3LI9A

Crystal structure of the extracellular domain of the putative histidine kinase mmhk1s-z2
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
262
structure length
262
Chain Sequence
KLAYEKSIEMAGNYANQFDAQMEANQAIARTLACTMAEYGSQDREEAMSIIKRILNENPQLIGVYLGYEPDAFDGRDKNYINAPGHDSTGRFVPYCNKINGPVIIEPLVHYDSSDYYQLPKTTGKDTLTEPYFYEGIFMVSYDSPIFKNGEFAGIAGVDVPLEYVDDVASSIRTFDTGYAFMVSNTGIFLSHPTQKNWIGEKSLSDFDVEEIKNAASDIREGIGGHVEIKDPITGKTVIMFYEPVKTGDFSFVLVVPKEEML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical sensory transduction histidine kinase
publication title Structural characterization of the predominant family of histidine kinase sensor domains.
pubmed doi rcsb
source organism Methanosarcina mazei
molecule tags Signaling protein
total genus 69
structure length 262
sequence length 262
ec nomenclature
pdb deposition date 2010-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02743 dCache_1 Cache domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3li9A01
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3li9A02
3ICYA 1D7EA 1EW0A 1ODVA 2PHYA 4H6JB 5DKLA 2I9VA 3GECA 2L0WA 1UWPX 2D01A 3IS2A 1LL8A 3A0SA 2R78A 1N9LA 3C8CA 2WKPA 5I5LA 3BY8A 2HV1A 4L9EA 4EEPA 2PYRA 4I5SA 4EQ1A 2QKPA 5HZHA 1XFNA 2ZOHA 5F6AA 5HDDA 3F1NB 3VE3A 1TS8A 4L9GA 3NOUC 3LIAA 2L4RA 1XJ3A 2GJ3A 2KDKA 3PHYA 5G4YA 4HNBA 4HH2A 3EEHA 1V9YA 1DP9A 4WL9A 3PYPA 5HWVA 4HOIA 2ZOIA 4LLOB 4I3IA 1V9ZA 1T1CA 1OT6A 3NOPC 2WKRA 5J3WA 3FC7A 1OTEA 3MQOA 1OTIA 1S67L 2KX6A 2PD7A 3UB7A 3C2WA 2A24A 4LRZE 4GHIB 1P97A 4LPZA 5DKKA 2QWSA 1TS6A 2Z6DA 4YWZA 2EA9A 4HH3A 5HDSA 4R3AA 3LUQA 4WUJA 3BWLA 4HJ3A 2ZBBA 2CMNA 4BBVA 4K08A 1TS0A 3A0VA 2QHKA 4NXBA 1TS7A 1S1ZA 2V0UA 2YKFA 3MJQA 4JGOA 4HP9A 3UB6A 1GSVA 3E4PA 4JGRA 4E04A 4L9FA 4KUKA 5HD3A 5HDCA 2K7SA 1JNUA 1LSXA 3H7WA 4GS9A 3A0RA 5IS1A 4WF0A 5F68A 3IS2B 2PR6A 1GSWA 2INWA 3H9WA 2V9AA 4JGPA 3MXQA 4NXEA 3LIBA 4EESA 2PR5A 3VOLA 2B02A 1WA9A 5J4EA 3OLOA 3ULFA 5HWTA 3NHQA 2V0WA 1UGUA 2WKQA 5HWWA 2W27A 4MN6A 5G4ZA 3LIFA 1UWNX 3ZQ5A 4F3LB 1OTBA 2VV8A 4EEUA 1S4SA 2OOLA 1S4RA 5HD5A 1N9OA 5J7EA 4M4XA 2JN7A 3F1OA 5F69A 4XT2B 4R6LA 2P7JA 1S66L 1T19A 4WN5A 1Y28A 1LT0A 3F1PA 2J80A 4GHIA 2BASA 5IU1A 4PKYA 2M1CA 4LRYC 4EW7A 4HIAA 3LIDA 1F98A 4B9OA 3KX0X 3K3DA 1OTAA 5TBMA 3K3CA 1LSWA 1OJ5A 2PYPA 3GDIA 2A24B 4DJ3A 3FG8A 3E4OA 3UB9A 4RQ9A 2D02A 1D06A 4EERA 3P7NA 1BYWA 5KIZA 1F9IA 1OJGA 4NXGA 4WLAA 4KUOA 4H6JA 3LI8A 3H82B 4I3AA 3G6OA 2H28A 3UE6A 2OWJA 1DP6A 3BY9A 3MQQA 3IBRA 5F5YA 1G28A 4HP4A 1LSVA 4I3JA 4MN5A 4JGQA 2VEAA 3B33A 1XJ6A 1T1AA 2QJ5A 3T50A 3F1NA 3VE4A 3UB8A 1OTDA 2L1MA 1S1YA 1N9NA 2VV6A 4HHDA 4BBTA 4PKYG 3H7WB 3LI9A 4GS9B 3EWKA 3UMEA 1VB6A 5DJTA 4F3LA 4LRXC 5AVFA 4I39A 4KQDA 1T18A 2QJ7A 2VLGA 1XJ2A 2YKHA 4GW9A 4DJ2A 2PDRA 5HSQA 4I38A 1T1BA 4HQAA 4XT2A 4BBUA 1XFQA 1GSXA 5EFWA 3HJIA 2V1BA 2VV7A 4HY8A 3CAXA 1MZUA 2W0NA 2PD8A 1XJ4A 1P0ZA 3MR0A 3F1OB 1DRMA 4NXFA 3SW1A 1NWZA 4HI4A 4HJ6A 4EXOA 3UMDA 1KOUA 3F1PB 5A8BA 3LICA 3MFXA 3NJAA 5AVEA 3LYXA 2JHEA 1X0OA 4GCZA 4R70A 3CWFA 2OWHA 3LIEA 3RH8B 4R38A 5DJUA 3HJKA 1OT9A 1DP8A 5TBMB 2V1AA 4HJ4A 3RTYA 3CLOA 3H82A 3E4QA 2Z6CA 4EETB 3NOTC 3D72A
chains in the Genus database with same CATH superfamily
1EW0A 3WS5A 4EV4A 2XFSA 5FQMA 3ZVWA 4NEED 3M6HA 3G2ZA 4EWFA 1UWPX 3IS2A 4YFMA 4OQIA 3M2JA 5HARA 2R78A 3NCKA 4Q0HA 4BLMA 1N9LA 2WGWA 3QNCA 4L0LA 3LO7A 3C8CA 2WKPA 5I5LA 3KYQA 4QY5A 5M18A 1W5DA 3UNWA 3HUNA 4I5SA 4DXCA 3HCYA 1ES5A 2GNXA 4E3NA 3F1NB 3V39A 5FQKA 4WELA 2FZ0A 3E0YA 1H0MA 5F1FA 2L4RA 5HL1A 2H5SA 3LR4A 3B3XA 3ZGAB 5G4YA 4XXRA 1ZHHB 4HH2A 4OONA 3T4OA 3VSLA 3IH9A 3ISGA 4BD0A 4UA9A 3PAGA 5HWVA 1V9ZA 1T1CA 2W3DA 1OT6A 4K91A 4ARZB 3NOPC 4FH4A 3DTMA 1KGGA 3T4LA 3CI6A 4ID4A 1G5UA 2C6WB 3O5YA 4H8RA 2KX6A 3NY4A 4E3IA 3BQAA 1P97A 2O0YA 3G2YA 1ZG4A 2A2LA 3BLSA 3QP4A 3IF6A 1ERQA 3N7WA 4HJ3A 3Q7VA 3L9KA 2IWBA 5DF9A 3UDXA 4LCMA 2CMNA 5CGXA 3PR6A 1K25A 1MWTA 3R7WB 1TS0A 2EX6A 2QHKA 1P9WA 1TS7A 3RXWA 2K31A 3ZG5A 2XA7S 1Y4OA 3LR0A 3MJQA 5EE8A 3T4JA 3PBTA 4E3MA 2XDMA 4YOFA 2X01A 3CG5A 1N9BA 1MC0A 4BQMA 3S22A 3IWOA 3BFDA 1YSQA 2K7SA 4CLCB 2ZMFA 4R4SA 4HESA 1K56A 1PZPA 2DMWA 1MXOA 3H7WA 3IF6C 3LEZA 3TJZC 5IS1A 2H0TA 1NYMA 4Q0JA 4G3VA 3SH7A 2WUQA 4QPRA 3D9YA 3NECA 3FYZA 2I72A 1L3LA 4CLCD 1DJBA 3ULFA 5HWTA 3D3OA 3LGOA 1UGUA 2W27A 5G4ZA 3FKWA 1W63Q 1UWNX 1CEGA 3BM6A 5E2GA 3C30A 1XKZA 4OPQA 3BLMA 3PBOA 4U3TA 4EEUA 3KSIA 1CJFA 1F2KA 4MBHA 1ES3A 3UE1A 5HD5A 4R3JA 1Z09A 1RGZA 4N92A 5F69A 5FQJA 1WE4A 1IOUA 5K5BA 4WN5A 1Y28A 2QMIA 3SZTA 3F1PA 4FUWA 3IBJA 3P09A 4MN7A 5CTMA 4YNRA 3HLGA 2WKHA 4WM9A 3KO6A 1I2WA 4JXVA 4QU3A 5TBMA 1LHYA 4MEZA 4DE2A 1BLSA 4O8GA 2PYPA 3T1QB 5EPHA 4MLLA 4XUZA 5CERA 3LCEA 1TF1A 1XGIA 4O01A 5HAIA 1BULA 4EERA 2C5WB 4EBLA 4WLAA 1PWCA 3WS1A 3W4PA 4P87A 4KUOA 3H82B 1GCEA 2ZC3B 2OWJA 3C38A 2VA0A 3WWXA 3JYIA 4WYYA 2W1TB 2JE5A 1W63M 1PRQA 3VOYA 3QHYA 4HP4A 4I3JA 4MN5A 2Y91A 5FQ9A 3S1YA 3PBNA 4D2OA 1HVBA 1T1AA 1IKIA 2JKTI 3T50A 3V5MA 4GDBA 4KZ7A 5TJJA 2WKEA 1PI4A 5FL3A 1XA1A 3A3JA 4PKYG 4R1GA 3QP5A 4LRXC 5JYPA 3CPTA 5J8XA 5AVFA 2XD5A 3G35A 4GNUA 4IBRA 1T18A 1PFLA 1XJ2A 2J8YA 1QMEA 2YKHA 4E6XA 4IVIA 5HSQA 2FH5A 5FI7A 4PAUA 4BBUA 2JKFA 1GSXA 3MKFA 3HJIA 4UA6A 1W8QA 3CAXA 3WS0A 1MWSA 1XJ4A 4OQHA 5DTKA 3MR0A 4Y17A 5HAQA 1ONGA 4NXFA 2HJ9C 2LB5A 1KGEA 1BSGA 2Y2NA 1CEFA 5EV0A 5HW3A 2W3FA 4KQOA 3MFXA 1K6RA 5AVEA 1YQSA 3TG9A 5M1AA 4GJ4A 3LIEA 4QY6A 3HJKA 4PM9A 4EU0A 3QP6A 1FCOA 1JVJA 4OP5A 1TD5A 5CECA 5FQIA 3KSHA 3CLOA 1KE3A 4Z1WA 3H82A 4Y3IA 4IJGA 1NRFA 1H5XA 3MS6A 3D72A 5EM1A 1G68A 4S2LA 3ICYA 3Q81A 4R0QA 1D7EA 2PHYA 4H6JB 3I7JA 3N8LA 2Y2QA 3GECA 3D4FA 2D01A 1CF0A 1LL8A 3VOZA 5EVIB 5FAOA 3PBSA 4CQHA 5GHXA 4X1MA 3P98A 5L09A 5E43A 3BY8A 3W4QA 4L9EA 4EEPA 5TR7A 2QKPA 5HZHA 2J9PA 4IHQA 1PIOA 2ZQAA 3V3SA 3VE3A 5DVAA 1TS8A 2VX8A 3C5AA 3LR5A 5EVID 3IXGA 2PU2A 3MQ0A 4MMNA 1ES4A 1FIKA 3E98A 1XJ3A 3E2KA 4NK3A 1XXMA 2KDKA 2XGNA 2ZMAA 5GLBA 3QP1A 4X53A 2Y2OA 1YLTA 1ZC2A 2WGVA 4WL9A 1MWRA 5L8MA 4Y15A 3GRJA 2Y2MA 4LLOB 4OLGA 1IFQA 2ZL1A 1GA9A 1KVMA 1I5QA 3R4KA 3G34A 3PAEA 4ETXA 2ZC6B 1OTEA 1S67L 3T12B 2AVXA 1S0WA 4Q0IA 3UB7A 1E4DA 4O0PA 4LPZA 5DKKA 2QWSA 3PXPA 1TS6A 2Z6DA 4YWZA 5HDSA 1NYYA 1IYSA 2VK3A 3K2NA 2EFUA 4UHUA 3M6BA 3CMZA 5DTSA 3BYDA 4HEFA 4BENA 1FCMA 4KG2A 3BECA 5FAPA 5FASA 2WZZA 2KOIA 1KGFA 1S1ZA 4GKUA 4KG6A 4UEYA 3JVUA 3G32A 2W1RA 1IKGA 2YKFA 2JBFA 1VETA 3UB6A 1BLPA 4JGRA 4WEKA 2O9AA 4B4ZA 2KLIA 2Z2LB 4S2OA 2ZD8A 3JPUA 3LY3A 1K54A 3A3DA 1JNUA 1IELA 3NULA 2Y2KA 3OCLA 2HP6A 1LSXA 4RX3A 5DF7A 4X55A 3AGDA 1L2SA 4WMCA 3IXHA 2JKGA 2ZQCA 2G7UA 5EVLA 2FFFB 1LL5A 2V9AA 3IWQA 4K0WA 4JGPA 3MXQA 1CQAA 1IEMA 2R9WA 1H8YA 4JF4A 5GHZA 2PR5A 4LV0A 2EWWA 2B02A 3VOLA 1JTGA 5J4EA 1RCJA 3MFDA 4ZAMA 2IWCA 2RCXA 5HWWA 4MN6A 1KVLA 3ZG7B 4LCLA 3RFBA 1PYYA 2J3TC 2VV8A 1CI9A 5A91A 2RL3A 1L0FA 4KG5A 1N9OA 1MBLA 3MXRA 1K56D 5J7EA 4M4XA 1H8MA 1K54C 1VQQA 1XPBA 3F1OA 2W3HA 3FWLA 4E3KA 4R6LA 2P7JA 3N6IA 3O88A 1S66L 4MNRA 1T19A 2P74A 4FH2A 2HJEA 3HLDA 2J80A 4GN2A 4RX2A 4IEDA 2CC1A 5IU1A 2M1CA 4WZ4A 1PNEA 3S7PA 3LIDA 1F98A 4B9OA 4X1LA 3FKVA 1XA7A 3HLFA 1OTAA 2PBYA 3UE3A 4N9KA 3ZG9B 4Y0OA 1BT5A 3K3CA 3NIAA 2A24B 4HBTA 3EOIA 3V3RA 3E4OA 1CK3A 4P0MA 3NBLA 3V67A 3EGXC 4PPRA 1JWZA 3MZEA 1P9RA 1Q2PA 3IF5A 1OJGA 2XEPA 3CUEA 4S2IA 3G6OA 3UE6A 4X25A 4QB8A 1BLHA 2WK0A 2E8IA 3UPPA 1DP6A 1MWUA 3BY9A 1JWVA 3MQQA 2Y2LA 2EXAA 5F5YA 4S2PA 3UO9A 5FEGA 4KZ8A 5CHUA 3HUMA 4BD1A 4AFIA 2VEAA 4JF6A 3IT9A 3BW6A 4KZ6A 4Z9QA 1XJ6A 4A5RA 3FPWA 1YLZA 3F1NA 1WYCA 2DCFA 2Y2JA 1OTDA 2L1MA 4MBKA 5D3OA 3BEBA 1N9NA 5FDHA 4GD6A 4GS9B 3EEAA 3WRZA 3CITA 2Y79A 3EWKA 2M7UA 3UMEA 2ZLYA 3HBRA 2Y2PA 1VB6A 4OQGA 2JKTM 2ZQ9A 3CUEC 3O87A 3S7NA 1E3UD 3VP4A 5GLCA 1SHVA 4P6ZS 4UA7A 4BMWA 1NRJA 5TFQA 2VLGA 5AQBA 2FFYA 3DAVA 4ARZA 4I38A 4HQAA 4ZJ1A 2QZ6A 1ZG6A 1VEUB 4ETZA 4C6YA 3SH9A 4HY8A 1CI8A 4WBGA 3BQ8A 1EWZA 4ZTKA 2Q0OA 2PD8A 5HX9A 1BTLA 1P0ZA 1SKOB 3BFGA 4RVAA 3UDFA 1NWZA 4HJ6A 4OOMA 1YPRA 3UPNA 5E2EA 2HGVA 2GDNA 2W3GA 4IUKA 3IXBA 2ZM2A 3VFFA 1ZKJA 3LICA 5GLAA 3NJAA 4X69A 2JHEA 1EI5A 4MBFA 4DF6A 3R7WA 3ITAA 3A3IA 3RH8B 2HZ5A 4E3JA 3S4XA 4QWOA 4Y0TA 1GA0A 1K55A 2PT7A 3ZYTA 2HDUA 2Q9NA 3RTYA 4DN0A 3JVVA 3E4QA 3HLEA 3IWIA 1NY0A 5IT5A 1NLZA 1ACFA 2XQZA 3HLCA 1PWDA 3T4KA 4CLCA 3LFVA 5U47A 3VP1A 1K6SA 1Z6FA 3N4IA 3IHBA 3W4OA 2Y4AA 3N8RA 1A0KA 1MKMA 2L0WA 5F82A 3T4TA 3A3EA 3NDGA 2GZAA 2Q9MA 4QJGA 1OMEA 2EFXA 2K2NA 1DY6A 2HV1A 5E2FA 4EQ1A 1K55C 1JTDA 4XUXA 1XFNA 1O7EA 2G2UA 5HDDA 3SS5A 4ZRRA 5GL9A 1H8ZA 3UN7A 4F94A 1LLBA 2IA2A 4G3WA 2GJ3A 4CLCC 4DXBA 4JBFA 3WRTA 5FDSA 3RJUA 1EROA 3U4LP 1MKIA 3EEHA 1DP9A 3QP2A 1PW8A 2HDSA 4D60A 3BFCA 2ZOIA 1L0EA 1DJAA 2BTFP 4II7A 1ESUA 2PRFA 5EVEA 1F5MA 4Y13A 3SOIA 3MQOA 2HP9A 5CRFA 2PD7A 4P85A 3C2WA 1ONHA 1MPLA 5F83A 4LRZE 4GHIB 5HAPA 2V8CA 3B42A 5FA7A 4QHCA 2PBDP 1IYPA 2BG1A 4ME4A 2EA9A 4HH3A 5E2HA 4LENA 4R3AA 4N9LA 1K57A 3IH8A 3LUQA 4FOFA 3G30A 2OSUA 5G18A 2PAVP 3BWLA 2ZBBA 3GSGA 1PW1A 3MSHA 3A3FA 4C75A 2B18A 4BBVA 4M3KA 5HPFA 4K08A 2P08A 5L10A 2EX9A 5KMWA 2W1TA 2V0UA 4PMAA 4OH0A 2P9VB 4HP9A 3GV9A 3E4PA 3UB5P 2V8FA 4PM7A 1MY8A 3SH8A 4OLDA 4E04A 1K0KA 3ZCZA 4KUKA 4K0XA 4DMZA 1H3QA 1K57C 3ZDJA 4ZDXA 1Q2QA 3FPVA 4WF0A 4CJNA 3IS2B 2PR6A 1GSWA 4KZBA 4N1XA 2VKSA 4B88A 3TW8A 1W79A 1KE4A 4EESA 5L2FA 2WGWB 3QNBA 3TOIA 1WA9A 4R3BA 3OLOA 5KZHA 4FTXA 4MDZA 2XA7M 4BL2A 5DFYA 1FILA 2WKQA 3IXDA 3EGDC 1JWPA 3LIFA 4LV1A 2ZC7A 3ZQ5A 4EBPA 4F3LB 1W8YA 2Y2IA 2EWVA 1DJCA 5IHVA 4GB7A 1S4RA 2ZC5B 4GLQA 4RYEA 4YINA 4OPZA 4NETA 2JN7A 4Q8IA 5C5KA 4QD4A 1XX2A 2HDQA 2WAEA 5BOHA 2IWDA 3VMAA 2H10A 1RGYA 5L07A 5CGWA 1HLUP 3NC8A 4GOGA 2WYXA 4GHIA 3OPHA 5FI2A 1STZA 4PM5A 1VHMA 4O7DA 2H0YA 4LRYC 5FQQA 4EW7A 4HIAA 1LI0A 2ZMVA 3KX0X 3IX4A 3DTKA 1YT4A 1OJ5A 4PM6A 1NZUA 4JXSA 1ESIA 4IVKA 1S6RA 4G3KA 4EQIA 5GLDA 4FSFA 4X6TA 4X68A 2D02A 3IF6B 3GTCA 3Q7VB 3MMHA 2V2FF 1F9IA 4BL3A 4DRTA 4H6JA 3LI8A 4I3AA 4IBXA 2H28A 4OPYA 1YMSA 3BJNA 4UQIS 2B95A 4GDNA 5FI6A 3MBZA 4IUHA 1TVFA 5EOOA 5EVIA 2OLUA 1LSVA 4GZBA 1GHPA 1FSWA 2XROA 5CEBA 4JGQA 4OKPA 3VP3A 4DE3A 3B33A 1ALQA 2W3EA 4E3LA 5F1GA 4FCFA 2EXBA 5FATA 3C4PA 5HFOA 3KYEA 3EQVA 3VE4A 1SDNA 3WS2A 3Q82A 1S1YA 4HHDA 4BJPA 3H7WB 3LI9A 2P04A 3W8KA 1FQGA 2X02A 2WADA 2J7VA 4OQ0A 1M40A 4PHTA 5DJTA 4F3LA 2B5RA 3RXXA 1N4OA 3BRMA 3PBRA 4DKIA 4Y7PA 3OOVA 4KQDA 2QJ7A 2BLSA 4PM8A 3EQUA 4P6BA 5EVIC 2A49A 4DJ2A 2PDRA 2Z2MB 2ACGA 2VV7A 5AQAA 1TDGA 5TGFA 1MZUA 3CJMA 3MXSA 1YLJA 4RA7A 4KZ9A 4NKPA 1DRMA 3LEQA 3DWKA 3SW1A 3GMWA 1GHIA 4EXOA 2UV0E 4R23A 2ZQDA 3PBQA 4KQQA 1C3BA 1K38A 1KOUA 3F1PB 2NUPC 3E2LA 1AXBA 3LYXA 1Y54A 2HF6A 1RP5A 1YSPA 4LV2A 4R70A 2OWHA 3UDIA 2JKRI 4R38A 4S2NA 2NUTC 5DJUA 3IX8A 1DP8A 5TBMB 3Q07A 5EUAA 2OAQ1 1YM1A 3LR3A 2VGLS 3ZFZA 5MC7A 1YKDA 2WGIA 2MJ6A 5CTNA 4UAAA 2Z6CA 4Y2FA 4C3QA 4EETB 3KSGA 3NOTC 2OLVA 3HL9A 5HPIA 1I2SA 3GQZA 3MF0A 3Q1FA 2V1ZA 1G6OA 3M2KA 1ODVA 1XP4A 5DKLA 1FSYA 4X56A 2I9VA 4LV3A 2JCHA 4S2KA 3A0SA 5JYOA 3OZHA 4JLFA 1PWGA 1BZAA 1K4FA 4S2NC 5CEDA 2PYRA 1KDSA 5A90A 3T1RA 5A92A 4DDYA 2ZOHA 5F6AA 1LI9A 1BUEA 4S2MA 1FR1A 3OPPA 4GD8A 4L9GA 3NOUC 4KQRA 2QYBA 3LIAA 2PU4A 3HVFA 1FCNA 2XRNA 4OVDA 4B4XA 3PHYA 3T4QA 4U0XA 2ZC4B 4HNBA 4KZ5A 1V9YA 3CPTB 3AGEA 3PYPA 3ZG8B 4HOIA 3IX3A 4I3IA 1BLCA 4HBUA 1XGJA 2WKRA 1AWIA 3DTEA 2WZXA 3FC7A 5J3WA 1IYOA 1LL9A 1OTIA 2J3WA 3DW0A 2XR0A 3UE0A 2V20A 4DDSA 4EUZA 2A24A 4OOYA 1KDWA 4ESPA 1ES2A 3L7HA 3KSFA 4WUJA 5CHJA 1J9MA 3DBAA 3C4OA 4JXWA 1O07A 2EX2A 2ZJ9A 2QPNA 3HUOA 3VFHA 1L0DA 4NG2A 5GHYA 3OPRA 5DFXA 4DE0A 3A0VA 1G6AA 4FD8A 4JKTA 4NXBA 2Y8HA 2O9CA 2XFTA 2UWXA 2WKIA 2ZQ7A 4JGOA 3OC2A 1GSVA 5KSHA 1QMFA 4OOLA 3C7UA 4L9FA 1FR6A 4LFUA 4WEJA 5CX7A 5FEFA 3BFFA 5HDCA 5HD3A 3S7OA 1E3UA 3OCNA 2XH9A 2Y2HA 3HLBA 3ZG0A 1SCWA 3GVBA 1J3WA 2OAP1 3VV4A 4GS9A 3A0RA 4EUVA 3AGFA 3OPLA 5F68A 2INWA 3H9WA 2Y55A 3VP2A 1TDLA 4NXEA 3LIBA 3SS3A 5A93A 2XSSA 5LBRA 3PTEA 5CGSA 3NHQA 2V0WA 3TSGA 4B93A 2VGKA 2ZQ8A 3FZCA 4Y0UA 2XD1A 1YLYA 1KE0A 4UQIM 1OTBA 4KZ4A 1VEUA 3P01A 4KZ3A 1S4SA 4JPMA 2OOLA 5DTTA 2HP5A 1SZVA 1SKOA 1E25A 4XT2B 4ZJ3A 1NLYA 3O3VA 4U0TA 5FSRA 2Y59A 5AQ9A 1TEMA 3BFEA 3V50A 1LT0A 1HZOA 3GR2A 3WS4A 2XLNA 3UY6A 5EECA 2VZWA 1K4EA 3T4SA 2BASA 2ZL1B 1VM1A 4PKYA 2WAFA 3K3DA 4KENB 1M6KA 1LSWA 2HDRA 4MCWA 1FOFA 3GDIA 3ZNYA 3KYZA 3O86A 4DJ3A 2A3UA 3SS4A 1NXYA 5FAQA 3FG8A 2VJWA 4BWIA 3MZDA 3HREA 3MKEA 5AQ7A 3UB9A 4RQ9A 3QP8A 3LY4A 1D06A 3ZNTA 3NI9A 2HPBA 2O99A 5DF8A 3P7NA 1BYWA 5KIZA 4NXGA 1SKFA 1NZOA 1YAXA 3FV7A 4CLCE 3B47A 3VSKA 4LGWA 4R4RA 4KZAA 3DTIA 3CZDA 3IBRA 3IHAA 3TE8A 1G28A 2E8JA 3S7QA 3T1XA 4Y5FA 3MZFA 1OPXA 2DNSA 4ZBEA 3N8SA 1VETB 4JXGA 2JC7A 4ZJ2A 5AJGA 4EBNA 2QJ5A 3UB8A 3ZHHA 1YLWA 4N1HA 2GX5A 2X71A 2VV6A 4S2JA 4BBTA 2VGLM 1PZOA 1YMXA 2J3TD 4E6WA 1GHMA 5CXWA 2G2WA 4DE1A 2J9OA 3W2ZA 4I39A 4OPRA 1WYBA 2LB9A 4GW9A 3Q7ZA 1ERMA 1T1BA 4XT2A 3ZVTA 4WMCD 1XFQA 5EM0A 5EFWA 3CHWP 1ZTUA 2V1BA 3HLWA 1IYQA 2XK1A 3OBFA 5HL6A 2EX8A 2XF3A 2W0NA 2O9BA 1SDEA 1L0GA 4WZ5A 4JF5A 3F1OB 3NDEA 1YLPA 1U60A 2ZM8A 3VP0A 4HI4A 5KSCA 1NJ4A 3T1SA 1PI5A 2VGJA 4E3OA 3UMDA 2ZM0A 5A8BA 1HTZA 4CPKA 3U2AA 2R9XA 1W7FA 2Y2GA 2DRWA 3C7VA 1X0OA 4P6ZM 4GCZA 2OV5A 5EOEA 3CWFA 3DWZA 2M7VA 1OT9A 4OP8A 3TRCA 2V1AA 4HJ4A 2P9VA 1D1JA 3ITBA 5CHMA 1HD8A 5M19A 2JKRM 3G31A 5I94A 4WZ5C 3G4PA 3UPOA 3IQAA
chains in the Genus database with same CATH topology
3ICYA 1D7EA 1EW0A 1ODVA 2PHYA 4H6JB 5DKLA 1MKMA 4NEED 2I9VA 3GECA 2L0WA 1UWPX 2D01A 3IS2A 1LL8A 3A0SA 3T4TA 2GZAA 2R78A 3PBSA 4Q0HA 1N9LA 4CQHA 4L0LA 3C8CA 2K2NA 2WKPA 5I5LA 3KYQA 3BY8A 2HV1A 4L9EA 4EEPA 2PYRA 4I5SA 4EQ1A 2QKPA 5HZHA 1XFNA 2ZOHA 3HCYA 4IHQA 5F6AA 2GNXA 5HDDA 3F1NB 3VE3A 4ZRRA 1TS8A 4L9GA 2VX8A 3NOUC 3LR5A 4WELA 2FZ0A 2IA2A 3E0YA 3MQ0A 2QYBA 4G3WA 3LIAA 4MMNA 2L4RA 3E98A 1XJ3A 2GJ3A 3LR4A 4CLCC 2KDKA 2XRNA 3PHYA 3T4QA 5G4YA 1ZHHB 4HNBA 4HH2A 3T4OA 3EEHA 1V9YA 1DP9A 4WL9A 5L8MA 3PYPA 5HWVA 4HOIA 2ZOIA 4LLOB 4I3IA 1V9ZA 1IFQA 4II7A 1T1CA 2W3DA 1OT6A 4ARZB 3NOPC 2WKRA 3R4KA 4ETXA 1F5MA 5J3WA 3FC7A 3T4LA 1OTEA 3MQOA 3CI6A 1OTIA 2J3WA 1S67L 3O5YA 2KX6A 2PD7A 4Q0IA 3UB7A 3C2WA 2A24A 4LRZE 3BQAA 1P97A 2O0YA 3B42A 4GHIB 4LPZA 2QWSA 4O0PA 3PXPA 1TS6A 2Z6DA 4YWZA 4ME4A 2EA9A 4HH3A 5HDSA 4R3AA 2A2LA 3KSFA 3K2NA 3LUQA 4FOFA 4WUJA 3DBAA 3BWLA 4HJ3A 2ZBBA 5DF9A 2CMNA 3PR6A 2B18A 4BBVA 3R7WB 5HPFA 4K08A 1TS0A 5DFXA 3A0VA 2P08A 2QHKA 1P9WA 2KOIA 4NXBA 2Y8HA 2W1TA 1TS7A 2O9CA 1S1ZA 2V0UA 4UEYA 2K31A 3JVUA 2XA7S 2W1RA 2YKFA 3LR0A 3MJQA 4JGOA 4HP9A 3T4JA 3UB6A 3OC2A 3PBTA 1GSVA 3E4PA 4YOFA 5KSHA 4JGRA 4WEKA 2O9AA 4OOLA 4E04A 2KLIA 1MC0A 4L9FA 4WEJA 5CX7A 4KUKA 5HD3A 5HDCA 3S7OA 3OCNA 1YSQA 2K7SA 4CLCB 2ZMFA 1JNUA 4DMZA 1H3QA 3OCLA 1LSXA 2DMWA 2OAP1 3H7WA 3VV4A 4GS9A 3A0RA 3TJZC 4EUVA 3FPVA 4WF0A 5IS1A 5F68A 4Q0JA 4G3VA 2G7UA 3IS2B 2PR6A 1GSWA 2INWA 3H9WA 2V9AA 4QPRA 2VKSA 4JGPA 3MXQA 3TW8A 4NXEA 3LIBA 4EESA 2PR5A 2EWWA 4CLCD 2B02A 3VOLA 1WA9A 2XSSA 5LBRA 3OLOA 5J4EA 4MDZA 2XA7M 3ULFA 5DFYA 5HWTA 3NHQA 2V0WA 3D3OA 1UGUA 2WKQA 4B93A 5HWWA 2W27A 3EGDC 4MN6A 5G4ZA 3LIFA 1W63Q 1UWNX 3RFBA 4UQIM 3ZQ5A 4F3LB 1OTBA 3C30A 3P01A 2EWVA 2J3TC 2VV8A 3PBOA 4EEUA 3KSIA 1S4SA 2OOLA 1S4RA 4GLQA 5HD5A 1N9OA 5J7EA 4M4XA 2JN7A 1H8MA 3F1OA 2W3HA 5F69A 5C5KA 4XT2B 1NLYA 4R6LA 2P7JA 1IOUA 5K5BA 1S66L 1T19A 4WN5A 1Y28A 1LT0A 2HJEA 3F1PA 3IBJA 2J80A 4GHIA 4MN7A 2VZWA 4YNRA 3T4SA 1STZA 2BASA 1VHMA 5IU1A 4PKYA 2M1CA 4LRYC 4EW7A 3S7PA 4HIAA 3LIDA 1F98A 3KO6A 4B9OA 2ZMVA 3K3DA 3KX0X 1OTAA 3UE3A 5TBMA 3K3CA 1LSWA 4MCWA 1OJ5A 4O8GA 2PYPA 3GDIA 3KYZA 2A24B 4DJ3A 3EOIA 3FG8A 4G3KA 2VJWA 4BWIA 3E4OA 4FSFA 1TF1A 3UB9A 4RQ9A 2D02A 3V67A 1D06A 4O01A 3EGXC 4EERA 2O99A 3MMHA 3P7NA 1BYWA 1P9RA 5KIZA 1F9IA 1OJGA 4NXGA 4WLAA 4KUOA 1YAXA 4H6JA 3LI8A 3CUEA 3H82B 4I3AA 3G6OA 4CLCE 2H28A 3UE6A 3B47A 3BJNA 4UQIS 2OWJA 3C38A 2VA0A 1DP6A 3BY9A 3MQQA 2W1TB 4IUHA 1W63M 3IBRA 5F5YA 3TE8A 1G28A 4HP4A 3S7QA 1LSVA 4I3JA 2XROA 4MN5A 4Y5FA 1OPXA 4AFIA 4JGQA 2VEAA 3B33A 3PBNA 2W3EA 3BW6A 5AJGA 1XJ6A 1T1AA 2JKTI 3FPWA 2QJ5A 3T50A 3EQVA 3F1NA 3VE4A 3UB8A 5TJJA 1OTDA 2L1MA 1S1YA 2GX5A 5FL3A 1N9NA 2VV6A 4HHDA 4BJPA 4BBTA 4PKYG 3H7WB 2VGLM 3LI9A 2P04A 4GS9B 3EEAA 3CITA 2J3TD 2Y79A 3EWKA 2M7UA 3UMEA 4PHTA 1VB6A 5DJTA 4F3LA 4LRXC 2JKTM 3CUEC 3S7NA 3PBRA 5AVFA 3W2ZA 3OOVA 4I39A 4KQDA 1T18A 2QJ7A 4P6ZS 1NRJA 4BMWA 2VLGA 1XJ2A 3EQUA 2YKHA 2LB9A 4GW9A 4ARZA 4DJ2A 2PDRA 2FH5A 5HSQA 4I38A 1T1BA 4HQAA 4PAUA 4XT2A 4BBUA 1XFQA 1GSXA 5EFWA 1ZTUA 3HJIA 2V1BA 2VV7A 4ETZA 4HY8A 3OBFA 3CAXA 5HL6A 1MZUA 3BQ8A 2W0NA 2O9BA 2PD8A 1XJ4A 1P0ZA 3MR0A 3F1OB 4NKPA 5DKKA 1DRMA 4NXFA 3SW1A 1NWZA 2HJ9C 2LB5A 4HI4A 4HJ6A 4OOMA 2HGVA 4EXOA 2W3GA 3PBQA 4IUKA 3UMDA 1KOUA 3F1PB 5A8BA 2W3FA 2NUPC 3LICA 4KQOA 3MFXA 3U2AA 3NJAA 5AVEA 3LYXA 2JHEA 2HF6A 1X0OA 1YSPA 4P6ZM 3R7WA 4GCZA 4R70A 3CWFA 4GJ4A 2OWHA 3LIEA 3RH8B 2JKRI 2M7VA 4R38A 2NUTC 5DJUA 3HJKA 1OT9A 1DP8A 5TBMB 4EU0A 3TRCA 2V1AA 2PT7A 2OAQ1 4HJ4A 3ZYTA 1TD5A 3LR3A 2VGLS 3KSHA 3RTYA 3CLOA 3JVVA 4Z1WA 4DN0A 1YKDA 5MC7A 3H82A 3E4QA 4Y3IA 2MJ6A 2Z6CA 4Y2FA 4IJGA 5IT5A 1NLZA 4EETB 3KSGA 3NOTC 5HPIA 2JKRM 3D72A 3T4KA 3MF0A 4CLCA 3LFVA 1G6OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ICY A;  1D7E A;  1EW0 A;  1ODV A;  2PHY A;  4H6J B;  5DKL A;  2I9V A;  3GEC A;  2L0W A;  1UWP X;  2D01 A;  3IS2 A;  1LL8 A;  3A0S A;  2R78 A;  1N9L A;  3C8C A;  2WKP A;  5I5L A;  3BY8 A;  2HV1 A;  4L9E A;  4EEP A;  2PYR A;  4I5S A;  4EQ1 A;  2QKP A;  5HZH A;  1XFN A;  2ZOH A;  5F6A A;  5HDD A;  3F1N B;  3VE3 A;  1TS8 A;  4L9G A;  3NOU C;  3LIA A;  2L4R A;  1XJ3 A;  2GJ3 A;  2KDK A;  3PHY A;  5G4Y A;  4HNB A;  4HH2 A;  3EEH A;  1V9Y A;  1DP9 A;  4WL9 A;  3PYP A;  5HWV A;  4HOI A;  2ZOI A;  4LLO B;  4I3I A;  1V9Z A;  1T1C A;  1OT6 A;  3NOP C;  2WKR A;  5J3W A;  3FC7 A;  1OTE A;  3MQO A;  1OTI A;  1S67 L;  2KX6 A;  2PD7 A;  3UB7 A;  3C2W A;  2A24 A;  4LRZ E;  4GHI B;  1P97 A;  4LPZ A;  5DKK A;  2QWS A;  1TS6 A;  2Z6D A;  4YWZ A;  2EA9 A;  4HH3 A;  5HDS A;  4R3A A;  3LUQ A;  4WUJ A;  3BWL A;  4HJ3 A;  2ZBB A;  2CMN A;  4BBV A;  4K08 A;  1TS0 A;  3A0V A;  2QHK A;  4NXB A;  1TS7 A;  1S1Z A;  2V0U A;  2YKF A;  3MJQ A;  4JGO A;  4HP9 A;  3UB6 A;  1GSV A;  3E4P A;  4JGR A;  4E04 A;  4L9F A;  4KUK A;  5HD3 A;  5HDC A;  2K7S A;  1JNU A;  1LSX A;  3H7W A;  4GS9 A;  3A0R A;  5IS1 A;  4WF0 A;  5F68 A;  3IS2 B;  2PR6 A;  1GSW A;  2INW A;  3H9W A;  2V9A A;  4JGP A;  3MXQ A;  4NXE A;  3LIB A;  4EES A;  2PR5 A;  3VOL A;  2B02 A;  1WA9 A;  5J4E A;  3OLO A;  3ULF A;  5HWT A;  3NHQ A;  2V0W A;  1UGU A;  2WKQ A;  5HWW A;  2W27 A;  4MN6 A;  5G4Z A;  3LIF A;  1UWN X;  3ZQ5 A;  4F3L B;  1OTB A;  2VV8 A;  4EEU A;  1S4S A;  2OOL A;  1S4R A;  5HD5 A;  1N9O A;  5J7E A;  4M4X A;  2JN7 A;  3F1O A;  5F69 A;  4XT2 B;  4R6L A;  2P7J A;  1S66 L;  1T19 A;  4WN5 A;  1Y28 A;  1LT0 A;  3F1P A;  2J80 A;  4GHI A;  2BAS A;  5IU1 A;  4PKY A;  2M1C A;  4LRY C;  4EW7 A;  4HIA A;  3LID A;  1F98 A;  4B9O A;  3KX0 X;  3K3D A;  1OTA A;  5TBM A;  3K3C A;  1LSW A;  1OJ5 A;  2PYP A;  3GDI A;  2A24 B;  4DJ3 A;  3FG8 A;  3E4O A;  3UB9 A;  4RQ9 A;  2D02 A;  1D06 A;  4EER A;  3P7N A;  1BYW A;  5KIZ A;  1F9I A;  1OJG A;  4NXG A;  4WLA A;  4KUO A;  4H6J A;  3LI8 A;  3H82 B;  4I3A A;  3G6O A;  2H28 A;  3UE6 A;  2OWJ A;  1DP6 A;  3BY9 A;  3MQQ A;  3IBR A;  5F5Y A;  1G28 A;  4HP4 A;  1LSV A;  4I3J A;  4MN5 A;  4JGQ A;  2VEA A;  3B33 A;  1XJ6 A;  1T1A A;  2QJ5 A;  3T50 A;  3F1N A;  3VE4 A;  3UB8 A;  1OTD A;  2L1M A;  1S1Y A;  1N9N A;  2VV6 A;  4HHD A;  4BBT A;  4PKY G;  3H7W B;  3LI9 A;  4GS9 B;  3EWK A;  3UME A;  1VB6 A;  5DJT A;  4F3L A;  4LRX C;  5AVF A;  4I39 A;  4KQD A;  1T18 A;  2QJ7 A;  2VLG A;  1XJ2 A;  2YKH A;  4GW9 A;  4DJ2 A;  2PDR A;  5HSQ A;  4I38 A;  1T1B A;  4HQA A;  4XT2 A;  4BBU A;  1XFQ A;  1GSX A;  5EFW A;  3HJI A;  2V1B A;  2VV7 A;  4HY8 A;  3CAX A;  1MZU A;  2W0N A;  2PD8 A;  1XJ4 A;  1P0Z A;  3MR0 A;  3F1O B;  1DRM A;  4NXF A;  3SW1 A;  1NWZ A;  4HI4 A;  4HJ6 A;  4EXO A;  3UMD A;  1KOU A;  3F1P B;  5A8B A;  3LIC A;  3MFX A;  3NJA A;  5AVE A;  3LYX A;  2JHE A;  1X0O A;  4GCZ A;  4R70 A;  3CWF A;  2OWH A;  3LIE A;  3RH8 B;  4R38 A;  5DJU A;  3HJK A;  1OT9 A;  1DP8 A;  5TBM B;  2V1A A;  4HJ4 A;  3RTY A;  3CLO A;  3H82 A;  3E4Q A;  2Z6C A;  4EET B;  3NOT C;  3D72 A; 
#chains in the Genus database with same CATH topology
 1EW0 A;  3WS5 A;  4EV4 A;  2XFS A;  5FQM A;  3ZVW A;  4NEE D;  3M6H A;  3G2Z A;  4EWF A;  1UWP X;  3IS2 A;  4YFM A;  4OQI A;  3M2J A;  5HAR A;  2R78 A;  3NCK A;  4Q0H A;  4BLM A;  1N9L A;  2WGW A;  3QNC A;  4L0L A;  3LO7 A;  3C8C A;  2WKP A;  5I5L A;  3KYQ A;  4QY5 A;  5M18 A;  1W5D A;  3UNW A;  3HUN A;  4I5S A;  4DXC A;  3HCY A;  1ES5 A;  2GNX A;  4E3N A;  3F1N B;  3V39 A;  5FQK A;  4WEL A;  2FZ0 A;  3E0Y A;  1H0M A;  5F1F A;  2L4R A;  5HL1 A;  2H5S A;  3LR4 A;  3B3X A;  3ZGA B;  5G4Y A;  4XXR A;  1ZHH B;  4HH2 A;  4OON A;  3T4O A;  3VSL A;  3IH9 A;  3ISG A;  4BD0 A;  4UA9 A;  3PAG A;  5HWV A;  1V9Z A;  1T1C A;  2W3D A;  1OT6 A;  4K91 A;  4ARZ B;  3NOP C;  4FH4 A;  3DTM A;  1KGG A;  3T4L A;  3CI6 A;  4ID4 A;  1G5U A;  2C6W B;  3O5Y A;  4H8R A;  2KX6 A;  3NY4 A;  4E3I A;  3BQA A;  1P97 A;  2O0Y A;  3G2Y A;  1ZG4 A;  2A2L A;  3BLS A;  3QP4 A;  3IF6 A;  1ERQ A;  3N7W A;  4HJ3 A;  3Q7V A;  3L9K A;  2IWB A;  5DF9 A;  3UDX A;  4LCM A;  2CMN A;  5CGX A;  3PR6 A;  1K25 A;  1MWT A;  3R7W B;  1TS0 A;  2EX6 A;  2QHK A;  1P9W A;  1TS7 A;  3RXW A;  2K31 A;  3ZG5 A;  2XA7 S;  1Y4O A;  3LR0 A;  3MJQ A;  5EE8 A;  3T4J A;  3PBT A;  4E3M A;  2XDM A;  4YOF A;  2X01 A;  3CG5 A;  1N9B A;  1MC0 A;  4BQM A;  3S22 A;  3IWO A;  3BFD A;  1YSQ A;  2K7S A;  4CLC B;  2ZMF A;  4R4S A;  4HES A;  1K56 A;  1PZP A;  2DMW A;  1MXO A;  3H7W A;  3IF6 C;  3LEZ A;  3TJZ C;  5IS1 A;  2H0T A;  1NYM A;  4Q0J A;  4G3V A;  3SH7 A;  2WUQ A;  4QPR A;  3D9Y A;  3NEC A;  3FYZ A;  2I72 A;  1L3L A;  4CLC D;  1DJB A;  3ULF A;  5HWT A;  3D3O A;  3LGO A;  1UGU A;  2W27 A;  5G4Z A;  3FKW A;  1W63 Q;  1UWN X;  1CEG A;  3BM6 A;  5E2G A;  3C30 A;  1XKZ A;  4OPQ A;  3BLM A;  3PBO A;  4U3T A;  4EEU A;  3KSI A;  1CJF A;  1F2K A;  4MBH A;  1ES3 A;  3UE1 A;  5HD5 A;  4R3J A;  1Z09 A;  1RGZ A;  4N92 A;  5F69 A;  5FQJ A;  1WE4 A;  1IOU A;  5K5B A;  4WN5 A;  1Y28 A;  2QMI A;  3SZT A;  3F1P A;  4FUW A;  3IBJ A;  3P09 A;  4MN7 A;  5CTM A;  4YNR A;  3HLG A;  2WKH A;  4WM9 A;  3KO6 A;  1I2W A;  4JXV A;  4QU3 A;  5TBM A;  1LHY A;  4MEZ A;  4DE2 A;  1BLS A;  4O8G A;  2PYP A;  3T1Q B;  5EPH A;  4MLL A;  4XUZ A;  5CER A;  3LCE A;  1TF1 A;  1XGI A;  4O01 A;  5HAI A;  1BUL A;  4EER A;  2C5W B;  4EBL A;  4WLA A;  1PWC A;  3WS1 A;  3W4P A;  4P87 A;  4KUO A;  3H82 B;  1GCE A;  2ZC3 B;  2OWJ A;  3C38 A;  2VA0 A;  3WWX A;  3JYI A;  4WYY A;  2W1T B;  2JE5 A;  1W63 M;  1PRQ A;  3VOY A;  3QHY A;  4HP4 A;  4I3J A;  4MN5 A;  2Y91 A;  5FQ9 A;  3S1Y A;  3PBN A;  4D2O A;  1HVB A;  1T1A A;  1IKI A;  2JKT I;  3T50 A;  3V5M A;  4GDB A;  4KZ7 A;  5TJJ A;  2WKE A;  1PI4 A;  5FL3 A;  1XA1 A;  3A3J A;  4PKY G;  4R1G A;  3QP5 A;  4LRX C;  5JYP A;  3CPT A;  5J8X A;  5AVF A;  2XD5 A;  3G35 A;  4GNU A;  4IBR A;  1T18 A;  1PFL A;  1XJ2 A;  2J8Y A;  1QME A;  2YKH A;  4E6X A;  4IVI A;  5HSQ A;  2FH5 A;  5FI7 A;  4PAU A;  4BBU A;  2JKF A;  1GSX A;  3MKF A;  3HJI A;  4UA6 A;  1W8Q A;  3CAX A;  3WS0 A;  1MWS A;  1XJ4 A;  4OQH A;  5DTK A;  3MR0 A;  4Y17 A;  5HAQ A;  1ONG A;  4NXF A;  2HJ9 C;  2LB5 A;  1KGE A;  1BSG A;  2Y2N A;  1CEF A;  5EV0 A;  5HW3 A;  2W3F A;  4KQO A;  3MFX A;  1K6R A;  5AVE A;  1YQS A;  3TG9 A;  5M1A A;  4GJ4 A;  3LIE A;  4QY6 A;  3HJK A;  4PM9 A;  4EU0 A;  3QP6 A;  1FCO A;  1JVJ A;  4OP5 A;  1TD5 A;  5CEC A;  5FQI A;  3KSH A;  3CLO A;  1KE3 A;  4Z1W A;  3H82 A;  4Y3I A;  4IJG A;  1NRF A;  1H5X A;  3MS6 A;  3D72 A;  5EM1 A;  1G68 A;  4S2L A;  3ICY A;  3Q81 A;  4R0Q A;  1D7E A;  2PHY A;  4H6J B;  3I7J A;  3N8L A;  2Y2Q A;  3GEC A;  3D4F A;  2D01 A;  1CF0 A;  1LL8 A;  3VOZ A;  5EVI B;  5FAO A;  3PBS A;  4CQH A;  5GHX A;  4X1M A;  3P98 A;  5L09 A;  5E43 A;  3BY8 A;  3W4Q A;  4L9E A;  4EEP A;  5TR7 A;  2QKP A;  5HZH A;  2J9P A;  4IHQ A;  1PIO A;  2ZQA A;  3V3S A;  3VE3 A;  5DVA A;  1TS8 A;  2VX8 A;  3C5A A;  3LR5 A;  5EVI D;  3IXG A;  2PU2 A;  3MQ0 A;  4MMN A;  1ES4 A;  1FIK A;  3E98 A;  1XJ3 A;  3E2K A;  4NK3 A;  1XXM A;  2KDK A;  2XGN A;  2ZMA A;  5GLB A;  3QP1 A;  4X53 A;  2Y2O A;  1YLT A;  1ZC2 A;  2WGV A;  4WL9 A;  1MWR A;  5L8M A;  4Y15 A;  3GRJ A;  2Y2M A;  4LLO B;  4OLG A;  1IFQ A;  2ZL1 A;  1GA9 A;  1KVM A;  1I5Q A;  3R4K A;  3G34 A;  3PAE A;  4ETX A;  2ZC6 B;  1OTE A;  1S67 L;  3T12 B;  2AVX A;  1S0W A;  4Q0I A;  3UB7 A;  1E4D A;  4O0P A;  4LPZ A;  5DKK A;  2QWS A;  3PXP A;  1TS6 A;  2Z6D A;  4YWZ A;  5HDS A;  1NYY A;  1IYS A;  2VK3 A;  3K2N A;  2EFU A;  4UHU A;  3M6B A;  3CMZ A;  5DTS A;  3BYD A;  4HEF A;  4BEN A;  1FCM A;  4KG2 A;  3BEC A;  5FAP A;  5FAS A;  2WZZ A;  2KOI A;  1KGF A;  1S1Z A;  4GKU A;  4KG6 A;  4UEY A;  3JVU A;  3G32 A;  2W1R A;  1IKG A;  2YKF A;  2JBF A;  1VET A;  3UB6 A;  1BLP A;  4JGR A;  4WEK A;  2O9A A;  4B4Z A;  2KLI A;  2Z2L B;  4S2O A;  2ZD8 A;  3JPU A;  3LY3 A;  1K54 A;  3A3D A;  1JNU A;  1IEL A;  3NUL A;  2Y2K A;  3OCL A;  2HP6 A;  1LSX A;  4RX3 A;  5DF7 A;  4X55 A;  3AGD A;  1L2S A;  4WMC A;  3IXH A;  2JKG A;  2ZQC A;  2G7U A;  5EVL A;  2FFF B;  1LL5 A;  2V9A A;  3IWQ A;  4K0W A;  4JGP A;  3MXQ A;  1CQA A;  1IEM A;  2R9W A;  1H8Y A;  4JF4 A;  5GHZ A;  2PR5 A;  4LV0 A;  2EWW A;  2B02 A;  3VOL A;  1JTG A;  5J4E A;  1RCJ A;  3MFD A;  4ZAM A;  2IWC A;  2RCX A;  5HWW A;  4MN6 A;  1KVL A;  3ZG7 B;  4LCL A;  3RFB A;  1PYY A;  2J3T C;  2VV8 A;  1CI9 A;  5A91 A;  2RL3 A;  1L0F A;  4KG5 A;  1N9O A;  1MBL A;  3MXR A;  1K56 D;  5J7E A;  4M4X A;  1H8M A;  1K54 C;  1VQQ A;  1XPB A;  3F1O A;  2W3H A;  3FWL A;  4E3K A;  4R6L A;  2P7J A;  3N6I A;  3O88 A;  1S66 L;  4MNR A;  1T19 A;  2P74 A;  4FH2 A;  2HJE A;  3HLD A;  2J80 A;  4GN2 A;  4RX2 A;  4IED A;  2CC1 A;  5IU1 A;  2M1C A;  4WZ4 A;  1PNE A;  3S7P A;  3LID A;  1F98 A;  4B9O A;  4X1L A;  3FKV A;  1XA7 A;  3HLF A;  1OTA A;  2PBY A;  3UE3 A;  4N9K A;  3ZG9 B;  4Y0O A;  1BT5 A;  3K3C A;  3NIA A;  2A24 B;  4HBT A;  3EOI A;  3V3R A;  3E4O A;  1CK3 A;  4P0M A;  3NBL A;  3V67 A;  3EGX C;  4PPR A;  1JWZ A;  3MZE A;  1P9R A;  1Q2P A;  3IF5 A;  1OJG A;  2XEP A;  3CUE A;  4S2I A;  3G6O A;  3UE6 A;  4X25 A;  4QB8 A;  1BLH A;  2WK0 A;  2E8I A;  3UPP A;  1DP6 A;  1MWU A;  3BY9 A;  1JWV A;  3MQQ A;  2Y2L A;  2EXA A;  5F5Y A;  4S2P A;  3UO9 A;  5FEG A;  4KZ8 A;  5CHU A;  3HUM A;  4BD1 A;  4AFI A;  2VEA A;  4JF6 A;  3IT9 A;  3BW6 A;  4KZ6 A;  4Z9Q A;  1XJ6 A;  4A5R A;  3FPW A;  1YLZ A;  3F1N A;  1WYC A;  2DCF A;  2Y2J A;  1OTD A;  2L1M A;  4MBK A;  5D3O A;  3BEB A;  1N9N A;  5FDH A;  4GD6 A;  4GS9 B;  3EEA A;  3WRZ A;  3CIT A;  2Y79 A;  3EWK A;  2M7U A;  3UME A;  2ZLY A;  3HBR A;  2Y2P A;  1VB6 A;  4OQG A;  2JKT M;  2ZQ9 A;  3CUE C;  3O87 A;  3S7N A;  1E3U D;  3VP4 A;  5GLC A;  1SHV A;  4P6Z S;  4UA7 A;  4BMW A;  1NRJ A;  5TFQ A;  2VLG A;  5AQB A;  2FFY A;  3DAV A;  4ARZ A;  4I38 A;  4HQA A;  4ZJ1 A;  2QZ6 A;  1ZG6 A;  1VEU B;  4ETZ A;  4C6Y A;  3SH9 A;  4HY8 A;  1CI8 A;  4WBG A;  3BQ8 A;  1EWZ A;  4ZTK A;  2Q0O A;  2PD8 A;  5HX9 A;  1BTL A;  1P0Z A;  1SKO B;  3BFG A;  4RVA A;  3UDF A;  1NWZ A;  4HJ6 A;  4OOM A;  1YPR A;  3UPN A;  5E2E A;  2HGV A;  2GDN A;  2W3G A;  4IUK A;  3IXB A;  2ZM2 A;  3VFF A;  1ZKJ A;  3LIC A;  5GLA A;  3NJA A;  4X69 A;  2JHE A;  1EI5 A;  4MBF A;  4DF6 A;  3R7W A;  3ITA A;  3A3I A;  3RH8 B;  2HZ5 A;  4E3J A;  3S4X A;  4QWO A;  4Y0T A;  1GA0 A;  1K55 A;  2PT7 A;  3ZYT A;  2HDU A;  2Q9N A;  3RTY A;  4DN0 A;  3JVV A;  3E4Q A;  3HLE A;  3IWI A;  1NY0 A;  5IT5 A;  1NLZ A;  1ACF A;  2XQZ A;  3HLC A;  1PWD A;  3T4K A;  4CLC A;  3LFV A;  5U47 A;  3VP1 A;  1K6S A;  1Z6F A;  3N4I A;  3IHB A;  3W4O A;  2Y4A A;  3N8R A;  1A0K A;  1MKM A;  2L0W A;  5F82 A;  3T4T A;  3A3E A;  3NDG A;  2GZA A;  2Q9M A;  4QJG A;  1OME A;  2EFX A;  2K2N A;  1DY6 A;  2HV1 A;  5E2F A;  4EQ1 A;  1K55 C;  1JTD A;  4XUX A;  1XFN A;  1O7E A;  2G2U A;  5HDD A;  3SS5 A;  4ZRR A;  5GL9 A;  1H8Z A;  3UN7 A;  4F94 A;  1LLB A;  2IA2 A;  4G3W A;  2GJ3 A;  4CLC C;  4DXB A;  4JBF A;  3WRT A;  5FDS A;  3RJU A;  1ERO A;  3U4L P;  1MKI A;  3EEH A;  1DP9 A;  3QP2 A;  1PW8 A;  2HDS A;  4D60 A;  3BFC A;  2ZOI A;  1L0E A;  1DJA A;  2BTF P;  4II7 A;  1ESU A;  2PRF A;  5EVE A;  1F5M A;  4Y13 A;  3SOI A;  3MQO A;  2HP9 A;  5CRF A;  2PD7 A;  4P85 A;  3C2W A;  1ONH A;  1MPL A;  5F83 A;  4LRZ E;  4GHI B;  5HAP A;  2V8C A;  3B42 A;  5FA7 A;  4QHC A;  2PBD P;  1IYP A;  2BG1 A;  4ME4 A;  2EA9 A;  4HH3 A;  5E2H A;  4LEN A;  4R3A A;  4N9L A;  1K57 A;  3IH8 A;  3LUQ A;  4FOF A;  3G30 A;  2OSU A;  5G18 A;  2PAV P;  3BWL A;  2ZBB A;  3GSG A;  1PW1 A;  3MSH A;  3A3F A;  4C75 A;  2B18 A;  4BBV A;  4M3K A;  5HPF A;  4K08 A;  2P08 A;  5L10 A;  2EX9 A;  5KMW A;  2W1T A;  2V0U A;  4PMA A;  4OH0 A;  2P9V B;  4HP9 A;  3GV9 A;  3E4P A;  3UB5 P;  2V8F A;  4PM7 A;  1MY8 A;  3SH8 A;  4OLD A;  4E04 A;  1K0K A;  3ZCZ A;  4KUK A;  4K0X A;  4DMZ A;  1H3Q A;  1K57 C;  3ZDJ A;  4ZDX A;  1Q2Q A;  3FPV A;  4WF0 A;  4CJN A;  3IS2 B;  2PR6 A;  1GSW A;  4KZB A;  4N1X A;  2VKS A;  4B88 A;  3TW8 A;  1W79 A;  1KE4 A;  4EES A;  5L2F A;  2WGW B;  3QNB A;  3TOI A;  1WA9 A;  4R3B A;  3OLO A;  5KZH A;  4FTX A;  4MDZ A;  2XA7 M;  4BL2 A;  5DFY A;  1FIL A;  2WKQ A;  3IXD A;  3EGD C;  1JWP A;  3LIF A;  4LV1 A;  2ZC7 A;  3ZQ5 A;  4EBP A;  4F3L B;  1W8Y A;  2Y2I A;  2EWV A;  1DJC A;  5IHV A;  4GB7 A;  1S4R A;  2ZC5 B;  4GLQ A;  4RYE A;  4YIN A;  4OPZ A;  4NET A;  2JN7 A;  4Q8I A;  5C5K A;  4QD4 A;  1XX2 A;  2HDQ A;  2WAE A;  5BOH A;  2IWD A;  3VMA A;  2H10 A;  1RGY A;  5L07 A;  5CGW A;  1HLU P;  3NC8 A;  4GOG A;  2WYX A;  4GHI A;  3OPH A;  5FI2 A;  1STZ A;  4PM5 A;  1VHM A;  4O7D A;  2H0Y A;  4LRY C;  5FQQ A;  4EW7 A;  4HIA A;  1LI0 A;  2ZMV A;  3KX0 X;  3IX4 A;  3DTK A;  1YT4 A;  1OJ5 A;  4PM6 A;  1NZU A;  4JXS A;  1ESI A;  4IVK A;  1S6R A;  4G3K A;  4EQI A;  5GLD A;  4FSF A;  4X6T A;  4X68 A;  2D02 A;  3IF6 B;  3GTC A;  3Q7V B;  3MMH A;  2V2F F;  1F9I A;  4BL3 A;  4DRT A;  4H6J A;  3LI8 A;  4I3A A;  4IBX A;  2H28 A;  4OPY A;  1YMS A;  3BJN A;  4UQI S;  2B95 A;  4GDN A;  5FI6 A;  3MBZ A;  4IUH A;  1TVF A;  5EOO A;  5EVI A;  2OLU A;  1LSV A;  4GZB A;  1GHP A;  1FSW A;  2XRO A;  5CEB A;  4JGQ A;  4OKP A;  3VP3 A;  4DE3 A;  3B33 A;  1ALQ A;  2W3E A;  4E3L A;  5F1G A;  4FCF A;  2EXB A;  5FAT A;  3C4P A;  5HFO A;  3KYE A;  3EQV A;  3VE4 A;  1SDN A;  3WS2 A;  3Q82 A;  1S1Y A;  4HHD A;  4BJP A;  3H7W B;  3LI9 A;  2P04 A;  3W8K A;  1FQG A;  2X02 A;  2WAD A;  2J7V A;  4OQ0 A;  1M40 A;  4PHT A;  5DJT A;  4F3L A;  2B5R A;  3RXX A;  1N4O A;  3BRM A;  3PBR A;  4DKI A;  4Y7P A;  3OOV A;  4KQD A;  2QJ7 A;  2BLS A;  4PM8 A;  3EQU A;  4P6B A;  5EVI C;  2A49 A;  4DJ2 A;  2PDR A;  2Z2M B;  2ACG A;  2VV7 A;  5AQA A;  1TDG A;  5TGF A;  1MZU A;  3CJM A;  3MXS A;  1YLJ A;  4RA7 A;  4KZ9 A;  4NKP A;  1DRM A;  3LEQ A;  3DWK A;  3SW1 A;  3GMW A;  1GHI A;  4EXO A;  2UV0 E;  4R23 A;  2ZQD A;  3PBQ A;  4KQQ A;  1C3B A;  1K38 A;  1KOU A;  3F1P B;  2NUP C;  3E2L A;  1AXB A;  3LYX A;  1Y54 A;  2HF6 A;  1RP5 A;  1YSP A;  4LV2 A;  4R70 A;  2OWH A;  3UDI A;  2JKR I;  4R38 A;  4S2N A;  2NUT C;  5DJU A;  3IX8 A;  1DP8 A;  5TBM B;  3Q07 A;  5EUA A;  2OAQ 1;  1YM1 A;  3LR3 A;  2VGL S;  3ZFZ A;  5MC7 A;  1YKD A;  2WGI A;  2MJ6 A;  5CTN A;  4UAA A;  2Z6C A;  4Y2F A;  4C3Q A;  4EET B;  3KSG A;  3NOT C;  2OLV A;  3HL9 A;  5HPI A;  1I2S A;  3GQZ A;  3MF0 A;  3Q1F A;  2V1Z A;  1G6O A;  3M2K A;  1ODV A;  1XP4 A;  5DKL A;  1FSY A;  4X56 A;  2I9V A;  4LV3 A;  2JCH A;  4S2K A;  3A0S A;  5JYO A;  3OZH A;  4JLF A;  1PWG A;  1BZA A;  1K4F A;  4S2N C;  5CED A;  2PYR A;  1KDS A;  5A90 A;  3T1R A;  5A92 A;  4DDY A;  2ZOH A;  5F6A A;  1LI9 A;  1BUE A;  4S2M A;  1FR1 A;  3OPP A;  4GD8 A;  4L9G A;  3NOU C;  4KQR A;  2QYB A;  3LIA A;  2PU4 A;  3HVF A;  1FCN A;  2XRN A;  4OVD A;  4B4X A;  3PHY A;  3T4Q A;  4U0X A;  2ZC4 B;  4HNB A;  4KZ5 A;  1V9Y A;  3CPT B;  3AGE A;  3PYP A;  3ZG8 B;  4HOI A;  3IX3 A;  4I3I A;  1BLC A;  4HBU A;  1XGJ A;  2WKR A;  1AWI A;  3DTE A;  2WZX A;  3FC7 A;  5J3W A;  1IYO A;  1LL9 A;  1OTI A;  2J3W A;  3DW0 A;  2XR0 A;  3UE0 A;  2V20 A;  4DDS A;  4EUZ A;  2A24 A;  4OOY A;  1KDW A;  4ESP A;  1ES2 A;  3L7H A;  3KSF A;  4WUJ A;  5CHJ A;  1J9M A;  3DBA A;  3C4O A;  4JXW A;  1O07 A;  2EX2 A;  2ZJ9 A;  2QPN A;  3HUO A;  3VFH A;  1L0D A;  4NG2 A;  5GHY A;  3OPR A;  5DFX A;  4DE0 A;  3A0V A;  1G6A A;  4FD8 A;  4JKT A;  4NXB A;  2Y8H A;  2O9C A;  2XFT A;  2UWX A;  2WKI A;  2ZQ7 A;  4JGO A;  3OC2 A;  1GSV A;  5KSH A;  1QMF A;  4OOL A;  3C7U A;  4L9F A;  1FR6 A;  4LFU A;  4WEJ A;  5CX7 A;  5FEF A;  3BFF A;  5HDC A;  5HD3 A;  3S7O A;  1E3U A;  3OCN A;  2XH9 A;  2Y2H A;  3HLB A;  3ZG0 A;  1SCW A;  3GVB A;  1J3W A;  2OAP 1;  3VV4 A;  4GS9 A;  3A0R A;  4EUV A;  3AGF A;  3OPL A;  5F68 A;  2INW A;  3H9W A;  2Y55 A;  3VP2 A;  1TDL A;  4NXE A;  3LIB A;  3SS3 A;  5A93 A;  2XSS A;  5LBR A;  3PTE A;  5CGS A;  3NHQ A;  2V0W A;  3TSG A;  4B93 A;  2VGK A;  2ZQ8 A;  3FZC A;  4Y0U A;  2XD1 A;  1YLY A;  1KE0 A;  4UQI M;  1OTB A;  4KZ4 A;  1VEU A;  3P01 A;  4KZ3 A;  1S4S A;  4JPM A;  2OOL A;  5DTT A;  2HP5 A;  1SZV A;  1SKO A;  1E25 A;  4XT2 B;  4ZJ3 A;  1NLY A;  3O3V A;  4U0T A;  5FSR A;  2Y59 A;  5AQ9 A;  1TEM A;  3BFE A;  3V50 A;  1LT0 A;  1HZO A;  3GR2 A;  3WS4 A;  2XLN A;  3UY6 A;  5EEC A;  2VZW A;  1K4E A;  3T4S A;  2BAS A;  2ZL1 B;  1VM1 A;  4PKY A;  2WAF A;  3K3D A;  4KEN B;  1M6K A;  1LSW A;  2HDR A;  4MCW A;  1FOF A;  3GDI A;  3ZNY A;  3KYZ A;  3O86 A;  4DJ3 A;  2A3U A;  3SS4 A;  1NXY A;  5FAQ A;  3FG8 A;  2VJW A;  4BWI A;  3MZD A;  3HRE A;  3MKE A;  5AQ7 A;  3UB9 A;  4RQ9 A;  3QP8 A;  3LY4 A;  1D06 A;  3ZNT A;  3NI9 A;  2HPB A;  2O99 A;  5DF8 A;  3P7N A;  1BYW A;  5KIZ A;  4NXG A;  1SKF A;  1NZO A;  1YAX A;  3FV7 A;  4CLC E;  3B47 A;  3VSK A;  4LGW A;  4R4R A;  4KZA A;  3DTI A;  3CZD A;  3IBR A;  3IHA A;  3TE8 A;  1G28 A;  2E8J A;  3S7Q A;  3T1X A;  4Y5F A;  3MZF A;  1OPX A;  2DNS A;  4ZBE A;  3N8S A;  1VET B;  4JXG A;  2JC7 A;  4ZJ2 A;  5AJG A;  4EBN A;  2QJ5 A;  3UB8 A;  3ZHH A;  1YLW A;  4N1H A;  2GX5 A;  2X71 A;  2VV6 A;  4S2J A;  4BBT A;  2VGL M;  1PZO A;  1YMX A;  2J3T D;  4E6W A;  1GHM A;  5CXW A;  2G2W A;  4DE1 A;  2J9O A;  3W2Z A;  4I39 A;  4OPR A;  1WYB A;  2LB9 A;  4GW9 A;  3Q7Z A;  1ERM A;  1T1B A;  4XT2 A;  3ZVT A;  4WMC D;  1XFQ A;  5EM0 A;  5EFW A;  3CHW P;  1ZTU A;  2V1B A;  3HLW A;  1IYQ A;  2XK1 A;  3OBF A;  5HL6 A;  2EX8 A;  2XF3 A;  2W0N A;  2O9B A;  1SDE A;  1L0G A;  4WZ5 A;  4JF5 A;  3F1O B;  3NDE A;  1YLP A;  1U60 A;  2ZM8 A;  3VP0 A;  4HI4 A;  5KSC A;  1NJ4 A;  3T1S A;  1PI5 A;  2VGJ A;  4E3O A;  3UMD A;  2ZM0 A;  5A8B A;  1HTZ A;  4CPK A;  3U2A A;  2R9X A;  1W7F A;  2Y2G A;  2DRW A;  3C7V A;  1X0O A;  4P6Z M;  4GCZ A;  2OV5 A;  5EOE A;  3CWF A;  3DWZ A;  2M7V A;  1OT9 A;  4OP8 A;  3TRC A;  2V1A A;  4HJ4 A;  2P9V A;  1D1J A;  3ITB A;  5CHM A;  1HD8 A;  5M19 A;  2JKR M;  3G31 A;  5I94 A;  4WZ5 C;  3G4P A;  3UPO A;  3IQA A; 
#chains in the Genus database with same CATH homology
 3ICY A;  1D7E A;  1EW0 A;  1ODV A;  2PHY A;  4H6J B;  5DKL A;  1MKM A;  4NEE D;  2I9V A;  3GEC A;  2L0W A;  1UWP X;  2D01 A;  3IS2 A;  1LL8 A;  3A0S A;  3T4T A;  2GZA A;  2R78 A;  3PBS A;  4Q0H A;  1N9L A;  4CQH A;  4L0L A;  3C8C A;  2K2N A;  2WKP A;  5I5L A;  3KYQ A;  3BY8 A;  2HV1 A;  4L9E A;  4EEP A;  2PYR A;  4I5S A;  4EQ1 A;  2QKP A;  5HZH A;  1XFN A;  2ZOH A;  3HCY A;  4IHQ A;  5F6A A;  2GNX A;  5HDD A;  3F1N B;  3VE3 A;  4ZRR A;  1TS8 A;  4L9G A;  2VX8 A;  3NOU C;  3LR5 A;  4WEL A;  2FZ0 A;  2IA2 A;  3E0Y A;  3MQ0 A;  2QYB A;  4G3W A;  3LIA A;  4MMN A;  2L4R A;  3E98 A;  1XJ3 A;  2GJ3 A;  3LR4 A;  4CLC C;  2KDK A;  2XRN A;  3PHY A;  3T4Q A;  5G4Y A;  1ZHH B;  4HNB A;  4HH2 A;  3T4O A;  3EEH A;  1V9Y A;  1DP9 A;  4WL9 A;  5L8M A;  3PYP A;  5HWV A;  4HOI A;  2ZOI A;  4LLO B;  4I3I A;  1V9Z A;  1IFQ A;  4II7 A;  1T1C A;  2W3D A;  1OT6 A;  4ARZ B;  3NOP C;  2WKR A;  3R4K A;  4ETX A;  1F5M A;  5J3W A;  3FC7 A;  3T4L A;  1OTE A;  3MQO A;  3CI6 A;  1OTI A;  2J3W A;  1S67 L;  3O5Y A;  2KX6 A;  2PD7 A;  4Q0I A;  3UB7 A;  3C2W A;  2A24 A;  4LRZ E;  3BQA A;  1P97 A;  2O0Y A;  3B42 A;  4GHI B;  4LPZ A;  2QWS A;  4O0P A;  3PXP A;  1TS6 A;  2Z6D A;  4YWZ A;  4ME4 A;  2EA9 A;  4HH3 A;  5HDS A;  4R3A A;  2A2L A;  3KSF A;  3K2N A;  3LUQ A;  4FOF A;  4WUJ A;  3DBA A;  3BWL A;  4HJ3 A;  2ZBB A;  5DF9 A;  2CMN A;  3PR6 A;  2B18 A;  4BBV A;  3R7W B;  5HPF A;  4K08 A;  1TS0 A;  5DFX A;  3A0V A;  2P08 A;  2QHK A;  1P9W A;  2KOI A;  4NXB A;  2Y8H A;  2W1T A;  1TS7 A;  2O9C A;  1S1Z A;  2V0U A;  4UEY A;  2K31 A;  3JVU A;  2XA7 S;  2W1R A;  2YKF A;  3LR0 A;  3MJQ A;  4JGO A;  4HP9 A;  3T4J A;  3UB6 A;  3OC2 A;  3PBT A;  1GSV A;  3E4P A;  4YOF A;  5KSH A;  4JGR A;  4WEK A;  2O9A A;  4OOL A;  4E04 A;  2KLI A;  1MC0 A;  4L9F A;  4WEJ A;  5CX7 A;  4KUK A;  5HD3 A;  5HDC A;  3S7O A;  3OCN A;  1YSQ A;  2K7S A;  4CLC B;  2ZMF A;  1JNU A;  4DMZ A;  1H3Q A;  3OCL A;  1LSX A;  2DMW A;  2OAP 1;  3H7W A;  3VV4 A;  4GS9 A;  3A0R A;  3TJZ C;  4EUV A;  3FPV A;  4WF0 A;  5IS1 A;  5F68 A;  4Q0J A;  4G3V A;  2G7U A;  3IS2 B;  2PR6 A;  1GSW A;  2INW A;  3H9W A;  2V9A A;  4QPR A;  2VKS A;  4JGP A;  3MXQ A;  3TW8 A;  4NXE A;  3LIB A;  4EES A;  2PR5 A;  2EWW A;  4CLC D;  2B02 A;  3VOL A;  1WA9 A;  2XSS A;  5LBR A;  3OLO A;  5J4E A;  4MDZ A;  2XA7 M;  3ULF A;  5DFY A;  5HWT A;  3NHQ A;  2V0W A;  3D3O A;  1UGU A;  2WKQ A;  4B93 A;  5HWW A;  2W27 A;  3EGD C;  4MN6 A;  5G4Z A;  3LIF A;  1W63 Q;  1UWN X;  3RFB A;  4UQI M;  3ZQ5 A;  4F3L B;  1OTB A;  3C30 A;  3P01 A;  2EWV A;  2J3T C;  2VV8 A;  3PBO A;  4EEU A;  3KSI A;  1S4S A;  2OOL A;  1S4R A;  4GLQ A;  5HD5 A;  1N9O A;  5J7E A;  4M4X A;  2JN7 A;  1H8M A;  3F1O A;  2W3H A;  5F69 A;  5C5K A;  4XT2 B;  1NLY A;  4R6L A;  2P7J A;  1IOU A;  5K5B A;  1S66 L;  1T19 A;  4WN5 A;  1Y28 A;  1LT0 A;  2HJE A;  3F1P A;  3IBJ A;  2J80 A;  4GHI A;  4MN7 A;  2VZW A;  4YNR A;  3T4S A;  1STZ A;  2BAS A;  1VHM A;  5IU1 A;  4PKY A;  2M1C A;  4LRY C;  4EW7 A;  3S7P A;  4HIA A;  3LID A;  1F98 A;  3KO6 A;  4B9O A;  2ZMV A;  3K3D A;  3KX0 X;  1OTA A;  3UE3 A;  5TBM A;  3K3C A;  1LSW A;  4MCW A;  1OJ5 A;  4O8G A;  2PYP A;  3GDI A;  3KYZ A;  2A24 B;  4DJ3 A;  3EOI A;  3FG8 A;  4G3K A;  2VJW A;  4BWI A;  3E4O A;  4FSF A;  1TF1 A;  3UB9 A;  4RQ9 A;  2D02 A;  3V67 A;  1D06 A;  4O01 A;  3EGX C;  4EER A;  2O99 A;  3MMH A;  3P7N A;  1BYW A;  1P9R A;  5KIZ A;  1F9I A;  1OJG A;  4NXG A;  4WLA A;  4KUO A;  1YAX A;  4H6J A;  3LI8 A;  3CUE A;  3H82 B;  4I3A A;  3G6O A;  4CLC E;  2H28 A;  3UE6 A;  3B47 A;  3BJN A;  4UQI S;  2OWJ A;  3C38 A;  2VA0 A;  1DP6 A;  3BY9 A;  3MQQ A;  2W1T B;  4IUH A;  1W63 M;  3IBR A;  5F5Y A;  3TE8 A;  1G28 A;  4HP4 A;  3S7Q A;  1LSV A;  4I3J A;  2XRO A;  4MN5 A;  4Y5F A;  1OPX A;  4AFI A;  4JGQ A;  2VEA A;  3B33 A;  3PBN A;  2W3E A;  3BW6 A;  5AJG A;  1XJ6 A;  1T1A A;  2JKT I;  3FPW A;  2QJ5 A;  3T50 A;  3EQV A;  3F1N A;  3VE4 A;  3UB8 A;  5TJJ A;  1OTD A;  2L1M A;  1S1Y A;  2GX5 A;  5FL3 A;  1N9N A;  2VV6 A;  4HHD A;  4BJP A;  4BBT A;  4PKY G;  3H7W B;  2VGL M;  3LI9 A;  2P04 A;  4GS9 B;  3EEA A;  3CIT A;  2J3T D;  2Y79 A;  3EWK A;  2M7U A;  3UME A;  4PHT A;  1VB6 A;  5DJT A;  4F3L A;  4LRX C;  2JKT M;  3CUE C;  3S7N A;  3PBR A;  5AVF A;  3W2Z A;  3OOV A;  4I39 A;  4KQD A;  1T18 A;  2QJ7 A;  4P6Z S;  1NRJ A;  4BMW A;  2VLG A;  1XJ2 A;  3EQU A;  2YKH A;  2LB9 A;  4GW9 A;  4ARZ A;  4DJ2 A;  2PDR A;  2FH5 A;  5HSQ A;  4I38 A;  1T1B A;  4HQA A;  4PAU A;  4XT2 A;  4BBU A;  1XFQ A;  1GSX A;  5EFW A;  1ZTU A;  3HJI A;  2V1B A;  2VV7 A;  4ETZ A;  4HY8 A;  3OBF A;  3CAX A;  5HL6 A;  1MZU A;  3BQ8 A;  2W0N A;  2O9B A;  2PD8 A;  1XJ4 A;  1P0Z A;  3MR0 A;  3F1O B;  4NKP A;  5DKK A;  1DRM A;  4NXF A;  3SW1 A;  1NWZ A;  2HJ9 C;  2LB5 A;  4HI4 A;  4HJ6 A;  4OOM A;  2HGV A;  4EXO A;  2W3G A;  3PBQ A;  4IUK A;  3UMD A;  1KOU A;  3F1P B;  5A8B A;  2W3F A;  2NUP C;  3LIC A;  4KQO A;  3MFX A;  3U2A A;  3NJA A;  5AVE A;  3LYX A;  2JHE A;  2HF6 A;  1X0O A;  1YSP A;  4P6Z M;  3R7W A;  4GCZ A;  4R70 A;  3CWF A;  4GJ4 A;  2OWH A;  3LIE A;  3RH8 B;  2JKR I;  2M7V A;  4R38 A;  2NUT C;  5DJU A;  3HJK A;  1OT9 A;  1DP8 A;  5TBM B;  4EU0 A;  3TRC A;  2V1A A;  2PT7 A;  2OAQ 1;  4HJ4 A;  3ZYT A;  1TD5 A;  3LR3 A;  2VGL S;  3KSH A;  3RTY A;  3CLO A;  3JVV A;  4Z1W A;  4DN0 A;  1YKD A;  5MC7 A;  3H82 A;  3E4Q A;  4Y3I A;  2MJ6 A;  2Z6C A;  4Y2F A;  4IJG A;  5IT5 A;  1NLZ A;  4EET B;  3KSG A;  3NOT C;  5HPI A;  2JKR M;  3D72 A;  3T4K A;  3MF0 A;  4CLC A;  3LFV A;  1G6O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...