1IOUA

Solution structure of ykt6p (1-140)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
140
structure length
140
Chain Sequence
MRIYYIGVFRSGGEKALELSEVKDLSQFGFFERSSVGQFMTFFAETVASRTGAGERQSIEEGNYIGHVYARSEGICGVLITDKQYPVRPAYTLLNKILDEYLVAHPKEEWADVTETNDALKMKQLDTYISKYQDPSQADA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords YKT6P
publication title An autoinhibitory mechanism for nonsyntaxin SNARE proteins revealed by the structure of Ykt6p
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 28
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2001-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13774 Longin Regulated-SNARE-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.50 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1iouA00
1IFQA 3KYQA 2NUTC 4AFIA 2NUPC 3EGXC 3EGDC 1IOUA 1H8MA 3BW6A 2DMWA 2VX8A 4B93A
chains in the Genus database with same CATH superfamily
3A3DA 1S1ZA 1ZHHB 3MJQA 1I5QA 3DAVA 5KMWA 2FFFB 3IWQA 2IWCA 3KYZA 3NIAA 4ETZA 3JPUA 1HD8A 4JBFA 1KOUA 2WGVA 2Y2KA 5HW3A 1ACFA 1MBLA 4GKUA 4R38A 1SDNA 1T1AA 5HAIA 4OOYA 1RCJA 4F3LB 4KUOA 3ZQ5A 5TGFA 2ZM2A 5HPIA 5A91A 4E3KA 5CEBA 3MFDA 2PT7A 1ZTUA 4OOMA 5E2GA 3G34A 2KX6A 4KZ5A 1S4SA 2C5WB 1YLJA 3LIFA 5HX9A 4ARZA 2ZL1A 5HL1A 2V1AA 4DE1A 5DVAA 4PAUA 3RXXA 2P74A 3T4KA 2XEPA 4LCMA 4WEJA 1F2KA 1PW8A 2IWBA 3OPLA 4KG2A 1F98A 3NI9A 2ZQ7A 3F1PB 2ZOHA 5CHUA 4ESPA 1DY6A 4EW7A 1P0ZA 3KSHA 1P9WA 4UAAA 1TS0A 3LEQA 4YOFA 4HIAA 5FDSA 4MLLA 3BFCA 2LB9A 2PR6A 4L0LA 5HDSA 3MQ0A 4X55A 4X1MA 4OP8A 1PW1A 4Z9QA 1PWGA 3IXHA 3WS1A 3Q1FA 5GLAA 1K57C 1XFNA 2ZMFA 5HAQA 2GNXA 1BUEA 2H0TA 2A49A 2QYBA 3PBQA 3EEAA 4LRZE 5GHYA 4WZ5C 5EVIA 1XGJA 3IWOA 5CX7A 5C5KA 2O9BA 2P04A 1IYSA 4EERA 1TS7A 1YLWA 4PHTA 2ZJ9A 3CPTA 4WELA 4CLCA 2ZC6B 1ERMA 2JHEA 4EWFA 1TF1A 1W5DA 2WK0A 4BENA 1YPRA 2A24A 4X25A 1IYQA 3BFDA 3W8KA 1CEGA 4CQHA 4HY8A 2P7JA 3CWFA 3GMWA 1TDLA 5E2FA 4Z1WA 1TS8A 4LRYC 2WYXA 3IHAA 2ZMAA 2Y2PA 1V9ZA 4BQMA 1K4EA 1ES2A 4YFMA 2WKPA 4MN6A 3C4OA 3IXGA 1Y54A 4QB8A 1ESUA 2G7UA 4BWIA 3QP1A 2OLVA 3CAXA 2W1TA 2P08A 3PTEA 3TG9A 3UDIA 3MXSA 4S2OA 3N6IA 3JVVA 1E4DA 2WKEA 3DTKA 2WGWA 3O86A 3T1SA 2FFYA 4OLDA 1LI0A 1VM1A 5GL9A 1Z09A 2EX9A 2H10A 5FI2A 1BULA 1IEMA 3ZGAB 3PBNA 4I5SA 3IF6B 4FH4A 3Q7VB 3N8RA 4CPKA 3UDFA 2JKRI 1NRFA 4BL3A 4Y0OA 3MQOA 2J3TC 2XR0A 3AGFA 4OPYA 5HDDA 4GCZA 1LSXA 1TD5A 3S22A 1U60A 2HJ9C 2HP5A 4JXSA 2P9VB 1MY8A 3BECA 3IH8A 1MC0A 4L9EA 4BD1A 1JTGA 2J80A 3FPWA 5CGWA 1PFLA 3H82A 1SZVA 5CECA 1K6RA 5FATA 4EUVA 1N9NA 3D4FA 1S6RA 4S2PA 1XX2A 3BFEA 3CITA 3B47A 4RX2A 3NC8A 2Y8HA 5EOEA 2IWDA 4U3TA 1P97A 1SKOA 1FSWA 5EVIC 5I5LA 2ZOIA 4EBPA 1IYOA 3ICYA 2GZAA 4WM9A 2W3EA 1ONGA 1H0MA 2V1ZA 1N9OA 2KLIA 1SHVA 1YLZA 3UN7A 3LEZA 4WZ4A 3VP2A 4UA6A 5TBMB 4GS9A 4IHQA 4CLCC 3KSFA 3EQVA 2BASA 1IFQA 1FR1A 1ZG4A 2W3HA 1YQSA 3ZVTA 2WKRA 2XF3A 2HDSA 3SH9A 1P9RA 1K56A 4AFIA 3E0YA 5IHVA 2EX2A 1F9IA 2ZC5B 3UY6A 4UEYA 5CGXA 4E6WA 5EE8A 2OAQ1 1HLUP 3DTMA 3LYXA 4MCWA 1DP9A 1YLYA 5FQIA 3FG8A 1PI5A 2W3GA 1DP8A 4E3IA 1NYYA 4EEPA 1JVJA 3UE3A 3DWZA 3O88A 1STZA 3DWKA 5CHJA 1XFQA 3L9KA 3IXBA 4R0QA 4Q0JA 3QNCA 1EROA 5AQBA 1NXYA 3SS5A 1KDWA 3G6OA 3HREA 3T12B 1KGEA 2WUQA 3K3DA 3A0SA 1YKDA 3ZG5A 1BLHA 4BBTA 1RGYA 1GHIA 5GLBA 3V67A 2K31A 2OWHA 5EV0A 5AQ7A 1VETB 3R7WB 2QPNA 5HAPA 2ZQAA 3HCYA 1D7EA 4PM5A 2D02A 1G6OA 4O0PA 5BOHA 2Y55A 2ZBBA 3KO6A 4GJ4A 3DW0A 4DJ3A 4B93A 4HEFA 4X56A 5LBRA 4E04A 2L0WA 1SKFA 3MZFA 3KSGA 3QP4A 3UDXA 3AGDA 4DRTA 3CZDA 5M19A 3QP5A 1RP5A 5KSHA 1FQGA 2ZD8A 4UA7A 1ES4A 3GTCA 1K38A 4QU3A 1CI8A 3D9YA 3VE3A 5E43A 3QHYA 3TOIA 2K2NA 4Q0HA 1XXMA 5DTSA 1FOFA 4WN5A 4ARZB 4MN5A 2H0YA 1KE4A 2ZL1B 4S2IA 2VA0A 1SCWA 5CERA 4U0TA 3T4SA 3FKVA 2HV1A 4HNBA 1MWSA 3S1YA 4II7A 4EQ1A 4BD0A 3SS4A 3CMZA 3PAGA 4R6LA 3C2WA 4NK3A 3HBRA 4E6XA 4PPRA 4QHCA 2V8CA 4OLGA 3BFGA 3PBOA 1PZOA 4GN2A 5CXWA 1BT5A 5DFXA 2VZWA 4I3JA 1XGIA 2XFSA 4LPZA 1N9LA 1IOUA 2EX8A 1UGUA 2ZMVA 1G28A 3F1NA 3HJKA 2G2WA 1NYMA 4EBLA 5HD5A 1JWVA 3LY3A 3K3CA 4E3OA 1XPBA 3OC2A 3LGOA 2HDUA 1K0KA 1EW0A 4WMCD 3AGEA 4ZRRA 3HLEA 5KZHA 4QD4A 3IF5A 1BZAA 1TS6A 3IX4A 5CGSA 4OKPA 1GSWA 5EVIB 3TW8A 3TSGA 1MZUA 1YT4A 2OSUA 3S7QA 3IXDA 1GSVA 1CI9A 1VETA 4DE2A 4MEZA 3R4KA 3HLGA 1ES5A 3CPTB 4KG5A 4LRXC 3FC7A 1ALQA 3IF6C 4CLCB 2XDMA 3ZG7B 5AQ9A 3HLWA 1O7EA 2JKTM 3GR2A 4MBHA 3P98A 3H7WA 3L7HA 1D06A 2A24B 2NUPC 3C4PA 3VSKA 1XA7A 5HWTA 4GLQA 2DRWA 4JGPA 2WZZA 1E3UD 1CF0A 4Y0UA 4Y2FA 4DMZA 2W27A 4KZ4A 2Q9NA 2V2FF 4R70A 4U0XA 3RXWA 3WRTA 4JXVA 1PRQA 2R9XA 3ULFA 3HL9A 1ES3A 2CMNA 1DRMA 1JWZA 2V0WA 1Q2QA 2PD7A 4ZJ1A 3HUMA 3BQ8A 1YAXA 4KZAA 5JYPA 2V8FA 3NECA 1L0EA 4QPRA 2W1TB 2OOLA 1TEMA 1MWTA 4N9LA 2H28A 3MSHA 2QMIA 2WGWB 2GX5A 2UWXA 4YNRA 4OOLA 4JF5A 2XRNA 5HWVA 1NRJA 3M2JA 2X02A 3NOPC 4JPMA 4WLAA 1XJ6A 2Q0OA 5CTNA 4YINA 4HJ6A 4IEDA 4ZBEA 1PIOA 5EUAA 4S2NA 2PBDP 5L09A 2Y2LA 4K91A 2Y2IA 1FCMA 3E2KA 1ODVA 5AQAA 4JGOA 4KZ6A 2G2UA 2WKHA 4I3IA 2XK1A 3HLFA 1W7FA 3G4PA 3IWIA 4WYYA 4GDBA 1GSXA 3E98A 5F83A 1OJGA 1FCNA 2XLNA 2FH5A 3WS0A 2NUTC 3H82B 3VP0A 3FWLA 4UQIS 1BLSA 2EFUA 4BBUA 5HFOA 3V5MA 4HOIA 4GDNA 3ZDJA 3HLBA 4JLFA 1S66L 4KQQA 3QP6A 1AWIA 3UB7A 3A0VA 1ZG6A 5DJTA 4NXGA 3OPRA 2Y79A 3QP2A 3CLOA 4LV2A 3BYDA 4R4RA 3MKEA 2ACGA 4S2MA 1SKOB 3MXRA 4I38A 3BQAA 1M40A 1X0OA 5FQQA 3M6BA 3G35A 5CTMA 2Y4AA 3O87A 3LCEA 1BLPA 4C3QA 2R78A 3H9WA 3S4XA 1FCOA 5M18A 4LV1A 3RH8B 1YM1A 2J3TD 3LIEA 3PBTA 3W4OA 4GS9B 3NOTC 4GNUA 2JCHA 3LR3A 5IS1A 3WS2A 2Q9MA 3NCKA 2Z6DA 1K25A 3E4PA 5HPFA 3K2NA 1GCEA 2E8IA 3S7OA 3UO9A 3VOYA 1DJAA 5FI6A 2VEAA 1N9BA 2RCXA 5DFYA 2B95A 3UB5P 2A3UA 2ZQ8A 5CRFA 1Y4OA 4HQAA 5HZHA 1HTZA 4R4SA 4N1HA 2DMWA 5FQKA 4KZ7A 2ZQCA 4NETA 4OPZA 1GHPA 2Y2HA 2ZLYA 3W2ZA 1GA0A 4UQIM 2WAFA 3NJAA 3VOZA 3LIBA 3SW1A 1O07A 1L3LA 3A0RA 4OP5A 2W3FA 4UHUA 4HH2A 3ZVWA 3JVUA 1KE0A 3ZYTA 3UNWA 1AXBA 3LUQA 4JXWA 3VFFA 4X1LA 3ITAA 3OLOA 4ETXA 4O8GA 3WRZA 3ZFZA 1XA1A 3IHBA 4LLOB 3SOIA 3T4TA 4Y13A 3OBFA 3TRCA 4GW9A 1V9YA 1FSYA 1K4FA 2HF6A 3MFXA 2YKFA 1JTDA 4OH0A 3T4LA 3V39A 4CLCE 5HDCA 5IU1A 2J7VA 4B4ZA 2VGKA 2MJ6A 4HI4A 3SZTA 1M6KA 5FEFA 1YSQA 3FPVA 2VV6A 4CJNA 2L1MA 4OQIA 5FASA 2ZC4B 2GJ3A 5EM0A 1MWUA 2Y2GA 2C6WB 1YMXA 1ONHA 4N1XA 3P09A 3UE0A 2Z2MB 5FQJA 5EECA 3BEBA 3W4PA 3B33A 3C8CA 3LR5A 3KX0X 4FOFA 3UE6A 3A3EA 1EWZA 1KVLA 4R3AA 2QJ7A 3HUOA 3W4QA 5EFWA 4DDSA 3WWXA 1MKIA 5DKLA 2Y2NA 4YWZA 1HVBA 1Y28A 4KZ9A 3UB8A 2WGIA 4NG2A 3EOIA 3MR0A 4PM8A 3TE8A 2H5SA 3UMDA 3KYQA 1EI5A 3UE1A 3PXPA 2XSSA 1Z6FA 3F1NB 5DTTA 5DF8A 3CUEA 3TJZC 4UA9A 4HBTA 3HVFA 1C3BA 3OPPA 4E3NA 1BYWA 5TR7A 1A0KA 4I39A 2W0NA 4P6ZS 2I72A 3LY4A 3D3OA 5EVEA 2Y91A 2VGJA 4DN0A 3NBLA 4BLMA 3VV4A 3FKWA 4X53A 1ZKJA 3N8SA 2ZQ9A 4Y5FA 3MBZA 3T4JA 3P7NA 1LSWA 3ZG9B 3BLMA 2M7UA 5FA7A 3FZCA 5E2EA 1OTAA 2Y2QA 5F69A 3CJMA 3NHQA 5DF7A 4LFUA 2WAEA 2QWSA 3P01A 2O99A 3H7WB 4WMCA 4B88A 3CI6A 4PKYA 5AVEA 4F94A 4QWOA 2OV5A 5G18A 3S7NA 4R1GA 3BY8A 3EWKA 4OQGA 4D2OA 3Q81A 5KSCA 4NXFA 2QZ6A 3BRMA 1NWZA 3RFBA 2EX6A 1LL9A 3DTEA 3IX8A 5GLCA 1NLYA 3V3RA 3VP4A 3NULA 1VEUA 1G68A 3CG5A 4L9FA 3BM6A 4N92A 4LV0A 3KSIA 2WADA 4PMAA 2OLUA 3QNBA 1JWPA 1VHMA 4RQ9A 2J3WA 5A8BA 4P6ZM 5FQMA 3LO7A 3U4LP 1E3UA 1YLPA 2VGLS 2DNSA 4Y17A 5J3WA 2OWJA 5M1AA 4DF6A 1W79A 3BFFA 4JGQA 1T19A 1L0GA 2WKQA 4KQDA 3UPNA 3SS3A 2UV0E 2A2LA 2BTFP 4XT2A 4K0XA 4ZJ2A 3G32A 4G3VA 3BJNA 3IQAA 4Y15A 3LFVA 4ZAMA 2Z6CA 4I3AA 3BWLA 3RTYA 2VKSA 4K08A 3LR4A 5FEGA 4H8RA 4KUKA 4JF6A 2V1BA 4PM9A 1QMEA 2FZ0A 5GLDA 3E2LA 1XKZA 4C6YA 3WS5A 4MBKA 2K7SA 4K0WA 4OVDA 1IKIA 2WZXA 4PM6A 4DXCA 1I2SA 4D60A 1MPLA 4RYEA 2JC7A 4KZBA 1KGFA 3G2YA 4ZDXA 4HP4A 4QY5A 3ZG0A 3MXQA 4BMWA 4FD8A 2HP9A 1WYBA 2XH9A 4LGWA 2XQZA 1Q2PA 3T50A 4EETB 3JYIA 4NXBA 3IS2A 3B3XA 3C5AA 2RL3A 4ZJ3A 2PU4A 4MNRA 3MS6A 2VGLM 4FTXA 5DF9A 5FQ9A 1PYYA 3N8LA 3OCNA 1H8MA 5EOOA 3PHYA 4XUZA 4C75A 2QJ5A 2VLGA 2L4RA 3G31A 4E3LA 2O0YA 1HZOA 5HD3A 2AVXA 4L9GA 1OTBA 3S7PA 3MZDA 1J3WA 1LT0A 2J8YA 2JKGA 1OTEA 3EGDC 1I2WA 3E4OA 2XROA 2HZ5A 2Y2OA 3UB9A 2PD8A 4EV4A 5IT5A 3OZHA 5F82A 1YLTA 2VV7A 4XXRA 5J4EA 4WL9A 1ERQA 4MMNA 1XP4A 2E8JA 1G5UA 5L8MA 5U47A 1ZC2A 5D3OA 1OT6A 2ZC7A 4IUKA 2VK3A 4JKTA 3GRJA 4GB7A 3BW6A 4IJGA 5AJGA 4NEED 4HH3A 1OTIA 3GQZA 4OQ0A 3A3IA 1OMEA 4O7DA 4IUHA 3G2ZA 5F6AA 3KYEA 5A90A 5J7EA 5KIZA 5MC7A 1ESIA 4JF4A 2O9CA 3E4QA 3SH8A 2EWVA 5I94A 4KZ8A 5A93A 3GECA 4JXGA 5DTKA 3HLCA 1FIKA 1W63Q 4FH2A 3MZEA 5F68A 2Y59A 4KZ3A 4MDZA 1PI4A 3UPPA 1H3QA 2XD5A 3Q82A 2DCFA 4P87A 2HPBA 1NY0A 1LL8A 1CEFA 2J9PA 3GV9A 4GOGA 4NKPA 2GDNA 4IBRA 3UPOA 4G3WA 3ZHHA 4Y0TA 1RGZA 1XJ2A 3VOLA 4P85A 3F1OB 1CQAA 1NJ4A 4F3LA 1IYPA 2CC1A 1WE4A 2HP6A 1VB6A 2B18A 2EFXA 4P6BA 4HBUA 4FCFA 5E2HA 5EM1A 1BTLA 4ME4A 1S0WA 1K6SA 4Y3IA 4G3KA 4Q8IA 4NXEA 5DJUA 3V3SA 4EUZA 1D1JA 1LHYA 4GD8A 4H6JB 5HARA 1S4RA 2JE5A 4DKIA 5F5YA 3DTIA 2PYPA 3Q07A 3F1PA 3GDIA 5EVLA 2Y2JA 1UWPX 4EEUA 1L2SA 3T4QA 2X71A 4GZBA 5EVID 3NY4A 4FSFA 3VP3A 1W8QA 1KDSA 1PWDA 4IVIA 3IBJA 1BLCA 3HJIA 2KDKA 5AVFA 2HJEA 1KVMA 3EGXC 5FI7A 1VQQA 4OQHA 1LL5A 4HJ4A 4CLCD 1N4OA 2XD1A 2ZC3B 5G4ZA 3C7UA 3NDEA 3VE4A 3IT9A 2EXAA 2BG1A 4X69A 2V20A 1QMFA 1LI9A 4LENA 3T1XA 3IH9A 4OPRA 2XGNA 4DXBA 3T1RA 3NOUC 1TDGA 3Q7ZA 4JGRA 3LR0A 3T1QB 3ZCZA 4FUWA 1H8ZA 3O3VA 4RVAA 5JYOA 4KQRA 1NZOA 4HP9A 3U2AA 3I7JA 4S2NC 4RX3A 3LICA 4X6TA 2OAP1 1IKGA 2J9OA 3LIAA 2D01A 4S2KA 3LI8A 4WUJA 3T4OA 2VX8A 1MKMA 2W1RA 3D72A 3F1OA 1G6AA 4KQOA 3UMEA 4WEKA 5GHZA 3MQQA 3FV7A 3G30A 4PM7A 2EXBA 1K55A 1L0DA 3MMHA 1KGGA 1FILA 4E3MA 2B5RA 3PR6A 3BLSA 1WYCA 1K54A 4BL2A 1H8YA 1VEUB 2BLSA 2PDRA 1PZPA 1PNEA 1F5MA 3PBSA 3DBAA 1H5XA 4QY6A 4XUXA 4O01A 3O5YA 1YMSA 4H6JA 3ISGA 1LSVA 2JKTI 3GVBA 1GHMA 3A3JA 3N4IA 1OJ5A 3M6HA 2B02A 4MBFA 2EA9A 3EQUA 2Y2MA 1OT9A 4EESA 5FAPA 2VV8A 2QHKA 5FAOA 2V9AA 4X68A 5L10A 3OPHA 5DKKA 1FR6A 5EPHA 2PYRA 1BSGA 1SDEA 2X01A 4XT2B 4B9OA 1T1BA 1S1YA 5FAQA 3VMAA 2W3DA 3VFHA 3CHWP 2XA7S 5CEDA 3LI9A 4KG6A 1GA9A 1JNUA 4ZTKA 4M3KA 2M7VA 3C38A 2KOIA 4HESA 1XJ3A 1TVFA 5CHMA 2WKIA 3IF6A 1XJ4A 3SH7A 3HLDA 3Q7VA 3N7WA 4OONA 5F1GA 3PBRA 4R3BA 4HJ3A 2M1CA 3ZNYA 2PR5A 2O9AA 1S67L 1NLZA 5FDHA 4IBXA 3GSGA 3MF0A 3HUNA 2PRFA 3FYZA 2P9VA 4GHIB 1PWCA 4R23A 4LCLA 4R3JA 1OTDA 1MXOA 3LIDA 5FL3A 2JN7A 1L0FA 3M2KA 5FSRA 3QP8A 1IELA 3C7VA 4HHDA 1LLBA 3IS2B 2ZM0A 2PBYA 2IA2A 4DE0A 3V50A 3PAEA 1K56D 4BBVA 2PU2A 3RJUA 1CK3A 4ID4A 2PAVP 4MN7A 5TJJA 2JKRM 1W63M 4KENB 5HSQA 4RA7A 3C30A 5TFQA 5G4YA 3MKFA 2R9WA 5TBMA 4S2JA 2XA7M 1UWNX 4Q0IA 1MWRA 4DDYA 2LB5A 1W8YA 3VSLA 2HDRA 4OPQA 1YSPA 1DJBA 3ZNTA 5F1FA 1T18A 4N9KA 4P0MA 5L07A 2ZQDA 4A5RA 2VJWA 4Y7PA 3B42A 2YKHA 1K57A 4S2LA 4QJGA 4IVKA 4WF0A 1OPXA 1DP6A 1K55C 3WS4A 3NDGA 3ZG8B 2EWWA 4WZ5A 2QKPA 3IBRA 4LV3A 1K54C 5K5BA 2Z2LB 4BJPA 3ITBA 4DJ2A 2XFTA 3BY9A 5GHXA 1DJCA 5L2FA 4GD6A 3OCLA 3A3FA 4E3JA 5HWWA 2INWA 3PYPA 1J9MA 4EBNA 5J8XA 3UB6A 4EQIA 3EEHA 3IX3A 2ZM8A 1NZUA 2V0UA 2JKFA 3OOVA 4EU0A 4PKYG 1WA9A 1KE3A 2HDQA 2I9VA 3CUEC 4M4XA 1T1CA 4WBGA 5HL6A 4DE3A 4B4XA 5A92A 4GHIA 4EXOA 1CJFA 1E25A 3VP1A 2JBFA 3R7WA 2PHYA 2HGVA
chains in the Genus database with same CATH topology
1D7EA 2D02A 1H3QA 3MFXA 1G6OA 1S1ZA 1ZHHB 4O0PA 2YKFA 3MJQA 3T4LA 2ZBBA 4CLCE 3KO6A 4GJ4A 4DJ3A 4B93A 5HDCA 5LBRA 3KYZA 1LL8A 2L0WA 5IU1A 4E04A 4ETZA 3KSGA 1KOUA 5KSHA 4NKPA 4R38A 2MJ6A 4G3WA 4HI4A 1T1AA 1XJ2A 1YSQA 3VOLA 3FPVA 2HF6A 2VV6A 4F3LB 3F1OB 2L1MA 4KUOA 3ZQ5A 5HPIA 4F3LA 3VE3A 2GJ3A 2K2NA 2PT7A 1ZTUA 4Q0HA 1VB6A 4OOMA 2KX6A 4WN5A 1S4SA 4ARZB 4MN5A 2B18A 3LIFA 2VA0A 4ARZA 3B33A 3C8CA 3LR5A 3T4SA 3KX0X 2HV1A 4HNBA 4FOFA 3UE6A 4II7A 2V1AA 4EQ1A 4ME4A 4R3AA 4PAUA 4Y3IA 3T4KA 2QJ7A 4G3KA 4R6LA 4NXEA 5DJUA 3C2WA 5EFWA 4WEJA 5DKLA 4YWZA 1Y28A 4H6JB 1F98A 3PBOA 1S4RA 3UB8A 3F1PB 5F5YA 2PYPA 5DFXA 2ZOHA 3F1PA 3EOIA 3MR0A 3GDIA 4EW7A 1P0ZA 3KSHA 1P9WA 3TE8A 1TS0A 2VZWA 1UWPX 4I3JA 4EEUA 3UMDA 3KYQA 4LPZA 3PXPA 4YOFA 3T4QA 2XSSA 1N9LA 1IOUA 1UGUA 4FSFA 4HIAA 3F1NB 2ZMVA 1G28A 2LB9A 2PR6A 3CUEA 3F1NA 3HJKA 4L0LA 3TJZC 5HDSA 5HD5A 3IBJA 3MQ0A 3HJIA 2KDKA 1BYWA 5AVFA 2HJEA 3K3CA 4I39A 2W0NA 3EGXC 3OC2A 4P6ZS 4CLCD 3D3OA 4HJ4A 1EW0A 5G4ZA 4DN0A 4ZRRA 3VE4A 1TS6A 3VV4A 1XFNA 2ZMFA 2GNXA 1GSWA 4Y5FA 2QYBA 3T4JA 3P7NA 3PBQA 3EEAA 3TW8A 1LSWA 4LRZE 1MZUA 3S7QA 3NOUC 1GSVA 2M7UA 5CX7A 4JGRA 3R4KA 3LR0A 5C5KA 2O9BA 1OTAA 2P04A 5F69A 4EERA 1TS7A 4LRXC 3NHQA 4PHTA 3FC7A 4CLCB 4HP9A 3U2AA 4MDZA 4WELA 2QWSA 3P01A 4CLCA 2JKTM 2O99A 3H7WB 2JHEA 3LICA 2OAP1 1TF1A 3H7WA 3CI6A 1D06A 2A24B 4PKYA 2NUPC 5AVEA 3LIAA 2A24A 2D01A 3LI8A 4WUJA 3T4OA 5HWTA 2VX8A 4GLQA 1MKMA 2W1RA 3D72A 3F1OA 4JGPA 4KQOA 3UMEA 4WEKA 3S7NA 3MQQA 4Y2FA 4CQHA 3BY8A 4HY8A 4DMZA 2W27A 2P7JA 3CWFA 4R70A 3EWKA 4Z1WA 3MMHA 1TS8A 4LRYC 4NXFA 3PR6A 1NWZA 3RFBA 1V9ZA 1NLYA 2PDRA 1F5MA 3ULFA 2CMNA 3PBSA 4L9FA 3DBAA 2WKPA 1DRMA 3KSIA 4MN6A 4O01A 3O5YA 2V0WA 2PD7A 1VHMA 3BQ8A 2J3WA 4H6JA 1YAXA 4RQ9A 5A8BA 1LSVA 2JKTI 4P6ZM 2VGLS 2G7UA 1OJ5A 4BWIA 4QPRA 2B02A 2W1TB 5J3WA 2EA9A 3EQUA 2OWJA 1OT9A 2OOLA 3CAXA 4EESA 2W1TA 2VV8A 2QHKA 2P08A 2V9AA 2H28A 4JGQA 1T19A 2WKQA 5DKKA 3JVVA 2GX5A 4KQDA 2PYRA 4YNRA 4OOLA 4XT2B 4B9OA 1T1BA 1S1YA 2A2LA 2W3DA 4XT2A 2XRNA 2XA7S 5HWVA 1NRJA 3LI9A 4G3VA 3BJNA 3NOPC 1JNUA 4WLAA 1XJ6A 3LFVA 2M7VA 3PBNA 3C38A 2KOIA 4I5SA 2Z6CA 1XJ3A 4HJ6A 4I3AA 3BWLA 3RTYA 2VKSA 4K08A 1XJ4A 3LR4A 2JKRI 3PBRA 1ODVA 4HJ3A 4KUKA 3MQOA 2M1CA 4JGOA 2V1BA 2PR5A 2J3TC 2O9AA 2FZ0A 1S67L 1NLZA 2K7SA 3MF0A 5HDDA 4I3IA 4GCZA 1LSXA 1TD5A 2HJ9C 1GSXA 3E98A 1MC0A 4GHIB 1OJGA 4L9EA 2FH5A 2J80A 2NUTC 3FPWA 3H82B 4HP4A 4UQIS 1OTDA 4BBUA 3H82A 3LIDA 4HOIA 3MXQA 4EUVA 5FL3A 4BMWA 2JN7A 1N9NA 1S66L 4HHDA 3UB7A 3A0VA 3T50A 4EETB 3IS2B 5DJTA 3CITA 3B47A 4NXGA 2Y79A 4NXBA 3IS2A 3CLOA 2Y8HA 2IA2A 4BBVA 4I38A 1P97A 3BQAA 1X0OA 5I5LA 2VGLM 2ZOIA 5DF9A 3ICYA 3OCNA 1H8MA 4MN7A 2GZAA 3PHYA 5TJJA 2W3EA 2QJ5A 2R78A 3H9WA 1N9OA 2KLIA 3RH8B 2J3TD 2L4RA 2VLGA 3LIEA 3PBTA 4GS9B 2O0YA 2JKRM 1W63M 3NOTC 5HD3A 5HSQA 5TBMB 4L9GA 4GS9A 4IHQA 3LR3A 3KSFA 3C30A 4CLCC 3EQVA 5G4YA 1OTBA 3S7PA 2BASA 5IS1A 1IFQA 5TBMA 1LT0A 3EGDC 1OTEA 2XA7M 1UWNX 4Q0IA 2W3HA 3E4OA 2XROA 2WKRA 2LB5A 2Z6DA 3E4PA 3UB9A 1P9RA 5HPFA 3K2NA 2PD8A 3S7OA 4AFIA 1YSPA 3E0YA 1T18A 1F9IA 5IT5A 2VEAA 2VJWA 5DFYA 3B42A 4UEYA 2YKHA 2VV7A 2OAQ1 4HQAA 5HZHA 5J4EA 4WF0A 4WL9A 3LYXA 1OPXA 1DP6A 4MCWA 1DP9A 4MMNA 2DMWA 2EWWA 5L8MA 2QKPA 3IBRA 3FG8A 5K5BA 2W3GA 1OT6A 1DP8A 4BJPA 4EEPA 4IUKA 4DJ2A 3UE3A 3BY9A 3BW6A 4IJGA 5AJGA 1STZA 3W2ZA 3OCLA 4NEED 4HH3A 1XFQA 1OTIA 5HWWA 2INWA 4UQIM 3PYPA 3NJAA 4IUHA 4Q0JA 3LIBA 3SW1A 5F6AA 3UB6A 3A0RA 2W3FA 3EEHA 4HH2A 5J7EA 5KIZA 3G6OA 5MC7A 3JVUA 2V0UA 3OOVA 3ZYTA 2O9CA 3E4QA 3K3DA 4EU0A 3A0SA 3LUQA 2EWVA 4PKYG 1YKDA 3OLOA 4ETXA 4O8GA 1WA9A 4BBTA 2I9VA 3GECA 3CUEC 4M4XA 1T1CA 5HL6A 4LLOB 3V67A 1W63Q 2K31A 4GHIA 2OWHA 3T4TA 4EXOA 3OBFA 3TRCA 4GW9A 1V9YA 3R7WB 5F68A 3R7WA 2PHYA 2HGVA 3HCYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IFQ A;  3KYQ A;  2NUT C;  4AFI A;  2NUP C;  3EGX C;  3EGD C;  1IOU A;  1H8M A;  3BW6 A;  2DMW A;  2VX8 A;  4B93 A; 
#chains in the Genus database with same CATH topology
 3A3D A;  1S1Z A;  1ZHH B;  3MJQ A;  1I5Q A;  3DAV A;  5KMW A;  2FFF B;  3IWQ A;  2IWC A;  3KYZ A;  3NIA A;  4ETZ A;  3JPU A;  1HD8 A;  4JBF A;  1KOU A;  2WGV A;  2Y2K A;  5HW3 A;  1ACF A;  1MBL A;  4GKU A;  4R38 A;  1SDN A;  1T1A A;  5HAI A;  4OOY A;  1RCJ A;  4F3L B;  4KUO A;  3ZQ5 A;  5TGF A;  2ZM2 A;  5HPI A;  5A91 A;  4E3K A;  5CEB A;  3MFD A;  2PT7 A;  1ZTU A;  4OOM A;  5E2G A;  3G34 A;  2KX6 A;  4KZ5 A;  1S4S A;  2C5W B;  1YLJ A;  3LIF A;  5HX9 A;  4ARZ A;  2ZL1 A;  5HL1 A;  2V1A A;  4DE1 A;  5DVA A;  4PAU A;  3RXX A;  2P74 A;  3T4K A;  2XEP A;  4LCM A;  4WEJ A;  1F2K A;  1PW8 A;  2IWB A;  3OPL A;  4KG2 A;  1F98 A;  3NI9 A;  2ZQ7 A;  3F1P B;  2ZOH A;  5CHU A;  4ESP A;  1DY6 A;  4EW7 A;  1P0Z A;  3KSH A;  1P9W A;  4UAA A;  1TS0 A;  3LEQ A;  4YOF A;  4HIA A;  5FDS A;  4MLL A;  3BFC A;  2LB9 A;  2PR6 A;  4L0L A;  5HDS A;  3MQ0 A;  4X55 A;  4X1M A;  4OP8 A;  1PW1 A;  4Z9Q A;  1PWG A;  3IXH A;  3WS1 A;  3Q1F A;  5GLA A;  1K57 C;  1XFN A;  2ZMF A;  5HAQ A;  2GNX A;  1BUE A;  2H0T A;  2A49 A;  2QYB A;  3PBQ A;  3EEA A;  4LRZ E;  5GHY A;  4WZ5 C;  5EVI A;  1XGJ A;  3IWO A;  5CX7 A;  5C5K A;  2O9B A;  2P04 A;  1IYS A;  4EER A;  1TS7 A;  1YLW A;  4PHT A;  2ZJ9 A;  3CPT A;  4WEL A;  4CLC A;  2ZC6 B;  1ERM A;  2JHE A;  4EWF A;  1TF1 A;  1W5D A;  2WK0 A;  4BEN A;  1YPR A;  2A24 A;  4X25 A;  1IYQ A;  3BFD A;  3W8K A;  1CEG A;  4CQH A;  4HY8 A;  2P7J A;  3CWF A;  3GMW A;  1TDL A;  5E2F A;  4Z1W A;  1TS8 A;  4LRY C;  2WYX A;  3IHA A;  2ZMA A;  2Y2P A;  1V9Z A;  4BQM A;  1K4E A;  1ES2 A;  4YFM A;  2WKP A;  4MN6 A;  3C4O A;  3IXG A;  1Y54 A;  4QB8 A;  1ESU A;  2G7U A;  4BWI A;  3QP1 A;  2OLV A;  3CAX A;  2W1T A;  2P08 A;  3PTE A;  3TG9 A;  3UDI A;  3MXS A;  4S2O A;  3N6I A;  3JVV A;  1E4D A;  2WKE A;  3DTK A;  2WGW A;  3O86 A;  3T1S A;  2FFY A;  4OLD A;  1LI0 A;  1VM1 A;  5GL9 A;  1Z09 A;  2EX9 A;  2H10 A;  5FI2 A;  1BUL A;  1IEM A;  3ZGA B;  3PBN A;  4I5S A;  3IF6 B;  4FH4 A;  3Q7V B;  3N8R A;  4CPK A;  3UDF A;  2JKR I;  1NRF A;  4BL3 A;  4Y0O A;  3MQO A;  2J3T C;  2XR0 A;  3AGF A;  4OPY A;  5HDD A;  4GCZ A;  1LSX A;  1TD5 A;  3S22 A;  1U60 A;  2HJ9 C;  2HP5 A;  4JXS A;  2P9V B;  1MY8 A;  3BEC A;  3IH8 A;  1MC0 A;  4L9E A;  4BD1 A;  1JTG A;  2J80 A;  3FPW A;  5CGW A;  1PFL A;  3H82 A;  1SZV A;  5CEC A;  1K6R A;  5FAT A;  4EUV A;  1N9N A;  3D4F A;  1S6R A;  4S2P A;  1XX2 A;  3BFE A;  3CIT A;  3B47 A;  4RX2 A;  3NC8 A;  2Y8H A;  5EOE A;  2IWD A;  4U3T A;  1P97 A;  1SKO A;  1FSW A;  5EVI C;  5I5L A;  2ZOI A;  4EBP A;  1IYO A;  3ICY A;  2GZA A;  4WM9 A;  2W3E A;  1ONG A;  1H0M A;  2V1Z A;  1N9O A;  2KLI A;  1SHV A;  1YLZ A;  3UN7 A;  3LEZ A;  4WZ4 A;  3VP2 A;  4UA6 A;  5TBM B;  4GS9 A;  4IHQ A;  4CLC C;  3KSF A;  3EQV A;  2BAS A;  1IFQ A;  1FR1 A;  1ZG4 A;  2W3H A;  1YQS A;  3ZVT A;  2WKR A;  2XF3 A;  2HDS A;  3SH9 A;  1P9R A;  1K56 A;  4AFI A;  3E0Y A;  5IHV A;  2EX2 A;  1F9I A;  2ZC5 B;  3UY6 A;  4UEY A;  5CGX A;  4E6W A;  5EE8 A;  2OAQ 1;  1HLU P;  3DTM A;  3LYX A;  4MCW A;  1DP9 A;  1YLY A;  5FQI A;  3FG8 A;  1PI5 A;  2W3G A;  1DP8 A;  4E3I A;  1NYY A;  4EEP A;  1JVJ A;  3UE3 A;  3DWZ A;  3O88 A;  1STZ A;  3DWK A;  5CHJ A;  1XFQ A;  3L9K A;  3IXB A;  4R0Q A;  4Q0J A;  3QNC A;  1ERO A;  5AQB A;  1NXY A;  3SS5 A;  1KDW A;  3G6O A;  3HRE A;  3T12 B;  1KGE A;  2WUQ A;  3K3D A;  3A0S A;  1YKD A;  3ZG5 A;  1BLH A;  4BBT A;  1RGY A;  1GHI A;  5GLB A;  3V67 A;  2K31 A;  2OWH A;  5EV0 A;  5AQ7 A;  1VET B;  3R7W B;  2QPN A;  5HAP A;  2ZQA A;  3HCY A;  1D7E A;  4PM5 A;  2D02 A;  1G6O A;  4O0P A;  5BOH A;  2Y55 A;  2ZBB A;  3KO6 A;  4GJ4 A;  3DW0 A;  4DJ3 A;  4B93 A;  4HEF A;  4X56 A;  5LBR A;  4E04 A;  2L0W A;  1SKF A;  3MZF A;  3KSG A;  3QP4 A;  3UDX A;  3AGD A;  4DRT A;  3CZD A;  5M19 A;  3QP5 A;  1RP5 A;  5KSH A;  1FQG A;  2ZD8 A;  4UA7 A;  1ES4 A;  3GTC A;  1K38 A;  4QU3 A;  1CI8 A;  3D9Y A;  3VE3 A;  5E43 A;  3QHY A;  3TOI A;  2K2N A;  4Q0H A;  1XXM A;  5DTS A;  1FOF A;  4WN5 A;  4ARZ B;  4MN5 A;  2H0Y A;  1KE4 A;  2ZL1 B;  4S2I A;  2VA0 A;  1SCW A;  5CER A;  4U0T A;  3T4S A;  3FKV A;  2HV1 A;  4HNB A;  1MWS A;  3S1Y A;  4II7 A;  4EQ1 A;  4BD0 A;  3SS4 A;  3CMZ A;  3PAG A;  4R6L A;  3C2W A;  4NK3 A;  3HBR A;  4E6X A;  4PPR A;  4QHC A;  2V8C A;  4OLG A;  3BFG A;  3PBO A;  1PZO A;  4GN2 A;  5CXW A;  1BT5 A;  5DFX A;  2VZW A;  4I3J A;  1XGI A;  2XFS A;  4LPZ A;  1N9L A;  1IOU A;  2EX8 A;  1UGU A;  2ZMV A;  1G28 A;  3F1N A;  3HJK A;  2G2W A;  1NYM A;  4EBL A;  5HD5 A;  1JWV A;  3LY3 A;  3K3C A;  4E3O A;  1XPB A;  3OC2 A;  3LGO A;  2HDU A;  1K0K A;  1EW0 A;  4WMC D;  3AGE A;  4ZRR A;  3HLE A;  5KZH A;  4QD4 A;  3IF5 A;  1BZA A;  1TS6 A;  3IX4 A;  5CGS A;  4OKP A;  1GSW A;  5EVI B;  3TW8 A;  3TSG A;  1MZU A;  1YT4 A;  2OSU A;  3S7Q A;  3IXD A;  1GSV A;  1CI9 A;  1VET A;  4DE2 A;  4MEZ A;  3R4K A;  3HLG A;  1ES5 A;  3CPT B;  4KG5 A;  4LRX C;  3FC7 A;  1ALQ A;  3IF6 C;  4CLC B;  2XDM A;  3ZG7 B;  5AQ9 A;  3HLW A;  1O7E A;  2JKT M;  3GR2 A;  4MBH A;  3P98 A;  3H7W A;  3L7H A;  1D06 A;  2A24 B;  2NUP C;  3C4P A;  3VSK A;  1XA7 A;  5HWT A;  4GLQ A;  2DRW A;  4JGP A;  2WZZ A;  1E3U D;  1CF0 A;  4Y0U A;  4Y2F A;  4DMZ A;  2W27 A;  4KZ4 A;  2Q9N A;  2V2F F;  4R70 A;  4U0X A;  3RXW A;  3WRT A;  4JXV A;  1PRQ A;  2R9X A;  3ULF A;  3HL9 A;  1ES3 A;  2CMN A;  1DRM A;  1JWZ A;  2V0W A;  1Q2Q A;  2PD7 A;  4ZJ1 A;  3HUM A;  3BQ8 A;  1YAX A;  4KZA A;  5JYP A;  2V8F A;  3NEC A;  1L0E A;  4QPR A;  2W1T B;  2OOL A;  1TEM A;  1MWT A;  4N9L A;  2H28 A;  3MSH A;  2QMI A;  2WGW B;  2GX5 A;  2UWX A;  4YNR A;  4OOL A;  4JF5 A;  2XRN A;  5HWV A;  1NRJ A;  3M2J A;  2X02 A;  3NOP C;  4JPM A;  4WLA A;  1XJ6 A;  2Q0O A;  5CTN A;  4YIN A;  4HJ6 A;  4IED A;  4ZBE A;  1PIO A;  5EUA A;  4S2N A;  2PBD P;  5L09 A;  2Y2L A;  4K91 A;  2Y2I A;  1FCM A;  3E2K A;  1ODV A;  5AQA A;  4JGO A;  4KZ6 A;  2G2U A;  2WKH A;  4I3I A;  2XK1 A;  3HLF A;  1W7F A;  3G4P A;  3IWI A;  4WYY A;  4GDB A;  1GSX A;  3E98 A;  5F83 A;  1OJG A;  1FCN A;  2XLN A;  2FH5 A;  3WS0 A;  2NUT C;  3H82 B;  3VP0 A;  3FWL A;  4UQI S;  1BLS A;  2EFU A;  4BBU A;  5HFO A;  3V5M A;  4HOI A;  4GDN A;  3ZDJ A;  3HLB A;  4JLF A;  1S66 L;  4KQQ A;  3QP6 A;  1AWI A;  3UB7 A;  3A0V A;  1ZG6 A;  5DJT A;  4NXG A;  3OPR A;  2Y79 A;  3QP2 A;  3CLO A;  4LV2 A;  3BYD A;  4R4R A;  3MKE A;  2ACG A;  4S2M A;  1SKO B;  3MXR A;  4I38 A;  3BQA A;  1M40 A;  1X0O A;  5FQQ A;  3M6B A;  3G35 A;  5CTM A;  2Y4A A;  3O87 A;  3LCE A;  1BLP A;  4C3Q A;  2R78 A;  3H9W A;  3S4X A;  1FCO A;  5M18 A;  4LV1 A;  3RH8 B;  1YM1 A;  2J3T D;  3LIE A;  3PBT A;  3W4O A;  4GS9 B;  3NOT C;  4GNU A;  2JCH A;  3LR3 A;  5IS1 A;  3WS2 A;  2Q9M A;  3NCK A;  2Z6D A;  1K25 A;  3E4P A;  5HPF A;  3K2N A;  1GCE A;  2E8I A;  3S7O A;  3UO9 A;  3VOY A;  1DJA A;  5FI6 A;  2VEA A;  1N9B A;  2RCX A;  5DFY A;  2B95 A;  3UB5 P;  2A3U A;  2ZQ8 A;  5CRF A;  1Y4O A;  4HQA A;  5HZH A;  1HTZ A;  4R4S A;  4N1H A;  2DMW A;  5FQK A;  4KZ7 A;  2ZQC A;  4NET A;  4OPZ A;  1GHP A;  2Y2H A;  2ZLY A;  3W2Z A;  1GA0 A;  4UQI M;  2WAF A;  3NJA A;  3VOZ A;  3LIB A;  3SW1 A;  1O07 A;  1L3L A;  3A0R A;  4OP5 A;  2W3F A;  4UHU A;  4HH2 A;  3ZVW A;  3JVU A;  1KE0 A;  3ZYT A;  3UNW A;  1AXB A;  3LUQ A;  4JXW A;  3VFF A;  4X1L A;  3ITA A;  3OLO A;  4ETX A;  4O8G A;  3WRZ A;  3ZFZ A;  1XA1 A;  3IHB A;  4LLO B;  3SOI A;  3T4T A;  4Y13 A;  3OBF A;  3TRC A;  4GW9 A;  1V9Y A;  1FSY A;  1K4F A;  2HF6 A;  3MFX A;  2YKF A;  1JTD A;  4OH0 A;  3T4L A;  3V39 A;  4CLC E;  5HDC A;  5IU1 A;  2J7V A;  4B4Z A;  2VGK A;  2MJ6 A;  4HI4 A;  3SZT A;  1M6K A;  5FEF A;  1YSQ A;  3FPV A;  2VV6 A;  4CJN A;  2L1M A;  4OQI A;  5FAS A;  2ZC4 B;  2GJ3 A;  5EM0 A;  1MWU A;  2Y2G A;  2C6W B;  1YMX A;  1ONH A;  4N1X A;  3P09 A;  3UE0 A;  2Z2M B;  5FQJ A;  5EEC A;  3BEB A;  3W4P A;  3B33 A;  3C8C A;  3LR5 A;  3KX0 X;  4FOF A;  3UE6 A;  3A3E A;  1EWZ A;  1KVL A;  4R3A A;  2QJ7 A;  3HUO A;  3W4Q A;  5EFW A;  4DDS A;  3WWX A;  1MKI A;  5DKL A;  2Y2N A;  4YWZ A;  1HVB A;  1Y28 A;  4KZ9 A;  3UB8 A;  2WGI A;  4NG2 A;  3EOI A;  3MR0 A;  4PM8 A;  3TE8 A;  2H5S A;  3UMD A;  3KYQ A;  1EI5 A;  3UE1 A;  3PXP A;  2XSS A;  1Z6F A;  3F1N B;  5DTT A;  5DF8 A;  3CUE A;  3TJZ C;  4UA9 A;  4HBT A;  3HVF A;  1C3B A;  3OPP A;  4E3N A;  1BYW A;  5TR7 A;  1A0K A;  4I39 A;  2W0N A;  4P6Z S;  2I72 A;  3LY4 A;  3D3O A;  5EVE A;  2Y91 A;  2VGJ A;  4DN0 A;  3NBL A;  4BLM A;  3VV4 A;  3FKW A;  4X53 A;  1ZKJ A;  3N8S A;  2ZQ9 A;  4Y5F A;  3MBZ A;  3T4J A;  3P7N A;  1LSW A;  3ZG9 B;  3BLM A;  2M7U A;  5FA7 A;  3FZC A;  5E2E A;  1OTA A;  2Y2Q A;  5F69 A;  3CJM A;  3NHQ A;  5DF7 A;  4LFU A;  2WAE A;  2QWS A;  3P01 A;  2O99 A;  3H7W B;  4WMC A;  4B88 A;  3CI6 A;  4PKY A;  5AVE A;  4F94 A;  4QWO A;  2OV5 A;  5G18 A;  3S7N A;  4R1G A;  3BY8 A;  3EWK A;  4OQG A;  4D2O A;  3Q81 A;  5KSC A;  4NXF A;  2QZ6 A;  3BRM A;  1NWZ A;  3RFB A;  2EX6 A;  1LL9 A;  3DTE A;  3IX8 A;  5GLC A;  1NLY A;  3V3R A;  3VP4 A;  3NUL A;  1VEU A;  1G68 A;  3CG5 A;  4L9F A;  3BM6 A;  4N92 A;  4LV0 A;  3KSI A;  2WAD A;  4PMA A;  2OLU A;  3QNB A;  1JWP A;  1VHM A;  4RQ9 A;  2J3W A;  5A8B A;  4P6Z M;  5FQM A;  3LO7 A;  3U4L P;  1E3U A;  1YLP A;  2VGL S;  2DNS A;  4Y17 A;  5J3W A;  2OWJ A;  5M1A A;  4DF6 A;  1W79 A;  3BFF A;  4JGQ A;  1T19 A;  1L0G A;  2WKQ A;  4KQD A;  3UPN A;  3SS3 A;  2UV0 E;  2A2L A;  2BTF P;  4XT2 A;  4K0X A;  4ZJ2 A;  3G32 A;  4G3V A;  3BJN A;  3IQA A;  4Y15 A;  3LFV A;  4ZAM A;  2Z6C A;  4I3A A;  3BWL A;  3RTY A;  2VKS A;  4K08 A;  3LR4 A;  5FEG A;  4H8R A;  4KUK A;  4JF6 A;  2V1B A;  4PM9 A;  1QME A;  2FZ0 A;  5GLD A;  3E2L A;  1XKZ A;  4C6Y A;  3WS5 A;  4MBK A;  2K7S A;  4K0W A;  4OVD A;  1IKI A;  2WZX A;  4PM6 A;  4DXC A;  1I2S A;  4D60 A;  1MPL A;  4RYE A;  2JC7 A;  4KZB A;  1KGF A;  3G2Y A;  4ZDX A;  4HP4 A;  4QY5 A;  3ZG0 A;  3MXQ A;  4BMW A;  4FD8 A;  2HP9 A;  1WYB A;  2XH9 A;  4LGW A;  2XQZ A;  1Q2P A;  3T50 A;  4EET B;  3JYI A;  4NXB A;  3IS2 A;  3B3X A;  3C5A A;  2RL3 A;  4ZJ3 A;  2PU4 A;  4MNR A;  3MS6 A;  2VGL M;  4FTX A;  5DF9 A;  5FQ9 A;  1PYY A;  3N8L A;  3OCN A;  1H8M A;  5EOO A;  3PHY A;  4XUZ A;  4C75 A;  2QJ5 A;  2VLG A;  2L4R A;  3G31 A;  4E3L A;  2O0Y A;  1HZO A;  5HD3 A;  2AVX A;  4L9G A;  1OTB A;  3S7P A;  3MZD A;  1J3W A;  1LT0 A;  2J8Y A;  2JKG A;  1OTE A;  3EGD C;  1I2W A;  3E4O A;  2XRO A;  2HZ5 A;  2Y2O A;  3UB9 A;  2PD8 A;  4EV4 A;  5IT5 A;  3OZH A;  5F82 A;  1YLT A;  2VV7 A;  4XXR A;  5J4E A;  4WL9 A;  1ERQ A;  4MMN A;  1XP4 A;  2E8J A;  1G5U A;  5L8M A;  5U47 A;  1ZC2 A;  5D3O A;  1OT6 A;  2ZC7 A;  4IUK A;  2VK3 A;  4JKT A;  3GRJ A;  4GB7 A;  3BW6 A;  4IJG A;  5AJG A;  4NEE D;  4HH3 A;  1OTI A;  3GQZ A;  4OQ0 A;  3A3I A;  1OME A;  4O7D A;  4IUH A;  3G2Z A;  5F6A A;  3KYE A;  5A90 A;  5J7E A;  5KIZ A;  5MC7 A;  1ESI A;  4JF4 A;  2O9C A;  3E4Q A;  3SH8 A;  2EWV A;  5I94 A;  4KZ8 A;  5A93 A;  3GEC A;  4JXG A;  5DTK A;  3HLC A;  1FIK A;  1W63 Q;  4FH2 A;  3MZE A;  5F68 A;  2Y59 A;  4KZ3 A;  4MDZ A;  1PI4 A;  3UPP A;  1H3Q A;  2XD5 A;  3Q82 A;  2DCF A;  4P87 A;  2HPB A;  1NY0 A;  1LL8 A;  1CEF A;  2J9P A;  3GV9 A;  4GOG A;  4NKP A;  2GDN A;  4IBR A;  3UPO A;  4G3W A;  3ZHH A;  4Y0T A;  1RGZ A;  1XJ2 A;  3VOL A;  4P85 A;  3F1O B;  1CQA A;  1NJ4 A;  4F3L A;  1IYP A;  2CC1 A;  1WE4 A;  2HP6 A;  1VB6 A;  2B18 A;  2EFX A;  4P6B A;  4HBU A;  4FCF A;  5E2H A;  5EM1 A;  1BTL A;  4ME4 A;  1S0W A;  1K6S A;  4Y3I A;  4G3K A;  4Q8I A;  4NXE A;  5DJU A;  3V3S A;  4EUZ A;  1D1J A;  1LHY A;  4GD8 A;  4H6J B;  5HAR A;  1S4R A;  2JE5 A;  4DKI A;  5F5Y A;  3DTI A;  2PYP A;  3Q07 A;  3F1P A;  3GDI A;  5EVL A;  2Y2J A;  1UWP X;  4EEU A;  1L2S A;  3T4Q A;  2X71 A;  4GZB A;  5EVI D;  3NY4 A;  4FSF A;  3VP3 A;  1W8Q A;  1KDS A;  1PWD A;  4IVI A;  3IBJ A;  1BLC A;  3HJI A;  2KDK A;  5AVF A;  2HJE A;  1KVM A;  3EGX C;  5FI7 A;  1VQQ A;  4OQH A;  1LL5 A;  4HJ4 A;  4CLC D;  1N4O A;  2XD1 A;  2ZC3 B;  5G4Z A;  3C7U A;  3NDE A;  3VE4 A;  3IT9 A;  2EXA A;  2BG1 A;  4X69 A;  2V20 A;  1QMF A;  1LI9 A;  4LEN A;  3T1X A;  3IH9 A;  4OPR A;  2XGN A;  4DXB A;  3T1R A;  3NOU C;  1TDG A;  3Q7Z A;  4JGR A;  3LR0 A;  3T1Q B;  3ZCZ A;  4FUW A;  1H8Z A;  3O3V A;  4RVA A;  5JYO A;  4KQR A;  1NZO A;  4HP9 A;  3U2A A;  3I7J A;  4S2N C;  4RX3 A;  3LIC A;  4X6T A;  2OAP 1;  1IKG A;  2J9O A;  3LIA A;  2D01 A;  4S2K A;  3LI8 A;  4WUJ A;  3T4O A;  2VX8 A;  1MKM A;  2W1R A;  3D72 A;  3F1O A;  1G6A A;  4KQO A;  3UME A;  4WEK A;  5GHZ A;  3MQQ A;  3FV7 A;  3G30 A;  4PM7 A;  2EXB A;  1K55 A;  1L0D A;  3MMH A;  1KGG A;  1FIL A;  4E3M A;  2B5R A;  3PR6 A;  3BLS A;  1WYC A;  1K54 A;  4BL2 A;  1H8Y A;  1VEU B;  2BLS A;  2PDR A;  1PZP A;  1PNE A;  1F5M A;  3PBS A;  3DBA A;  1H5X A;  4QY6 A;  4XUX A;  4O01 A;  3O5Y A;  1YMS A;  4H6J A;  3ISG A;  1LSV A;  2JKT I;  3GVB A;  1GHM A;  3A3J A;  3N4I A;  1OJ5 A;  3M6H A;  2B02 A;  4MBF A;  2EA9 A;  3EQU A;  2Y2M A;  1OT9 A;  4EES A;  5FAP A;  2VV8 A;  2QHK A;  5FAO A;  2V9A A;  4X68 A;  5L10 A;  3OPH A;  5DKK A;  1FR6 A;  5EPH A;  2PYR A;  1BSG A;  1SDE A;  2X01 A;  4XT2 B;  4B9O A;  1T1B A;  1S1Y A;  5FAQ A;  3VMA A;  2W3D A;  3VFH A;  3CHW P;  2XA7 S;  5CED A;  3LI9 A;  4KG6 A;  1GA9 A;  1JNU A;  4ZTK A;  4M3K A;  2M7V A;  3C38 A;  2KOI A;  4HES A;  1XJ3 A;  1TVF A;  5CHM A;  2WKI A;  3IF6 A;  1XJ4 A;  3SH7 A;  3HLD A;  3Q7V A;  3N7W A;  4OON A;  5F1G A;  3PBR A;  4R3B A;  4HJ3 A;  2M1C A;  3ZNY A;  2PR5 A;  2O9A A;  1S67 L;  1NLZ A;  5FDH A;  4IBX A;  3GSG A;  3MF0 A;  3HUN A;  2PRF A;  3FYZ A;  2P9V A;  4GHI B;  1PWC A;  4R23 A;  4LCL A;  4R3J A;  1OTD A;  1MXO A;  3LID A;  5FL3 A;  2JN7 A;  1L0F A;  3M2K A;  5FSR A;  3QP8 A;  1IEL A;  3C7V A;  4HHD A;  1LLB A;  3IS2 B;  2ZM0 A;  2PBY A;  2IA2 A;  4DE0 A;  3V50 A;  3PAE A;  1K56 D;  4BBV A;  2PU2 A;  3RJU A;  1CK3 A;  4ID4 A;  2PAV P;  4MN7 A;  5TJJ A;  2JKR M;  1W63 M;  4KEN B;  5HSQ A;  4RA7 A;  3C30 A;  5TFQ A;  5G4Y A;  3MKF A;  2R9W A;  5TBM A;  4S2J A;  2XA7 M;  1UWN X;  4Q0I A;  1MWR A;  4DDY A;  2LB5 A;  1W8Y A;  3VSL A;  2HDR A;  4OPQ A;  1YSP A;  1DJB A;  3ZNT A;  5F1F A;  1T18 A;  4N9K A;  4P0M A;  5L07 A;  2ZQD A;  4A5R A;  2VJW A;  4Y7P A;  3B42 A;  2YKH A;  1K57 A;  4S2L A;  4QJG A;  4IVK A;  4WF0 A;  1OPX A;  1DP6 A;  1K55 C;  3WS4 A;  3NDG A;  3ZG8 B;  2EWW A;  4WZ5 A;  2QKP A;  3IBR A;  4LV3 A;  1K54 C;  5K5B A;  2Z2L B;  4BJP A;  3ITB A;  4DJ2 A;  2XFT A;  3BY9 A;  5GHX A;  1DJC A;  5L2F A;  4GD6 A;  3OCL A;  3A3F A;  4E3J A;  5HWW A;  2INW A;  3PYP A;  1J9M A;  4EBN A;  5J8X A;  3UB6 A;  4EQI A;  3EEH A;  3IX3 A;  2ZM8 A;  1NZU A;  2V0U A;  2JKF A;  3OOV A;  4EU0 A;  4PKY G;  1WA9 A;  1KE3 A;  2HDQ A;  2I9V A;  3CUE C;  4M4X A;  1T1C A;  4WBG A;  5HL6 A;  4DE3 A;  4B4X A;  5A92 A;  4GHI A;  4EXO A;  1CJF A;  1E25 A;  3VP1 A;  2JBF A;  3R7W A;  2PHY A;  2HGV A; 
#chains in the Genus database with same CATH homology
 1D7E A;  2D02 A;  1H3Q A;  3MFX A;  1G6O A;  1S1Z A;  1ZHH B;  4O0P A;  2YKF A;  3MJQ A;  3T4L A;  2ZBB A;  4CLC E;  3KO6 A;  4GJ4 A;  4DJ3 A;  4B93 A;  5HDC A;  5LBR A;  3KYZ A;  1LL8 A;  2L0W A;  5IU1 A;  4E04 A;  4ETZ A;  3KSG A;  1KOU A;  5KSH A;  4NKP A;  4R38 A;  2MJ6 A;  4G3W A;  4HI4 A;  1T1A A;  1XJ2 A;  1YSQ A;  3VOL A;  3FPV A;  2HF6 A;  2VV6 A;  4F3L B;  3F1O B;  2L1M A;  4KUO A;  3ZQ5 A;  5HPI A;  4F3L A;  3VE3 A;  2GJ3 A;  2K2N A;  2PT7 A;  1ZTU A;  4Q0H A;  1VB6 A;  4OOM A;  2KX6 A;  4WN5 A;  1S4S A;  4ARZ B;  4MN5 A;  2B18 A;  3LIF A;  2VA0 A;  4ARZ A;  3B33 A;  3C8C A;  3LR5 A;  3T4S A;  3KX0 X;  2HV1 A;  4HNB A;  4FOF A;  3UE6 A;  4II7 A;  2V1A A;  4EQ1 A;  4ME4 A;  4R3A A;  4PAU A;  4Y3I A;  3T4K A;  2QJ7 A;  4G3K A;  4R6L A;  4NXE A;  5DJU A;  3C2W A;  5EFW A;  4WEJ A;  5DKL A;  4YWZ A;  1Y28 A;  4H6J B;  1F98 A;  3PBO A;  1S4R A;  3UB8 A;  3F1P B;  5F5Y A;  2PYP A;  5DFX A;  2ZOH A;  3F1P A;  3EOI A;  3MR0 A;  3GDI A;  4EW7 A;  1P0Z A;  3KSH A;  1P9W A;  3TE8 A;  1TS0 A;  2VZW A;  1UWP X;  4I3J A;  4EEU A;  3UMD A;  3KYQ A;  4LPZ A;  3PXP A;  4YOF A;  3T4Q A;  2XSS A;  1N9L A;  1IOU A;  1UGU A;  4FSF A;  4HIA A;  3F1N B;  2ZMV A;  1G28 A;  2LB9 A;  2PR6 A;  3CUE A;  3F1N A;  3HJK A;  4L0L A;  3TJZ C;  5HDS A;  5HD5 A;  3IBJ A;  3MQ0 A;  3HJI A;  2KDK A;  1BYW A;  5AVF A;  2HJE A;  3K3C A;  4I39 A;  2W0N A;  3EGX C;  3OC2 A;  4P6Z S;  4CLC D;  3D3O A;  4HJ4 A;  1EW0 A;  5G4Z A;  4DN0 A;  4ZRR A;  3VE4 A;  1TS6 A;  3VV4 A;  1XFN A;  2ZMF A;  2GNX A;  1GSW A;  4Y5F A;  2QYB A;  3T4J A;  3P7N A;  3PBQ A;  3EEA A;  3TW8 A;  1LSW A;  4LRZ E;  1MZU A;  3S7Q A;  3NOU C;  1GSV A;  2M7U A;  5CX7 A;  4JGR A;  3R4K A;  3LR0 A;  5C5K A;  2O9B A;  1OTA A;  2P04 A;  5F69 A;  4EER A;  1TS7 A;  4LRX C;  3NHQ A;  4PHT A;  3FC7 A;  4CLC B;  4HP9 A;  3U2A A;  4MDZ A;  4WEL A;  2QWS A;  3P01 A;  4CLC A;  2JKT M;  2O99 A;  3H7W B;  2JHE A;  3LIC A;  2OAP 1;  1TF1 A;  3H7W A;  3CI6 A;  1D06 A;  2A24 B;  4PKY A;  2NUP C;  5AVE A;  3LIA A;  2A24 A;  2D01 A;  3LI8 A;  4WUJ A;  3T4O A;  5HWT A;  2VX8 A;  4GLQ A;  1MKM A;  2W1R A;  3D72 A;  3F1O A;  4JGP A;  4KQO A;  3UME A;  4WEK A;  3S7N A;  3MQQ A;  4Y2F A;  4CQH A;  3BY8 A;  4HY8 A;  4DMZ A;  2W27 A;  2P7J A;  3CWF A;  4R70 A;  3EWK A;  4Z1W A;  3MMH A;  1TS8 A;  4LRY C;  4NXF A;  3PR6 A;  1NWZ A;  3RFB A;  1V9Z A;  1NLY A;  2PDR A;  1F5M A;  3ULF A;  2CMN A;  3PBS A;  4L9F A;  3DBA A;  2WKP A;  1DRM A;  3KSI A;  4MN6 A;  4O01 A;  3O5Y A;  2V0W A;  2PD7 A;  1VHM A;  3BQ8 A;  2J3W A;  4H6J A;  1YAX A;  4RQ9 A;  5A8B A;  1LSV A;  2JKT I;  4P6Z M;  2VGL S;  2G7U A;  1OJ5 A;  4BWI A;  4QPR A;  2B02 A;  2W1T B;  5J3W A;  2EA9 A;  3EQU A;  2OWJ A;  1OT9 A;  2OOL A;  3CAX A;  4EES A;  2W1T A;  2VV8 A;  2QHK A;  2P08 A;  2V9A A;  2H28 A;  4JGQ A;  1T19 A;  2WKQ A;  5DKK A;  3JVV A;  2GX5 A;  4KQD A;  2PYR A;  4YNR A;  4OOL A;  4XT2 B;  4B9O A;  1T1B A;  1S1Y A;  2A2L A;  2W3D A;  4XT2 A;  2XRN A;  2XA7 S;  5HWV A;  1NRJ A;  3LI9 A;  4G3V A;  3BJN A;  3NOP C;  1JNU A;  4WLA A;  1XJ6 A;  3LFV A;  2M7V A;  3PBN A;  3C38 A;  2KOI A;  4I5S A;  2Z6C A;  1XJ3 A;  4HJ6 A;  4I3A A;  3BWL A;  3RTY A;  2VKS A;  4K08 A;  1XJ4 A;  3LR4 A;  2JKR I;  3PBR A;  1ODV A;  4HJ3 A;  4KUK A;  3MQO A;  2M1C A;  4JGO A;  2V1B A;  2PR5 A;  2J3T C;  2O9A A;  2FZ0 A;  1S67 L;  1NLZ A;  2K7S A;  3MF0 A;  5HDD A;  4I3I A;  4GCZ A;  1LSX A;  1TD5 A;  2HJ9 C;  1GSX A;  3E98 A;  1MC0 A;  4GHI B;  1OJG A;  4L9E A;  2FH5 A;  2J80 A;  2NUT C;  3FPW A;  3H82 B;  4HP4 A;  4UQI S;  1OTD A;  4BBU A;  3H82 A;  3LID A;  4HOI A;  3MXQ A;  4EUV A;  5FL3 A;  4BMW A;  2JN7 A;  1N9N A;  1S66 L;  4HHD A;  3UB7 A;  3A0V A;  3T50 A;  4EET B;  3IS2 B;  5DJT A;  3CIT A;  3B47 A;  4NXG A;  2Y79 A;  4NXB A;  3IS2 A;  3CLO A;  2Y8H A;  2IA2 A;  4BBV A;  4I38 A;  1P97 A;  3BQA A;  1X0O A;  5I5L A;  2VGL M;  2ZOI A;  5DF9 A;  3ICY A;  3OCN A;  1H8M A;  4MN7 A;  2GZA A;  3PHY A;  5TJJ A;  2W3E A;  2QJ5 A;  2R78 A;  3H9W A;  1N9O A;  2KLI A;  3RH8 B;  2J3T D;  2L4R A;  2VLG A;  3LIE A;  3PBT A;  4GS9 B;  2O0Y A;  2JKR M;  1W63 M;  3NOT C;  5HD3 A;  5HSQ A;  5TBM B;  4L9G A;  4GS9 A;  4IHQ A;  3LR3 A;  3KSF A;  3C30 A;  4CLC C;  3EQV A;  5G4Y A;  1OTB A;  3S7P A;  2BAS A;  5IS1 A;  1IFQ A;  5TBM A;  1LT0 A;  3EGD C;  1OTE A;  2XA7 M;  1UWN X;  4Q0I A;  2W3H A;  3E4O A;  2XRO A;  2WKR A;  2LB5 A;  2Z6D A;  3E4P A;  3UB9 A;  1P9R A;  5HPF A;  3K2N A;  2PD8 A;  3S7O A;  4AFI A;  1YSP A;  3E0Y A;  1T18 A;  1F9I A;  5IT5 A;  2VEA A;  2VJW A;  5DFY A;  3B42 A;  4UEY A;  2YKH A;  2VV7 A;  2OAQ 1;  4HQA A;  5HZH A;  5J4E A;  4WF0 A;  4WL9 A;  3LYX A;  1OPX A;  1DP6 A;  4MCW A;  1DP9 A;  4MMN A;  2DMW A;  2EWW A;  5L8M A;  2QKP A;  3IBR A;  3FG8 A;  5K5B A;  2W3G A;  1OT6 A;  1DP8 A;  4BJP A;  4EEP A;  4IUK A;  4DJ2 A;  3UE3 A;  3BY9 A;  3BW6 A;  4IJG A;  5AJG A;  1STZ A;  3W2Z A;  3OCL A;  4NEE D;  4HH3 A;  1XFQ A;  1OTI A;  5HWW A;  2INW A;  4UQI M;  3PYP A;  3NJA A;  4IUH A;  4Q0J A;  3LIB A;  3SW1 A;  5F6A A;  3UB6 A;  3A0R A;  2W3F A;  3EEH A;  4HH2 A;  5J7E A;  5KIZ A;  3G6O A;  5MC7 A;  3JVU A;  2V0U A;  3OOV A;  3ZYT A;  2O9C A;  3E4Q A;  3K3D A;  4EU0 A;  3A0S A;  3LUQ A;  2EWV A;  4PKY G;  1YKD A;  3OLO A;  4ETX A;  4O8G A;  1WA9 A;  4BBT A;  2I9V A;  3GEC A;  3CUE C;  4M4X A;  1T1C A;  5HL6 A;  4LLO B;  3V67 A;  1W63 Q;  2K31 A;  4GHI A;  2OWH A;  3T4T A;  4EXO A;  3OBF A;  3TRC A;  4GW9 A;  1V9Y A;  3R7W B;  5F68 A;  3R7W A;  2PHY A;  2HGV A;  3HCY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...