;  4OPY A;  2K2N A;  1GA9 A;  3Q82 A;  2WGW B;  4IHQ A;  2VV7 A;  4JXG A;  1KVM A;  4WF0 A;  3VOZ A;  1K25 A;  3IQA A;  3ZCZ A;  4I38 A;  2HDU A;  5F5Y A;  4D60 A;  2Z2L B;  1ZG6 A;  1Y54 A;  3BY8 A;  3QP1 A;  3ZDJ A;  1GSW A;  2G2W A;  4HBU A;  4UQI M;  5EOO A;  4E3M A;  1HVB A;  4JF5 A;  5AQ7 A;  3KSH A;  4HJ3 A;  4K0W A;  4UA6 A;  2IWB A;  1XA1 A;  2Y2O A;  1MPL A;  4PMA A;  4DE0 A;  3TOI A;  2FFY A;  4KZ4 A;  3V3R A;  3O86 A;  3WWX A;  2HP6 A;  1K57 A;  2OWH A;  3VFH A;  5EUA A;  2W3D A;  5CTM A;  4KQD A;  2Y2I A;  1CF0 A;  1SKF A;  3LR4 A;  2W1R A;  5FAQ A;  5FAO A;  4S2O A;  1OTI A;  3F1N A;  5F1G A;  4K0X A;  5DFX A;  1IOU A;  3UPN A;  4DN0 A;  4XXR A;  1SDN A;  2W3G A;  4NXE A;  4QU3 A;  4OQI A;  2H0T A;  4JGQ A;  4UEY A;  3EQU A;  2D02 A;  3LUQ A;  1E3U A;  2JKT I;  4X1L A;  5IHV A;  4BLM A;  1UGU A;  4WZ5 C;  1XJ6 A;  3VMA A;  2GX5 A;  4E3K A;  4JPM A;  5AJG A;  1L0F A;  2ZL1 B;  4P87 A;  3BLM A;  3LEZ A;  3QP5 A;  4GHI B;  5TR7 A;  5CHM A;  2P04 A;  1NRJ A;  1PNE A;  4DXC A;  2Y2Q A;  2O0Y A;  1STZ A;  2VGL S;  2ZC3 B;  2OLU A;  1PFL A;  3T1R A;  1ZG4 A;  3MKF A;  3OLO A;  2E8J A;  3WRT A;  2H28 A;  5IT5 A;  3Q7Z A;  4E6W A;  3EEH A;  3LIA A;  3CZD A;  3MZE A;  4FD8 A;  5U47 A;  4LV3 A;  3Q7V B;  3VSK A;  5FDS A;  4Q0I A;  1NYY A;  4OON A;  3KYQ A;  1L0D A;  4WUJ A;  2L4R A;  3ISG A;  2JKG A;  3LI9 A;  1LL8 A;  2UV0 E;  1RCJ A;  4JXV A;  1BYW A;  3FWL A;  5DTS A;  1K55 A;  4BD1 A;  1JNU A;  1IYO A;  3QP2 A;  5DTK A;  1HTZ A;  4WBG A;  4DE3 A;  2CMN A;  3MQ0 A;  2J7V A;  5FI6 A;  1ERO A;  3ZG8 B;  4YWZ A;  1CJF A;  1FQG A;  1F5M A;  2JKR M;  3A3I A;  3A3D A;  3Q07 A;  3G32 A;  2XQZ A;  4ZDX A;  2HJE A;  3LO7 A;  1KE3 A;  2WKI A;  1W63 Q;  2V2F F;  4KUK A;  2BAS A;  1P97 A;  3BFD A;  2VGK A;  1KGF A;  2HGV A;  1XXM A;  4GW9 A;  4S2K A;  1ZKJ A;  3V39 A;  4HEF A;  3OPH A;  4PM5 A;  3DW0 A;  5AQ9 A;  3T4O A;  4OPZ A;  5HSQ A;  1MXO A;  1XJ2 A;  4NK3 A;  1MWT A;  4OOY A;  1NJ4 A;  3BFC A;  1LL9 A;  5HAP A;  1L2S A;  5KZH A;  2OOL A;  1XGI A;  3GEC A;  1XFQ A;  1L0E A;  2Y91 A;  1MY8 A;  4U3T A;  2JKF A;  1PWG A;  2A24 B;  3LIE A;  2Z6C A;  4R4R A;  1IYQ A;  2G7U A;  1YSP A;  4DDY A;  2DCF A;  3D4F A;  3R4K A;  2RCX A;  1ES3 A;  5FI2 A;  3RXX A;  1N9N A;  4Q0H A;  5D3O A;  3NEC A;  5F69 A;  5EFW A;  1OPX A;  1ACF A;  4GCZ A;  4EV4 A;  1XKZ A;  1TD5 A;  3HLD A;  4WZ5 A;  4XUX A;  3ULF A;  4KZ5 A;  1HZO A;  3CPT A;  1TDL A;  4ZTK A;  3D72 A;  3H82 B;  3TW8 A;  5FI7 A;  4FH4 A;  3IS2 A;  2ZM0 A;  3NIA A;  1RGZ A;  4EER A;  3ZG7 B;  3CUE C;  3FPW A;  3BWL A;  1MKM A;  4NEE D;  1PI4 A;  3VFF A;  3TJZ C;  1L3L A;  3N8S A;  5CX7 A;  4E3L A;  4D2O A;  3HJK A;  1XJ4 A;  5JYP A;  4YIN A;  3QNC A;  1NLZ A;  4QY5 A;  4KG2 A;  4OOL A;  2DMW A;  2W27 A;  3BFG A;  3A3J A;  4S2J A;  2GJ3 A;  3D3O A;  2WKP A;  3KX0 X;  2YKH A;  1MBL A;  4GN2 A;  3PBN A;  5KIZ A;  1M40 A;  1N9O A;  3P01 A;  4L0L A;  3O88 A;  5FQI A;  4MN5 A;  2JHE A;  5DJU A;  1SZV A;  4HHD A;  4QPR A;  4JXW A;  4ZJ3 A;  2QKP A;  2GZA A;  4KZB A;  3C4O A;  3SOI A;  1BUE A;  4GD6 A;  3F1P A;  3JVV A;  4OVD A;  1OJG A;  4QHC A;  1XJ3 A;  1SDE A;  3NHQ A;  2C5W B;  1S1Y A;  3WS5 A;  2XK1 A;  2OSU A;  1LI9 A;  3VV4 A;  3LI8 A;  3FPV A;  1VEU A;  1OTE A;  3IX4 A;  1OTA A;  3HCY A;  3OZH A;  5HAQ A;  1CQA A;  1K6R A;  3PAE A;  4QWO A;  3UNW A;  1I2S A;  4HP9 A;  4E3I A;  3LR5 A;  1TS7 A;  4LV0 A;  4DJ3 A;  4UQI S;  1JWV A;  1XFN A;  1P0Z A;  3HRE A;  3F1O B;  4OH0 A;  2O99 A;  4P6B A;  2PU2 A;  3FV7 A;  3WS4 A;  2PBY A;  2ZM8 A;  4LRX C;  4IUK A;  3LYX A;  3E2K A;  2X71 A;  4CLC D;  5DVA A;  3G2Y A;  3IWQ A;  4EEU A;  4QY6 A;  2O9C A;  3W4Q A;  1CI8 A;  4MBK A;  5GLD A;  3UB9 A;  5L09 A;  5KSC A;  3ZQ5 A;  3ZYT A;  1Q2P A;  1O7E A;  3H7W B;  1OT9 A;  4IJG A;  5EVI D;  4ETX A;  5GLA A;  1YAX A;  2XSS A;  4LFU A;  3T1Q B;  3HJI A;  5CED A;  1GCE A;  4WEK A;  4WMC A;  5HAI A;  2ZQA A;  4PM9 A;  4MEZ A;  1A0K A;  4GNU A;  3RJU A;  3ZVT A;  4KQQ A;  2FH5 A;  2ZQC A;  3MXS A;  3IWI A;  2VV8 A;  4LCM A;  4X68 A;  1LSW A;  2HF6 A;  3LIB A;  4OQH A;  5DFY A;  1MWS A;  3E4P A;  1DJB A;  4HBT A;  1RP5 A;  2VKS A;  5F6A A;  5CGS A;  1Q2Q A;  2H0Y A;  1YLY A;  1LT0 A;  2W3H A;  1JWP A;  2EFU A;  1DY6 A;  5FSR A;  4F3L A;  1AWI A;  4MN7 A;  2WK0 A;  4C3Q A;  4CLC A;  1G6A A;  3LFV A;  5HL1 A;  3SZT A;  4S2M A;  3NBL A;  4R3B A;  1PRQ A;  3BEB A;  2M1C A;  3AGF A;  4ETZ A;  1K38 A;  1H8Z A;  5EM1 A;  4BQM A;  2W1T A;  3VOL A;  2NUT C;  3M2J A;  4KZ6 A;  4BWI A;  1NRF A;  1YLZ A;  5GHZ A;  4R1G A;  3EQV A;  2VV6 A;  2EX9 A;  3R7W A;  4OPR A;  1ES5 A;  5FDH A;  4MDZ A;  5DJT A;  1TS6 A;  2EXA A;  2VZW A;  1D1J A;  2KDK A;  4NKP A;  3ZVW A;  3NJA A;  2ZC7 A;  2Y55 A;  1EW0 A;  2PYR A;  5J4E A;  1U60 A;  1BUL A;  1IFQ A;  3PAG A;  2HDR A;  4OKP A;  4BEN A;  2QZ6 A;  3LIF A;  1LLB A;  2NUP C;  4Q8I A;  1YM1 A;  1JWZ A;  3UE6 A;  1YLW A;  3W8K A;  2W3E A;  1UWN X;  3C5A A;  4DRT A;  3L9K A;  3GVB A;  1E3U D;  5G18 A;  3IH8 A;  5TBM B;  1V9Z A;  4RX3 A;  3UE0 A;  1TF1 A;  2JCH A;  4U0T A;  3GR2 A;  1XA7 A;  3DAV A;  4Y15 A;  1LHY A;  2M7V A;  3V67 A;  5K5B A;  3HLW A;  3NDG A;  4EU0 A;  1IYP A;  2H10 A;  3HVF A;  3VOY A;  5AQA A;  4WYY A;  2Q9N A;  2B5R A;  3B3X A;  5L8M A;  3SW1 A;  2FFF B;  1OJ5 A;  2V8C A;  2L1M A;  3O5Y A;  4LV2 A;  4H6J B;  1XGJ A;  2WGW A;  1YQS A;  3EWK A;  4QJG A;  1G28 A;  3F1N B;  5A93 A;  5HD5 A;  5I5L A;  2J3T C;  1QMF A;  1T1C A;  1DP9 A;  2DNS A;  4EQI A;  1DP8 A;  1ZTU A;  3HLC A;  4HOI A;  1YLP A;  1LSV A;  1VHM A;  1HLU P;  2B18 A;  2D01 A;  2WAD A;  4YFM A;  3G30 A;  5GL9 A;  4OP8 A;  4O0P A;  4S2L A;  5CRF A;  1XP4 A;  2Y59 A;  3CAX A;  5KSH A;  3MJQ A;  3UME A;  4EEP A;  5F68 A;  2P9V A;  3KSI A;  3UB7 A;  3PBO A;  1KDS A;  3H9W A;  4Y0U A;  1IEL A;  1H0M A;  1TS8 A;  2INW A;  2W0N A;  2EFX A;  5HL6 A;  3DBA A;  3MS6 A;  2L0W A;  2V0U A;  2J3W A;  4GLQ A;  1Y28 A;  5FEF A;  3HUO A;  4G3K A;  3KYZ A;  5IS1 A;  4KZ8 A;  4IVI A;  1P9W A;  3LR3 A;  2XD5 A;  4UA7 A;  2B95 A;  1MWU A;  3VE3 A;  4H8R A;  3QP4 A;  3C2W A;  5JYO A;  5A90 A;  2ZC6 B;  3HLF A;  3DWK A;  5HPF A;  2IWD A;  4ZJ2 A;  3P98 A;  4B4X A;  4R3A A;  4N92 A;  5GHX A;  2ZL1 A;  3S7N A;  2V0W A;  2ZBB A;  3IXG A;  2WGV A;  1GSX A;  4BMW A;  4N9L A;  4PM7 A;  4WZ4 A;  3D9Y A;  2IA2 A;  4E3J A;  4FH2 A;  2WYX A;  2C6W B;  3T4K A;  5CGX A;  3IX3 A;  3LIC A;  2KX6 A;  4JLF A;  4Y7P A;  4LV1 A;  4HQA A;  4LGW A;  3BEC A;  3NDE A;  3PYP A;  5M19 A;  2JC7 A;  5F82 A;  3O3V A;  1ERQ A;  2X01 A;  3C30 A;  3GRJ A;  4KZ9 A;  4GOG A;  3FZC A;  2Y2M A;  3JYI A;  2MJ6 A;  4LPZ A;  1S67 L;  1VB6 A;  1K4E A;  1VQQ A;  3OPL A;  5IU1 A;  4P85 A;  4P0M A;  2Y79 A;  3AGD A;  5HDC A;  3UB8 A;  4P6Z M;  1MC0 A;  1NY0 A;  5GHY A;  5HZH A;  3LR0 A;  1ONG A;  3S22 A;  2I72 A;  3ZG0 A;  4KZ3 A;  5HX9 A;  4ZBE A;  1N9B A;  3PXP A;  4MCW A;  3EGD C;  1ERM A;  1K54 C;  4PHT A;  3MZD A;  4CPK A;  3BJN A;  3BQ8 A;  2ZQ7 A;  2V1A A;  1L0G A;  4Y2F A;  4LRZ E;  3FYZ A;  5AVE A;  3ZFZ A;  1BLC A;  4GS9 A;  4ARZ B;  1I5Q A;  2M7U A;  1PI5 A;  4WM9 A;  2FZ0 A;  2VLG A;  1S6R A;  3ZHH A;  4PM8 A;  3EEA A;  2ZMF A;  1G68 A;  4XT2 A;  4Y13 A;  2KOI A;  4E6X A;  5FQK A;  2XFT A;  5FA7 A;  3OPP A;  4FCF A;  1J3W A;  4DMZ A;  3NC8 A;  1UWP X;  1TS0 A;  5EV0 A;  1YT4 A;  4I39 A;  3CPT B;  3PBQ A;  4IED A;  3MFD A;  1FCN A;  3QP8 A;  3RFB A;  2J8Y A;  2PU4 A;  4FSF A;  2A24 A;  3LEQ A;  1AXB A;  3KSF A;  2WKH A;  2ZC5 B;  3GSG A;  3IXH A;  3C8C A;  2XA7 M;  3CG5 A;  3CJM A;  2A3U A;  2V8F A;  2J80 A;  1G5U A;  1W7F A;  1K6S A;  2G2U A;  3RH8 B;  5GLB A;  1DP6 A;  4ZRR A;  3WS0 A;  1Z6F A;  2A49 A;  3MFX A;  4KG6 A;  1CI9 A;  1EI5 A;  2OLV A;  3C7V A;  1YLT A;  4JGO A;  1PZO A;  1VET B;  3H82 A;  1E4D A;  5FQ9 A;  3N8R A;  3F1P B;  3V3S A;  1OME A;  4F94 A;  4CJN A;  4JBF A;  4M3K A;  2K7S A;  2HDQ A;  2XR0 A;  1IKG A;  1H8Y A;  2Q9M A;  3MQQ A;  3U4L P;  1YKD A;  1HD8 A;  5CEC A;  2ZMA A;  1S4S A;  1VEU B;  1PIO A;  2KLI A;  4HJ6 A;  4WMC D;  3IXB A;  4RYE A;  3PHY A;  4ZAM A;  5FAT A;  2BG1 A;  4DXB A;  1T19 A;  5A91 A;  3W4O A;  4Y0T A;  1KVL A;  3T4T A;  4HH3 A;  3TSG A;  5F1F A;  2HDS A;  4MN6 A;  5CTN A;  3TG9 A;  1ZHH B;  1G6O A;  3P09 A;  2PAV P;  3DTK A;  5L10 A;  1KE0 A;  2Y2H A;  1H8M A;  3T4Q A;  5E2E A;  5EVE A;  3A0S A;  3RTY A;  4X69 A;  4EXO A;  2PR5 A;  3N4I A;  3KYE A;  2RL3 A;  4S2I A;  3ITB A;  2ZMV A;  4FOF A;  4BJP A;  3BFE A;  3CWF A;  4N9K A;  4PKY G;  2EWW A;  2JKR I;  3F1O A;  1MKI A;  2PR6 A;  1LI0 A;  3BQA A;  4OQG A;  4EWF A;  2QMI A;  3KSG A;  4N1X A;  4OQ0 A;  4OP5 A;  2PD8 A;  3S7O A;  5GLC A;  4FTX A;  2Y2N A;  1FOF A;  4G3V A;  1RGY A;  2JKT M;  1D7E A;  1YLJ A;  4HP4 A;  1SHV A;  3H7W A;  1CEG A;  1H5X A;  3GMW A;  5DF7 A;  1BLH A;  1JTD A;  1N9L A;  5DF8 A;  3QNB A;  4R6L A;  3QHY A;  5EE8 A;  2PYP A;  4GDN A;  5KMW A;  3NOP C;  1YSQ A;  4CLC B;  3CUE A;  3E98 A;  5FAP A;  1W8Q A;  4PM6 A;  4KQR A;  3E0Y A;  5J3W A;  4DE2 A;  5TGF A;  2Q0O A;  5F83 A;  3UPP A;  3VP3 A;  4ME4 A;  1SKO A;  3UB5 P;  3UDX A;  2CC1 A;  2ZD8 A;  5EVI B;  5EOE A;  1OT6 A;  3K3C A;  5EPH A;  1KGG A;  1D06 A;  5A8B A;  1QME A;  3MF0 A;  3UDI A;  5E43 A;  3IBR A;  2HV1 A;  2IWC A;  2XRN A;  1I2W A;  5HD3 A;  4OLD A;  1K0K A;  2VA0 A;  4YNR A;  3FKW A;  3G6O A;  1KGE A;  3BFF A;  5E2G A;  1OTD A;  2BLS A;  4MNR A;  2J9P A;  2Y2L A;  1S1Z A;  4C6Y A;  5FAS A;  4UAA A;  3JVU A;  3PBS A;  1NZU A;  3IH9 A;  2V9A A;  2QWS A;  3M6B A;  5TJJ A;  1FR1 A;  4RX2 A;  1ZC2 A;  4P6Z S;  1ALQ A;  4KG5 A;  5HWW A;  1EWZ A;  3HLG A;  3B47 A;  4OOM A;  3S7P A;  5FEG A;  2OAP 1;  4JF6 A;  4Y5F A;  3IF6 B;  3P7N A;  5BOH A;  1S0W A;  4OLG A;  1PWD A;  5G4Z A;  4WLA A;  3HLB A;  5CHJ A;  4X25 A;  4KEN B;  4BBT A;  1NXY A;  4PAU A;  2XD1 A;  2XRO A;  2EX6 A;  2PT7 A;  2WZX A;  4GB7 A;  5L07 A;  4DF6 A;  5CGW A;  2EWV A;  1NYM A;  2V1B A;  4E3N A;  1V9Y A;  3RXW A;  3BYD A;  3MKE A;  5HW3 A;  4X6T A;  2V20 A;  3ZGA B;  1E25 A;  1WYC A;  1DJC A;  5CXW A;  5I94 A;  2PDR A;  4IUH A;  1F98 A;  2OWJ A;  4RVA A;  4B4Z A;  5TBM A;  4ESP A;  3I7J A;  2OAQ 1;  3Q1F A;  3E2L A;  3JPU A;  3LY4 A;  3K2N A;  2XFS A;  4X53 A;  3T1X A;  3V5M A;  1DRM A;  4GD8 A;  2VJW A;  2QJ7 A;  5EVL A;  3S1Y A;  2XA7 S;  3NOT C;  4K08 A;  4S2N C;  1NWZ A;  3BW6 A;  3WS1 A;  2O9A A;  2P9V B;  5DKL A;  1M6K A;  4A5R A;  1W63 M;  4GKU A;  1FIL A;  4MBF A;  4H6J A;  2JE5 A;  4IBX A;  3UO9 A;  4M4X A;  4Y0O A;  4O8G A;  4DDS A;  1YPR A;  4JXS A;  3IX8 A;  1ES4 A;  5CEB A;  3GV9 A;  4FUW A;  1BLS A;  5DKK A;  5DTT A;  4UHU A;  3VP0 A;  2ZQ9 A;  4IVK A;  3T4L A;  1FCO A;  3O87 A;  1ESI A;  1PW1 A;  2H5S A;  4NG2 A;  4KQO A;  3T4S A;  4NXG A;  4B9O A;  4KUO A;  2Y2J A;  2V1Z A;  2WKR A;  3NOU C;  1W5D A;  4MLL A;  3S4X A;  3W4P A;  2B02 A;  3C4P A;  3AGE A;  5AQB A;  3IHB A;  4L9E A;  4B88 A;  4GHI A;  3IF5 A;  4EBN A;  4Y17 A;  3PBT A;  4XUZ A;  2Y2K A;  4S2P A;  2QPN A;  1GHP A;  4AFI A;  1T1A A;  1TEM A;  3ITA A;  1K56 D;  4GJ4 A;  2PRF A;  3B42 A;  5HFO A;  4EBL A;  2J3T D;  5FL3 A;  1ESU A;  2ZJ9 A;  2E8I A;  4ZJ1 A;  1GHM A;  3E4O A;  2DRW A;  1OTB A;  5M18 A;  1T18 A;  5A92 A;  2J9O A;  4EUZ A;  3KO6 A;  4JGP A;  1BT5 A;  3CLO A;  4EES A;  4MBH A;  1T1B A;  3N8L A;  2ZOI A;  1Z09 A;  2UWX A;  3Q7V A;  3PR6 A;  3NY4 A;  1CEF A;  4MMN A;  1FR6 A;  4JGR A;  4CQH A;  4R3J A;  3W2Z A;  2ZOH A;  1MWR A;  3SS4 A;  2WKE A;  2VGJ A;  3ZNY A;  4LLO B;  1SCW A;  2Y8H A;  4R4S A;  1WYB A;  2PBD P;  2LB5 A;  3NUL A;  3A0R A;  1PYY A;  2WUQ A;  5EEC A;  3EOI A;  3SS3 A;  4O01 A;  4L9G A;  4R23 A;  4X1M A;  2ZC4 B;  4GS9 B;  4PPR A;  5HDS A;  2OV5 A;  4I5S A;  2AVX A;  5J7E A;  3CHW P;  3OPR A;  4JKT A;  4LEN A;  4O7D A;  4WEJ A;  3MZF A;  3SH9 A;  4XT2 B;  1DJA A;  1GHI A;  1J9M A;  1K56 A;  3BY9 A;  4OPQ A;  4U0X A;  3WRZ A;  3S7Q A;  4S2N A;  4KZA A;  4BD0 A;  3IHA A;  3PTE A;  3MXR A;  5FQJ A;  5CER A;  1NZO A;  2R78 A;  3UDF A;  3UY6 A;  4HI4 A;  1FIK A;  1S66 L;  3IS2 B;  4ARZ A;  5HWV A;  3N6I A;  3NI9 A;  2HPB A;  1O07 A;  4X56 A;  5FQQ A;  4IBR A;  3CI6 A;  2ZQ8 A;  5E2H A;  5AVF A;  2Z2M B;  4LRY C;  4EQ1 A;  4QD4 A;  3C7U A;  3G2Z A;  3G31 A;  1F9I A;  4BL2 A;  4JF4 A;  1KDW A;  2Y4A A;  3TRC A;  5E2F A;  4X55 A;  5CHU A;  4RQ9 A;  3IBJ A;  4WL9 A;  1ODV A;  3LID A;  4R70 A;  3ZG9 B;  4RA7 A;  1YMS A;  5HWT A;  3T12 B;  1JTG A;  4L9F A;  4DE1 A;  3LCE A;  4BL3 A;  4CLC E;  5LBR A;  4HH2 A;  4CLC C;  3G4P A;  1BSG A;  2P08 A;  3MSH A;  3FKV A;  5M1A A;  3QP6 A;  2R9W A;  2EA9 A;  2W3F A;  3SH8 A;  3MBZ A;  4I3A A;  2LB9 A;  3FG8 A;  3BRM A;  3GQZ A;  1Y4O A;  4QB8 A;  2PD7 A;  4Y3I A;  1CK3 A;  3UE1 A;  5EVI C;  3E4Q A;  1TVF A;  1FSW A;  3GTC A;  3NCK A;  4G3W A;  3M6H A;  3LGO A;  1VET A;  2Y2G A;  2XH9 A;  2QJ5 A;  3DWZ A;  3HL9 A;  4Z1W A;  2HZ5 A;  2VGL M;  4YOF A;  1TDG A;  3M2K A;  2A2L A;  5HAR A;  1IYS A;  2XDM A;  4DJ2 A;  1IKI A;  4Q0J A;  1XX2 A;  4E3O A;  1FSY A;  5HDD A;  3SS5 A;  3T1S A;  3IXD A;  3DTM A;  2WGI A;  2YKF A;  1PW8 A;  3LY3 A;  3ZG5 A;  3SH7 A;  1W79 A;  1K54 A;  4EBP A;  4B93 A;  2P74 A;  3PBR A;  2ZM2 A;  3OOV A;  3UPO A;  2O9B A;  1F2K A;  1WE4 A;  2HP5 A;  2Z6D A;  4R0Q A;  3IF6 C;  1KOU A;  4HIA A;  3HUN A;  1ONH A;  3A3E A;  2ACG A;  1LL5 A;  3MR0 A;  3Q81 A;  2I9V A;  4N1H A;  2WAF A;  3A3F A;  3VP4 A;  3N7W A;  3DTE A; 
#chains in the Genus database with same CATH homology
 2PT7 A;  3D72 A;  3FC7 A;  3H82 B;  3TW8 A;  3IS2 A;  2IA2 A;  2EWV A;  2V1B A;  4EER A;  2PHY A;  3CUE C;  3FPW A;  1V9Y A;  3OCN A;  4R38 A;  3T4K A;  3BWL A;  1MKM A;  4NXF A;  4NEE D;  4PKY A;  3UB6 A;  3LIC A;  2KX6 A;  4HQA A;  3TJZ C;  5CX7 A;  1H3Q A;  3MXQ A;  3K3D A;  3HJK A;  3PYP A;  1XJ4 A;  5HPI A;  3CIT A;  3OC2 A;  1NLZ A;  4F3L B;  1MZU A;  4EET B;  3C30 A;  4OOL A;  2DMW A;  4HJ4 A;  2PDR A;  2W27 A;  4IUH A;  1X0O A;  2GJ3 A;  3D3O A;  2WKP A;  1F98 A;  2GNX A;  3KX0 X;  2MJ6 A;  4LPZ A;  2YKH A;  1S67 L;  3C38 A;  1VB6 A;  3PBN A;  2OWJ A;  5KIZ A;  4HNB A;  5TBM A;  5IU1 A;  1N9O A;  3P01 A;  4L0L A;  4WEL A;  2VX8 A;  2Y79 A;  2OAQ 1;  4BBU A;  5HDC A;  2W1T B;  4MN5 A;  2JHE A;  3T4J A;  5DJU A;  3UB8 A;  4P6Z M;  1MC0 A;  3T50 A;  5HZH A;  2QHK A;  4HHD A;  4QPR A;  3LR0 A;  3VE4 A;  2QKP A;  2GZA A;  3K2N A;  5MC7 A;  1DRM A;  3OCL A;  2VJW A;  2QJ7 A;  3PXP A;  4MCW A;  3EGD C;  3F1P A;  4NXB A;  2XA7 S;  4PHT A;  3JVV A;  3NOT C;  3B33 A;  4K08 A;  3BJN A;  3BQ8 A;  1OJG A;  1NWZ A;  3TE8 A;  3BW6 A;  1XJ3 A;  2O9A A;  5DKL A;  3NHQ A;  2HJ9 C;  3GDI A;  3R7W B;  2V1A A;  1S1Y A;  5G4Y A;  1GSV A;  3A0V A;  4Y2F A;  3VV4 A;  4LRZ E;  1W63 M;  3LI8 A;  3FPV A;  4H6J A;  1OTE A;  1OTA A;  1P9R A;  5AVE A;  4E04 A;  3HCY A;  4M4X A;  4O8G A;  2QYB A;  2P7J A;  4GS9 A;  4ARZ B;  2M7U A;  4HP9 A;  2FZ0 A;  2VLG A;  3LR5 A;  2K31 A;  1TS7 A;  2JN7 A;  5DKK A;  4DJ3 A;  4UQI S;  3EEA A;  2ZMF A;  3UE3 A;  1XFN A;  3OBF A;  1P0Z A;  4XT2 A;  3F1O B;  2O99 A;  2KOI A;  3T4L A;  4BBV A;  4HY8 A;  5C5K A;  4DMZ A;  3ICY A;  4KQO A;  3T4S A;  4NXG A;  4I3J A;  4LRX C;  3MMH A;  1UWP X;  4IUK A;  3UMD A;  4B9O A;  4EW7 A;  3LYX A;  1S4R A;  4KUO A;  1TS0 A;  2VEA A;  2WKR A;  3NOU C;  4CLC D;  1NLY A;  4WN5 A;  4I39 A;  4EEU A;  2B02 A;  2O9C A;  3PBQ A;  3UB9 A;  3RFB A;  4L9E A;  3ZQ5 A;  4I3I A;  3ZYT A;  4FSF A;  1LSX A;  5DF9 A;  3H7W B;  4GHI A;  1OT9 A;  2A24 A;  3MQO A;  4IJG A;  3PBT A;  4EUV A;  4AFI A;  3KSF A;  4ETX A;  1T1A A;  1YAX A;  3C8C A;  2XSS A;  3HJI A;  2XA7 M;  3EGX C;  4WEK A;  3U2A A;  4GJ4 A;  2J80 A;  3B42 A;  4II7 A;  2J3T D;  5FL3 A;  2WKQ A;  3E4O A;  1WA9 A;  3RH8 B;  1OTB A;  2K2N A;  1DP6 A;  4ZRR A;  1T18 A;  4IHQ A;  3MFX A;  2VV7 A;  2FH5 A;  3KO6 A;  4JGP A;  3CLO A;  2VV8 A;  4WF0 A;  4EES A;  1T1B A;  1LSW A;  2HF6 A;  3LIB A;  2ZOI A;  4I38 A;  5F5Y A;  5DFY A;  3E4P A;  4JGO A;  3H82 A;  3PR6 A;  3BY8 A;  1GSW A;  3F1P B;  2VKS A;  4UQI M;  4MMN A;  5F6A A;  4JGR A;  4CQH A;  3W2Z A;  2ZOH A;  3KSH A;  4HJ3 A;  2K7S A;  1LT0 A;  4LLO B;  2W3H A;  2Y8H A;  3MQQ A;  1YKD A;  2LB5 A;  4F3L A;  1S4S A;  3A0R A;  4MN7 A;  2KLI A;  4HJ6 A;  4CLC A;  3LFV A;  3EOI A;  4O01 A;  2OWH A;  3PHY A;  4L9G A;  2W3D A;  4KQD A;  4GS9 B;  5HDS A;  2M1C A;  4I5S A;  3LR4 A;  4ETZ A;  1T19 A;  5J7E A;  2W1R A;  4WEJ A;  2W1T A;  3VOL A;  1OTI A;  3F1N A;  4XT2 B;  2NUT C;  3T4T A;  4BWI A;  4HH3 A;  5DFX A;  1IOU A;  4DN0 A;  4MN6 A;  3EQV A;  2W3G A;  3BY9 A;  4NXE A;  1ZHH B;  1G6O A;  2VV6 A;  4JGQ A;  4UEY A;  3EQU A;  2D02 A;  3LUQ A;  3S7Q A;  2JKT I;  1UGU A;  3R7W A;  1XJ6 A;  2GX5 A;  4MDZ A;  5DJT A;  1TS6 A;  1H8M A;  2VZW A;  5AJG A;  2KDK A;  3T4Q A;  4NKP A;  4GHI B;  2R78 A;  3NJA A;  3A0S A;  2P04 A;  4HI4 A;  3RTY A;  4EXO A;  1EW0 A;  2PYR A;  1S66 L;  3IS2 B;  5J4E A;  2PR5 A;  1NRJ A;  4ARZ A;  1IFQ A;  5HWV A;  2O0Y A;  1STZ A;  2VGL S;  2ZMV A;  4FOF A;  3LIF A;  4BJP A;  3CWF A;  2NUP C;  3CI6 A;  5AVF A;  4PKY G;  4LRY C;  2EWW A;  4EQ1 A;  2JKR I;  3F1O A;  3UE6 A;  1F9I A;  3OLO A;  2PR6 A;  2H28 A;  5IT5 A;  3BQA A;  3TRC A;  2W3E A;  1UWN X;  3EEH A;  3KSG A;  2PD8 A;  3LIA A;  3S7O A;  4RQ9 A;  5TBM B;  3IBJ A;  1V9Z A;  4WL9 A;  1ODV A;  3LID A;  1TF1 A;  4R70 A;  4G3V A;  4Q0I A;  2JKT M;  1D7E A;  3KYQ A;  5HWT A;  2M7V A;  4WUJ A;  4HP4 A;  2L4R A;  3H7W A;  4L9F A;  3V67 A;  3LI9 A;  4CLC E;  1LL8 A;  1N9L A;  5LBR A;  1BYW A;  5K5B A;  4HH2 A;  4EU0 A;  4CLC C;  4R6L A;  2P08 A;  1JNU A;  2PYP A;  3NOP C;  1YSQ A;  4CLC B;  3CUE A;  3E98 A;  2EA9 A;  2W3F A;  2CMN A;  5L8M A;  4I3A A;  3MQ0 A;  2LB9 A;  3SW1 A;  3FG8 A;  1OJ5 A;  3E0Y A;  5J3W A;  2L1M A;  2PD7 A;  3O5Y A;  4Y3I A;  4YWZ A;  4H6J B;  1F5M A;  2JKR M;  4ME4 A;  3EWK A;  3E4Q A;  2HJE A;  1G28 A;  3F1N B;  1W63 Q;  5HD5 A;  4G3W A;  4BMW A;  1OT6 A;  3K3C A;  4KUK A;  5I5L A;  1D06 A;  2J3T C;  5A8B A;  2BAS A;  3MF0 A;  1P97 A;  1T1C A;  2QJ5 A;  4Z1W A;  2VGL M;  4YOF A;  1DP9 A;  3IBR A;  1DP8 A;  1ZTU A;  2HV1 A;  2A2L A;  2HGV A;  4HOI A;  1LSV A;  2XRN A;  4DJ2 A;  1VHM A;  2B18 A;  2D01 A;  4Q0J A;  5HD3 A;  4GW9 A;  2VA0 A;  4YNR A;  3G6O A;  4O0P A;  5HDD A;  1OTD A;  3CAX A;  5KSH A;  3MJQ A;  2YKF A;  1S1Z A;  3T4O A;  3UME A;  4EEP A;  5F68 A;  5HSQ A;  3KSI A;  1XJ2 A;  3UB7 A;  3PBO A;  3H9W A;  3JVU A;  3PBS A;  1TS8 A;  2INW A;  2V9A A;  4B93 A;  2QWS A;  2W0N A;  2OOL A;  3GEC A;  1XFQ A;  3PBR A;  5HL6 A;  5TJJ A;  3OOV A;  3DBA A;  2L0W A;  2A24 B;  2V0U A;  2Z6C A;  2J3W A;  3LIE A;  4GLQ A;  4P6Z S;  2O9B A;  1Y28 A;  2G7U A;  1YSP A;  2Z6D A;  5HWW A;  3B47 A;  3KYZ A;  4G3K A;  5IS1 A;  3R4K A;  4OOM A;  3S7P A;  1KOU A;  4HIA A;  2OAP 1;  1P9W A;  3LR3 A;  1N9N A;  4Q0H A;  4Y5F A;  3P7N A;  5F69 A;  5EFW A;  3VE3 A;  3C2W A;  3MR0 A;  5G4Z A;  4WLA A;  1OPX A;  2I9V A;  4GCZ A;  5HPF A;  1TD5 A;  4R3A A;  4BBT A;  4PAU A;  3ULF A;  2XRO A;  3S7N A;  2V0W A;  2ZBB A;  1GSX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...