3SW1A

Structure of a full-length bacterial lov protein
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
134
structure length
134
Chain Sequence
MINAQLLQSMVDASNDGIVVAEKEGDDTILIYVNAAFEYLTGYSRDEILYQDCRFLQGDDRDQLGRARIRKAMAEGRPCREVLRNYRKDGSAFWNELSITPVKSDFDQRTYFIGIQKDVSRQVELERELAELRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Sensory box protein
publication title Structural Basis for the Slow Dark Recovery of a Full-Length LOV Protein from Pseudomonas putida.
pubmed doi rcsb
source organism Pseudomonas putida
total genus 41
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3sw1A00
1N9NA 2V0WA 1T19A 5G4YA 3LUQA 4K08A 4BBUA 4F3LB 3LI8A 1DRMA 3LIBA 3NHQA 5HWVA 2L1MA 4EW7A 4GS9A 1LT0A 1S66L 4H6JA 2CMNA 4XT2A 2WKPA 5G4ZA 4I5SA 1S4SA 1S1YA 3UMDA 2PR6A 4HI4A 1MZUA 3IS2B 1OTBA 4DJ3A 1XJ2A 4BBTA 3A0RA 1T1BA 2QKPA 3PHYA 2ZOHA 3A0VA 5DKKA 4WUJA 2W27A 2YKFA 4E04A 4MN5A 1UGUA 2OWHA 3EEHA 1LSXA 5DJTA 4I3AA 3F1NA 2OOLA 3BY8A 4JGQA 3LIFA 4KUKA 3VE3A 1XJ4A 3BWLA 5AVFA 3NOUC 4L9GA 4GCZA 2L0WA 4M4XA 2BASA 2V1AA 1EW0A 4NXGA 4NXFA 2L4RA 5HDSA 1OJ5A 3A0SA 4EESA 4XT2B 3SW1A 3PYPA 3UB9A 2V0UA 3MQQA 2ZOIA 5EFWA 3LIAA 4DJ2A 2H28A 2JHEA 3RTYA 1D06A 3F1PB 2PDRA 1OT6A 2KDKA 4LRZE 5HD3A 1DP8A 1VB6A 2VV6A 1ODVA 4B9OA 3F1OB 3H82A 4HH3A 2WKQA 4HIAA 1G28A 1TS6A 3K3CA 2D02A 3UMEA 5F6AA 4GW9A 5TBMB 4EEUA 1OTEA 4GHIA 3LYXA 3NOTC 3ZQ5A 4BBVA 4EERA 2PR5A 3LI9A 3OLOA 1GSWA 3P7NA 1XJ6A 4R6LA 2M1CA 4EQ1A 1P97A 2PD7A 2INWA 4LLOB 2VV8A 4HP9A 1P0ZA 1V9ZA 4NXBA 2YKHA 4WN5A 2QJ7A 3NOPC 1S67L 3ULFA 1GSXA 3H7WA 1LSWA 3C2WA 1NWZA 1XFQA 2V9AA 2Z6DA 4YWZA 3VE4A 3UB7A 2QHKA 1F98A 4HNBA 2VLGA 3GDIA 3ICYA 4GS9B 3T50A 1T1CA 2HV1A 2GJ3A 2A24A 3E4OA 4H6JB 3C8CA 1DP9A 1X0OA 5J4EA 4KUOA 4LPZA 3UE6A 4F3LA 1BYWA 1TS0A 4RQ9A 3UB8A 4R3AA 4WL9A 3H9WA 5KIZA 5J7EA 4HHDA 5HWTA 2D01A 3KX0X 4KQDA 3VOLA 4HJ6A 1WA9A 4HJ3A 1T18A 4PKYG 3F1NB 1LSVA 3G6OA 4L9FA 5HSQA 4HH2A 1DP6A 1N9LA 5AVEA 3IS2A 3D72A 3E4QA 1OTIA 1OTAA 4WLAA 2VEAA 5J3WA 1TS7A 1S4RA 3MFXA 5DKLA 1OT9A 4EEPA 2Z6CA 1T1AA 3FC7A 3UB6A 2PYPA 4LRYC 4MN6A 1JNUA 4R70A 4EETB 3LIDA 3GECA 2V1BA 1Y28A 4HQAA 5HZHA 3MR0A 2J80A 2JN7A 1KOUA 3E4PA 2W0NA 4NXEA 1OTDA 2OWJA 5DJUA 4I3JA 3RH8B 1OJGA 3H82B 3MQOA 3LICA 2EA9A 2QJ5A 2I9VA 5HDDA 3HJKA 4JGPA 3CWFA 2PYRA 4HY8A 5HD5A 1S1ZA 2KX6A 1XJ3A 3F1PA 4HJ4A 5I5LA 4GHIB 1XFNA 3F1OA 4R38A 3EWKA 2B02A 2R78A 1UWPX 2PHYA 3NJAA 5IU1A 3HJIA 2P7JA 5TBMA 2ZBBA 1GSVA 5F69A 3B33A 5A8BA 5F5YA 3MXQA 2VV7A 2PD8A 4PKYA 3CAXA 5IS1A 1LL8A 4LRXC 2WKRA 4L9EA 5HWWA 4EXOA 1N9OA 5F68A 3H7WB 2K7SA 4I38A 2QWSA 1F9IA 1UWNX 1V9YA 5HDCA 3K3DA 3CLOA 3IBRA 3LIEA 3BY9A 3FG8A 4JGRA 4JGOA 4WF0A 1D7EA 1TS8A 4HOIA 4I39A 4HP4A 4I3IA 2A24B 3MJQA
chains in the Genus database with same CATH superfamily
1N9NA 2Q9MA 5G4YA 3LUQA 4DE1A 4X69A 2W1RA 1SKOA 2IWDA 3IH8A 3LI8A 1XPBA 2A2LA 1I2WA 3BFCA 2L1MA 4EW7A 3KO6A 2WYXA 2H5SA 4MBFA 1KDSA 4KZAA 4XT2A 2WKPA 4BL2A 2PU4A 5HAPA 4ZJ3A 2XDMA 1ONGA 3V3RA 5TR7A 2JKRM 4GLQA 3UB5P 1L0FA 4Y7PA 3C7UA 1XJ2A 4Y0OA 5FEFA 3PHYA 4WZ5A 4ZDXA 5FI6A 1FILA 4BMWA 4WUJA 2J8YA 3VOYA 4DKIA 4KZ5A 1JTDA 1UGUA 2HJ9C 3F1NA 3OPHA 4A5RA 1S6RA 2E8IA 3LIFA 4OPYA 3OC2A 1LL9A 1XJ4A 3SH8A 3BWLA 3NOUC 5EECA 1F2KA 1CK3A 4GCZA 2L0WA 4OOMA 3VP1A 4O0PA 3MXRA 4NXGA 2HP6A 3BJNA 3NDGA 5F82A 4S2PA 2C6WB 3N8LA 3A3DA 3C7VA 5EFWA 4QWOA 3S7QA 2Y2NA 4BQMA 4KG2A 3OBFA 3RTYA 1DY6A 5CECA 2KDKA 4LRZE 4N1HA 1L2SA 1VM1A 4B9OA 1CJFA 3F1OB 3H82A 3CMZA 1E3UA 3G34A 4HIAA 4XUXA 4LV0A 2D02A 3N6IA 4EBLA 1P9WA 4O01A 3OPRA 4EEUA 3MF0A 4B88A 4X1MA 3T4QA 1MC0A 4ID4A 1G68A 3HLBA 4KG5A 4KZ9A 3ZQ5A 4S2KA 4MMNA 1HZOA 2ZQDA 1H5XA 3MZDA 3Q82A 3B42A 1YMXA 1S0WA 3LI9A 3ZG7B 3P7NA 1E25A 4RVAA 2M1CA 1IYSA 4CLCE 4LGWA 4Q8IA 2XRNA 4OQ0A 4GD8A 2VV8A 2QPNA 4QJGA 1PWGA 1P0ZA 1CI8A 2BTFP 3N7WA 2YKHA 5L07A 4CJNA 3S7PA 3ULFA 3TOIA 2OAQ1 3IXGA 5FQ9A 2ZL1B 4IBRA 2HZ5A 5DVAA 3A3JA 1K4FA 1HD8A 5HPIA 1NWZA 4K91A 3MBZA 1FCMA 4OLGA 4UAAA 5DF7A 3IXDA 1IYPA 4HNBA 3HL9A 4R4RA 2VLGA 3ICYA 3VMAA 4GS9B 4MLLA 5FI7A 1C3BA 5FAPA 2IWCA 3MSHA 5AQ7A 3C8CA 1WYBA 1IKIA 5J4EA 4LPZA 2EXBA 4JLFA 3TW8A 2HP5A 2B5RA 3RXXA 1BYWA 5FA7A 4RQ9A 2PBYA 4WL9A 3H9WA 2XROA 1FR6A 1IEMA 2Y2JA 3Q7VA 1DJBA 1RGYA 3V50A 4OQGA 2EWWA 4KQDA 3VOLA 4JXVA 3B3XA 1BLSA 3Q1FA 5EVIA 1T18A 5HSQA 4O8GA 1ESUA 1G6OA 4KG6A 1XGJA 3IS2A 3E4QA 2Y2LA 4WBGA 4Z9QA 3S7NA 1K0KA 1YLJA 2DRWA 3PBSA 4MEZA 1TS7A 2H0YA 4P85A 3UO9A 2VX8A 2HDSA 3DTKA 1OT9A 1T1AA 4BWIA 1YLWA 4WMCD 4N1XA 3PAEA 3ITBA 1L0EA 4E6XA 4R70A 3WRZA 3V39A 5AQ9A 1KGGA 1PZPA 2V1BA 3T4JA 3EQVA 2M7VA 3BQAA 4ZBEA 1YQSA 2W0NA 4NXEA 2OWJA 3Q7ZA 4I3JA 1OJGA 5FEGA 5KMWA 3MQOA 5FL3A 2EFXA 5HDDA 2HDUA 3HJKA 3N8SA 1ALQA 4FH4A 2HJEA 3QP1A 3M6HA 3CWFA 5HD5A 1NZUA 4IVKA 1ZG6A 3CPTB 2KX6A 1MKIA 4OONA 5I5LA 1XA1A 4DDSA 2Y2GA 1J9MA 3E0YA 3HLCA 4OP8A 2FH5A 1XFNA 1K57A 4N92A 2XD5A 4EBPA 1IOUA 4E3KA 5I94A 4ARZB 3HBRA 3LY3A 1UWPX 2CC1A 5IU1A 3HJIA 4ZJ2A 3S1YA 4L0LA 1K4EA 3BFGA 3M6BA 5F5YA 2J9PA 3OOVA 4MBKA 3MFDA 1FQGA 2WGIA 2VV7A 1PNEA 3CAXA 3N8RA 2PAVP 5HPFA 1K55C 3HUOA 3PXPA 4LRXC 2WKRA 4CLCC 4U0TA 3P98A 1KVLA 3BLSA 3FPVA 2K7SA 3HLEA 5FAQA 1F9IA 4X1LA 4YOFA 4QU3A 1FCOA 3LO7A 3IBRA 2JE5A 2O9CA 4YFMA 4DN0A 2GNXA 3PBTA 3MS6A 2WZXA 4I3IA 4R23A 4Y2FA 1E3UD 1YLPA 2V0WA 3GRJA 4ME4A 2ZMAA 5GL9A 4OQHA 4E6WA 1YPRA 3O87A 3UE1A 3JYIA 1M6KA 5M19A 3CHWP 3MMHA 1LT0A 5TJJA 3GQZA 1JWPA 2C5WB 2CMNA 3T4KA 4EU0A 1AXBA 1S1YA 1YLYA 2VGJA 3UMDA 1KDWA 2B18A 2PRFA 3PBRA 3EOIA 3QHYA 5CEBA 1ZKJA 5GLAA 3A0RA 2Y79A 1T1BA 4BENA 3FKWA 1MKMA 1G6AA 2ZOHA 3A0VA 3ITAA 5DKKA 4EUZA 1L3LA 2XLNA 4E04A 4E3OA 3WS2A 5HFOA 4BD0A 3EEHA 4I3AA 2Y8HA 2WADA 2OOLA 4B4ZA 3BY8A 4DRTA 5AJGA 2M7UA 5HX9A 4L9GA 2OSUA 3KYZA 4PAUA 1JTGA 1YAXA 1Q2PA 1EW0A 4QY6A 1ZC2A 2LB5A 2L4RA 2G2WA 2JKFA 5HDSA 3KSIA 1NLYA 4EESA 4XT2B 4PHTA 3PYPA 2ZD8A 3SOIA 1JWVA 2Y2MA 1IELA 3E2LA 3QP6A 3MQQA 3E98A 2BG1A 3SZTA 3IF6A 3LIAA 3T1QB 2DCFA 1VEUB 5AQBA 4PM7A 4Y5FA 2JHEA 3PR6A 1NZOA 1D06A 2KLIA 1KGFA 4P6BA 1SDNA 2FFYA 5G18A 1W79A 2AVXA 1D1JA 4YNRA 5JYOA 5HD3A 2ZQ8A 1ODVA 4JF6A 4X55A 3PBOA 4HH3A 2K31A 3TSGA 3ZGAB 3GVBA 3K3CA 1PI4A 3GSGA 2O9BA 2VK3A 2XH9A 5FQQA 3NIAA 5IT5A 5MC7A 1ERQA 4GW9A 4P87A 3VFHA 1FOFA 4LV3A 1PYYA 1H8YA 1OTEA 1SDEA 1RGZA 3BLMA 1NLZA 5GLBA 5AQAA 4GD6A 1P9RA 4M3KA 1SHVA 1MY8A 2Q0OA 2PR5A 4S2NC 1XXMA 4N9KA 2IA2A 3QP8A 1BLCA 2JKTI 3O86A 4R6LA 1P97A 2WGWB 2INWA 3IH9A 1PWDA 2A3UA 4CLCB 3ZNTA 1Z09A 4NXBA 4ZTKA 3R4KA 1S67L 4WELA 1K25A 5CGWA 1L0DA 3ZG8B 5CGSA 4UHUA 1LSWA 3GV9A 1AWIA 3DW0A 3L7HA 1XFQA 1NRJA 4O7DA 3JVUA 3WS4A 1W8YA 4IJGA 4YWZA 2RL3A 3LR4A 3UB7A 3DWKA 4UA7A 1Y4OA 1VETB 4X25A 1CI9A 3BYDA 1KGEA 3T50A 3A3IA 4RYEA 2JC7A 2V2FF 2JBFA 1K54A 1MPLA 4H6JB 4KZ8A 4MNRA 3V67A 3IWQA 1X0OA 4RX2A 4OVDA 5M18A 5DTTA 4NEED 5A92A 2X01A 1GA9A 4C6YA 1W7FA 4KQRA 3KSGA 4R3AA 4QD4A 4ZRRA 3UY6A 1KE3A 1MWTA 3OPPA 2D01A 3KX0X 3LR5A 4HJ6A 3U2AA 3BFDA 4YINA 3CUEA 1LSVA 4L9FA 1J3WA 2HF6A 2DMWA 1DP6A 3RJUA 1N9LA 5DF9A 5AVEA 4LV1A 5J3WA 5FQMA 2W1TB 1I5QA 2HDQA 1S4RA 2VGLS 1TD5A 4R3BA 1PZOA 2PYPA 4MN6A 1I2SA 1JNUA 3NULA 3SS3A 3ZFZA 1VHMA 2MJ6A 2QZ6A 3MR0A 4DXCA 4MBHA 4Y0TA 1WYCA 3G32A 3RH8B 3T4OA 4HEFA 3CZDA 4OQIA 3BECA 4DMZA 2WZZA 4JGPA 3T4SA 5GHYA 2JKGA 1LHYA 4HY8A 1XA7A 3Q07A 4FCFA 4D2OA 1K56A 4WYYA 5CHUA 1S1ZA 3T4TA 2ZMVA 2HP9A 4FSFA 3P01A 2X71A 4GHIB 2OAP1 3ZNYA 4GZBA 1NXYA 4JBFA 2Y55A 3W4PA 1Y54A 1IYOA 4JPMA 3F1OA 3IWIA 3G31A 2KOIA 3EWKA 2B02A 3NJAA 4NG2A 4B4XA 3BFFA 3T1XA 3I7JA 3R7WB 3ZDJA 3HLDA 5A93A 5A8BA 2J3TC 3GMWA 3TG9A 2PD8A 4S2JA 1BTLA 3UN7A 2EX8A 3PAGA 5IS1A 1LL8A 4DDYA 5CTMA 1N9OA 1TVFA 3H7WB 1IFQA 2FFFB 3WWXA 1PRQA 2WKEA 2QWSA 2LB9A 3HUNA 1K6RA 1VQQA 3NBLA 1V9YA 3RFBA 4OKPA 3CLOA 3DAVA 4JKTA 3LIEA 3FG8A 4NETA 1D7EA 1TS8A 4HOIA 1PW1A 4I39A 4HP4A 2A24B 2ZL1A 2ZC4B 3PBQA 1ESIA 5CHJA 5TGFA 1O07A 3S22A 2WUQA 3K2NA 2VJWA 4FD8A 2PBDP 4F3LB 1DRMA 3NHQA 1CEGA 2XF3A 2P9VB 2ZQ7A 4GS9A 4UEYA 4R4SA 1S66L 3IHBA 1DJCA 4WZ5C 5L10A 1YMSA 4MCWA 1S4SA 1KE4A 4QY5A 2PR6A 3DBAA 4N9LA 3C38A 3VFFA 3VOZA 4ZJ1A 2VZWA 2QMIA 4OPRA 2QKPA 3ZYTA 2R9WA 4BLMA 1M40A 4EBNA 2ZQ9A 4WEKA 4UA9A 2XD1A 2W27A 3BW6A 4MN5A 2OLVA 2OWHA 1LSXA 4QHCA 5EE8A 4KUKA 3MQ0A 2ZJ9A 3VE3A 1IKGA 1TDLA 1BSGA 5FDSA 3T1RA 2V1AA 2Q9NA 4Y15A 3G2ZA 3A0SA 5GHXA 2EX6A 2ZM2A 3IX3A 1HTZA 2G7UA 2J9OA 2WKHA 3C4PA 1FCNA 5HAIA 1LLBA 3QNCA 1OPXA 2H28A 2A49A 4S2LA 5HL1A 2I72A 3F1PB 3P09A 4RA7A 2PDRA 1OT6A 1RCJA 2Y2QA 4RX3A 4C75A 4JXSA 2G2UA 1DP8A 1TDGA 2VV6A 3BQ8A 4EUVA 4FUWA 4G3WA 3W4OA 4E3MA 2Y59A 4NKPA 5F6AA 5TBMB 1BUEA 3CPTA 3T4LA 4PM9A 1FSWA 1YT4A 1ONHA 5KSCA 3LYXA 1KE0A 4CLCD 4PM5A 1SZVA 4WEJA 3HUMA 5A91A 4Y3IA 3S4XA 3EEAA 3HLWA 4KZ6A 3T1SA 4CPKA 3OLOA 4HBTA 4OOLA 5U47A 4ARZA 1GSWA 5CTNA 1XJ6A 5DFXA 3G35A 1NRFA 3LY4A 4WZ4A 4E3IA 4GKUA 4LLOB 4KQQA 2ZMFA 1Z6FA 4ETZA 4JXGA 3IT9A 3TE8A 1V9ZA 3IX8A 4Z1WA 1BLHA 2OV5A 4GB7A 1GSXA 4U3TA 4LFUA 5E2EA 4G3KA 1L0GA 3IWOA 3C2WA 4CQHA 1XX2A 4P6ZS 2GZAA 2NUTC 3HREA 3IXHA 1FIKA 1K56D 1SKOB 2IWBA 5DTKA 1MWSA 2QHKA 1RP5A 1KVMA 1F98A 4P6ZM 1K6SA 3NC8A 3NY4A 2V8CA 1T1CA 2HV1A 1YM1A 4OLDA 3E4OA 4OP5A 1ES2A 1GA0A 4R3JA 3EQUA 3BRMA 1PI5A 1XKZA 4KUOA 3UDIA 4F94A 3DWZA 3MKEA 3MZFA 5FAOA 3PTEA 5EVIC 3UE6A 1ACFA 4HESA 1TS0A 5GLDA 1W8QA 5J7EA 3ZG0A 3W4QA 3C5AA 3VSKA 1WA9A 4HJ3A 3UPOA 3A3FA 3F1NB 3G6OA 2OLUA 5CHMA 3MXSA 4HH2A 1PW8A 3ISGA 3O5YA 2NUPC 5HARA 3PBNA 5D3OA 2VEAA 3AGDA 2Z2MB 1LI0A 1YLTA 4KZ4A 5LBRA 4EWFA 3MFXA 5CGXA 5EOEA 3NCKA 2ZC7A 3UDXA 3UB6A 2HPBA 4KZ7A 4LRYC 2JKTM 1GHIA 4EETB 3LIDA 3CJMA 3G2YA 4HQAA 3SS4A 5HZHA 3SH9A 2JN7A 1BULA 2Y2PA 1KOUA 3E4PA 1E4DA 5FQKA 4Y17A 5EM1A 3D3OA 5GHZA 3ZG9B 4GNUA 3H82B 3ZCZA 3V5MA 2EXAA 3LICA 2XFTA 3OZHA 2FZ0A 3UPPA 1ZTUA 1ERMA 1K57C 3FWLA 1VEUA 3KSFA 1XJ3A 4D60A 4OPZA 4FH2A 1PWCA 2JKRI 2ACGA 1QMEA 5EV0A 1H8MA 4JXWA 5IHVA 4X6TA 4PM6A 3NDEA 2PU2A 3S7OA 3C4OA 4R38A 4UQIS 2PHYA 4QPRA 3JVVA 5CRFA 2ZBBA 1BLPA 1SCWA 3IX4A 3TRCA 4UQIM 2H10A 1F5MA 5GLCA 5HW3A 3IQAA 3MXQA 3NI9A 5FQIA 1FSYA 4PKYA 4H8RA 3LEZA 1G5UA 4HBUA 2WAEA 5HWWA 1TF1A 3SS5A 4EXOA 3FV7A 3QNBA 5DFYA 4XUZA 5JYPA 2W3HA 5F68A 1W63Q 3HCYA 5EPHA 4GN2A 4X68A 2WGWA 1NYYA 1K55A 4CLCA 3BY9A 5TFQA 2Y2OA 4Q0IA 2ZC5B 4JGOA 3O88A 2J3WA 2E8JA 2X02A 5L2FA 5E43A 3MJQA 3FYZA 3LR3A 3MKFA 4WM9A 5E2FA 1T19A 4LCLA 1IYQA 2V20A 3OCLA 2VGLM 2ZQAA 4NK3A 3QP4A 2Z2LB 4K08A 3VP4A 4BBUA 3LIBA 5HWVA 1VETA 2Y4AA 3DTMA 3IHAA 1BZAA 3VP2A 2O0YA 3Q7VB 4OPQA 4E3LA 3UNWA 4H6JA 3CI6A 2P04A 1NY0A 4Y0UA 5EVIB 1OMEA 3V3SA 5G4ZA 1MBLA 4I5SA 2WAFA 3ZHHA 3BFEA 4GJ4A 1H8ZA 4HI4A 3OCNA 1MZUA 3IS2B 5C5KA 1OTBA 4DJ3A 1BT5A 5HAQA 4BBTA 4X53A 4EQIA 4K0WA 3DTEA 3GR2A 4LV2A 2YKFA 2V8FA 3FKVA 1QMFA 4GDNA 2XQZA 3FPWA 1GHPA 5EUAA 5DJTA 2Y2HA 3Q81A 4JGQA 2Y2KA 4IHQA 3BEBA 5K5BA 3HLGA 1HLUP 5AVFA 1EWZA 3IBJA 3CG5A 1O7EA 3IF6C 2BASA 4M4XA 4R0QA 4ESPA 3QP2A 2W1TA 4NXFA 1JWZA 1N9BA 1OJ5A 3TJZC 3BM6A 3SH7A 3LFVA 4ZAMA 2K2NA 5FDHA 3SW1A 3UB9A 3MZEA 5FQJA 5BOHA 1XGIA 2V0UA 1GCEA 1LI9A 2EX2A 3FZCA 3CITA 2ZOIA 2WGVA 4DJ2A 1NJ4A 2B95A 3IXBA 5E2GA 3WS1A 4Y13A 3DTIA 2W3DA 4E3NA 2HDRA 4BD1A 3RXWA 2W3GA 3HVFA 1VB6A 2XGNA 3UPNA 2EFUA 2WKQA 4LENA 1CF0A 2VA0A 1G28A 1TS6A 3WRTA 4Q0HA 1YSPA 3UMEA 4G3VA 3IF5A 2J3TD 2XFSA 1WE4A 3M2KA 4EV4A 5CEDA 4GHIA 4IVIA 3NOTC 3AGEA 1A0KA 1MXOA 4KZBA 1W63M 5EM0A 2R9XA 4BBVA 4GDBA 4EERA 3KYEA 4X56A 3D4FA 4PMAA 2V1ZA 4BJPA 4IUKA 3LCEA 3UE3A 4E3JA 1W5DA 4EQ1A 2ZC6B 3R7WA 2PD7A 4JF4A 4HP9A 4ETXA 3WS5A 4S2NA 4DXBA 3N4IA 4WN5A 2QJ7A 4U0XA 3NOPC 3LEQA 2QYBA 4IEDA 4JF5A 4DF6A 4B93A 3H7WA 3JPUA 1NYMA 1K54C 3U4LP 1ZG4A 2V9AA 2Z6DA 1CEFA 3VE4A 3LR0A 2XEPA 4FTXA 3GDIA 3KYQA 3OPLA 5FI2A 2GJ3A 1YLZA 5J8XA 2A24A 1XP4A 1PFLA 3O3VA 3UE0A 1DP9A 2UV0E 3ZG5A 4S2OA 4P0MA 3B47A 4II7A 2O9AA 2XA7S 4KQOA 2J7VA 2EWVA 5HL6A 5FASA 1SKFA 3CUEC 4F3LA 4OH0A 3UB8A 4R1GA 3W8KA 4S2IA 3ZVTA 2GDNA 2Y2IA 2XA7M 5KIZA 2P9VA 1CQAA 4HHDA 5HWTA 4XXRA 3L9KA 4PM8A 3D9YA 5EOOA 5F1GA 4PKYG 3KSHA 5EVID 5EVLA 3A3EA 4PPRA 1H3QA 2WKIA 4KENB 1STZA 2EX9A 4K0XA 3VP3A 3D72A 1YSQA 1OTIA 1OTAA 4WLAA 2XR0A 1K38A 4QB8A 5CERA 2ZM0A 2HGVA 4GOGA 3C30A 5E2HA 3E2KA 2W3FA 3M2JA 5DKLA 4MN7A 4EEPA 2Z6CA 3FC7A 1N4OA 2XK1A 4Q0JA 2XSSA 2UWXA 5KZHA 3IF6B 2O99A 3GECA 3QP5A 2GX5A 5FSRA 1Y28A 5DF8A 5F83A 3VSLA 2J80A 3AGFA 2ZC3B 1OTDA 5DJUA 5KSHA 5A90A 5CXWA 2WK0A 4DE2A 2EA9A 1MWUA 2QJ5A 2I9VA 1Q2QA 5DTSA 1TEMA 2Y91A 2PYRA 2W3EA 3W2ZA 2P74A 2H0TA 3F1PA 4HJ4A 4C3QA 5CX7A 2ZLYA 3LGOA 4MDZA 5EVEA 1JVJA 3T12B 1GHMA 2DNSA 4OOYA 3EGXC 3ZVWA 4S2MA 3VV4A 4AFIA 2R78A 5L09A 2P7JA 5F1FA 2BLSA 2VKSA 5TBMA 4FOFA 1GSVA 1ZHHB 2VGKA 5F69A 3B33A 3NECA 4DE3A 3UDFA 3WS0A 1EI5A 3EGDC 2PT7A 1U60A 4LCMA 5M1AA 4L9EA 4IBXA 1YKDA 3VP0A 1LL5A 1EROA 1ES3A 2ZQCA 3G4PA 3G30A 3GTCA 4I38A 1DJAA 1UWNX 1H0MA 4KZ3A 5HDCA 3K3DA 4DE0A 1ES5A 2JCHA 4UA6A 1PIOA 5L8MA 5FATA 4JGRA 1HVBA 4WF0A 1ES4A 1FR1A 4WMCA 2RCXA 1MWRA 4IUHA 4BL3A 2ZM8A 2P08A 3HLFA
chains in the Genus database with same CATH topology
3LR3A 3PBQA 1N9NA 2V0WA 1T19A 4ME4A 5G4YA 3OCLA 3LUQA 2W1RA 2VGLM 3K2NA 2VJWA 4K08A 4BBUA 4F3LB 3LI8A 2A2LA 1DRMA 3LIBA 3NHQA 5HWVA 2L1MA 4EW7A 3KO6A 2O0YA 4GS9A 4UEYA 3MMHA 1LT0A 5TJJA 1S66L 4H6JA 3CI6A 2P04A 2CMNA 3T4KA 4XT2A 2WKPA 5G4ZA 4I5SA 4MCWA 1S4SA 4EU0A 1S1YA 4GJ4A 3UMDA 2B18A 2PR6A 3DBAA 4HI4A 3PBRA 3EOIA 3OCNA 3C38A 1MZUA 3IS2B 2JKRM 4GLQA 5C5KA 1OTBA 4DJ3A 1XJ2A 4BBTA 2VZWA 3A0RA 2Y79A 1T1BA 2QKPA 3ZYTA 3PHYA 1MKMA 2ZOHA 3A0VA 4WEKA 4BMWA 5DKKA 4WUJA 2W27A 2YKFA 4E04A 3BW6A 4MN5A 3FPWA 1UGUA 2OWHA 3EEHA 1LSXA 5DJTA 4I3AA 2Y8HA 2HJ9C 3F1NA 2OOLA 3BY8A 4JGQA 3LIFA 5AJGA 4KUKA 3MQ0A 3VE3A 2M7UA 3OC2A 4IHQA 1XJ4A 5K5BA 3BWLA 5AVFA 3NOUC 4L9GA 3KYZA 4PAUA 3IBJA 4GCZA 1YAXA 2L0WA 4M4XA 2BASA 4OOMA 2V1AA 4O0PA 1EW0A 4NXGA 2W1TA 2LB5A 2L4RA 3BJNA 4NXFA 5HDSA 1OJ5A 3A0SA 3KSIA 1NLYA 3TJZC 4EESA 3LFVA 2K2NA 4XT2B 4PHTA 3SW1A 2G7UA 3PYPA 3UB9A 2V0UA 3CITA 3MQQA 2ZOIA 3E98A 5EFWA 3S7QA 3LIAA 1OPXA 4DJ2A 2H28A 4Y5FA 2JHEA 3PR6A 3OBFA 3RTYA 1D06A 2KLIA 3F1PB 2PDRA 1OT6A 2KDKA 2W3DA 4YNRA 4LRZE 2W3GA 5HD3A 1DP8A 1VB6A 2VV6A 1ODVA 3BQ8A 3PBOA 4B9OA 4EUVA 3F1OB 3H82A 4HH3A 2K31A 2WKQA 4HIAA 4G3WA 2VA0A 1G28A 1TS6A 3K3CA 2D02A 4Q0HA 2O9BA 1P9WA 1YSPA 3UMEA 4NKPA 4O01A 4G3VA 5IT5A 5F6AA 5MC7A 2J3TD 4GW9A 5TBMB 3T4LA 4EEUA 3MF0A 1OTEA 3T4QA 4GHIA 3LYXA 3NOTC 1MC0A 4CLCD 4WEJA 1NLZA 1W63M 3ZQ5A 1P9RA 4MMNA 4Y3IA 4BBVA 3EEAA 4EERA 3B42A 2PR5A 3LI9A 4BJPA 4IUKA 3OLOA 4OOLA 4ARZA 1GSWA 2IA2A 3P7NA 1XJ6A 5DFXA 3UE3A 2JKTI 4R6LA 2M1CA 4CLCE 4EQ1A 1P97A 2XRNA 3R7WA 2PD7A 2INWA 4LLOB 2VV8A 4HP9A 2ZMFA 4ETXA 1P0ZA 4ETZA 4CLCB 3TE8A 1V9ZA 4NXBA 2YKHA 4WN5A 2QJ7A 3R4KA 4Z1WA 3S7PA 3NOPC 1S67L 3ULFA 2QYBA 2OAQ1 4WELA 1GSXA 4B93A 3H7WA 4G3KA 1LSWA 3C2WA 4CQHA 4P6ZS 2GZAA 2NUTC 5HPIA 1NWZA 1XFQA 1NRJA 3JVUA 2V9AA 2Z6DA 4IJGA 4YWZA 3LR4A 3UB7A 3VE4A 3LR0A 2QHKA 1F98A 4P6ZM 4HNBA 2VLGA 3GDIA 3ICYA 4GS9B 3T50A 3KYQA 1T1CA 2HV1A 2GJ3A 2A24A 3E4OA 4H6JB 3C8CA 3V67A 1DP9A 1X0OA 5J4EA 3EQUA 4KUOA 4LPZA 3B47A 4II7A 4NEED 2O9AA 2XA7S 4KQOA 3UE6A 3TW8A 2EWVA 5HL6A 3CUEC 4F3LA 1BYWA 1TS0A 4RQ9A 3KSGA 3UB8A 4R3AA 4WL9A 4ZRRA 3H9WA 2XROA 5KIZA 2XA7M 5J7EA 4HHDA 5HWTA 2D01A 2EWWA 3KX0X 3LR5A 4KQDA 3VOLA 4HJ6A 3U2AA 1WA9A 4HJ3A 1T18A 4PKYG 3KSHA 3F1NB 3CUEA 1LSVA 3G6OA 4L9FA 2HF6A 5HSQA 1H3QA 2DMWA 4O8GA 4HH2A 1DP6A 1G6OA 1N9LA 5DF9A 5AVEA 3O5YA 1STZA 3IS2A 2NUPC 3D72A 1YSQA 3E4QA 1OTIA 1OTAA 3PBNA 4WLAA 2VEAA 5J3WA 3S7NA 2W1TB 3PBSA 2HGVA 1TS7A 3C30A 5LBRA 1S4RA 2VGLS 3MFXA 1TD5A 2W3FA 2VX8A 5DKLA 4MN7A 1OT9A 4EEPA 2Z6CA 1T1AA 3FC7A 4BWIA 3UB6A 2PYPA 4LRYC 4MN6A 2JKTM 2XSSA 1JNUA 4Q0JA 4R70A 4EETB 3LIDA 2O99A 3GECA 2V1BA 2GX5A 3T4JA 1VHMA 1Y28A 4HQAA 2MJ6A 3EQVA 2M7VA 5HZHA 3BQAA 3MR0A 2J80A 2JN7A 1KOUA 3E4PA 2W0NA 4NXEA 1OTDA 2OWJA 5DJUA 5KSHA 4I3JA 3RH8B 3T4OA 1OJGA 3D3OA 3H82B 3MQOA 5FL3A 3LICA 4DMZA 2EA9A 2QJ5A 2I9VA 5HDDA 2FZ0A 3HJKA 4JGPA 3T4SA 2HJEA 1ZTUA 3CWFA 2PYRA 4HY8A 5HD5A 2W3EA 1S1ZA 3W2ZA 3T4TA 3KSFA 2KX6A 2ZMVA 1XJ3A 3F1PA 4FSFA 4HJ4A 3P01A 5CX7A 5I5LA 4GHIB 2JKRI 2OAP1 4MDZA 1H8MA 3E0YA 2FH5A 1XFNA 3EGXC 3S7OA 3F1OA 1IOUA 4R38A 4UQIS 2KOIA 3EWKA 3VV4A 4AFIA 2B02A 4ARZB 2R78A 1UWPX 2PHYA 4QPRA 3NJAA 3JVVA 5IU1A 3HJIA 2P7JA 2VKSA 5TBMA 2ZBBA 4L0LA 4FOFA 1GSVA 1ZHHB 3TRCA 4UQIM 3R7WB 5F69A 1F5MA 3B33A 5A8BA 5F5YA 2J3TC 3OOVA 3MXQA 2VV7A 2PD8A 4PKYA 3EGDC 2PT7A 3CAXA 5IS1A 5HPFA 1LL8A 3PXPA 4LRXC 2WKRA 4CLCC 4L9EA 1YKDA 5HWWA 1TF1A 4EXOA 1N9OA 5DFYA 2W3HA 3H7WB 1W63Q 1IFQA 5F68A 3HCYA 3FPVA 2K7SA 4I38A 2QWSA 1F9IA 1UWNX 2LB9A 1V9YA 5HDCA 4YOFA 3RFBA 3K3DA 3CLOA 4CLCA 3IBRA 3LIEA 3BY9A 5L8MA 2O9CA 3FG8A 4Q0IA 4JGRA 4JGOA 4DN0A 2GNXA 4WF0A 1D7EA 3PBTA 1TS8A 2J3WA 4HOIA 4I39A 4HP4A 4I3IA 2A24B 3MJQA 4IUHA 4Y2FA 2P08A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N9N A;  2V0W A;  1T19 A;  5G4Y A;  3LUQ A;  4K08 A;  4BBU A;  4F3L B;  3LI8 A;  1DRM A;  3LIB A;  3NHQ A;  5HWV A;  2L1M A;  4EW7 A;  4GS9 A;  1LT0 A;  1S66 L;  4H6J A;  2CMN A;  4XT2 A;  2WKP A;  5G4Z A;  4I5S A;  1S4S A;  1S1Y A;  3UMD A;  2PR6 A;  4HI4 A;  1MZU A;  3IS2 B;  1OTB A;  4DJ3 A;  1XJ2 A;  4BBT A;  3A0R A;  1T1B A;  2QKP A;  3PHY A;  2ZOH A;  3A0V A;  5DKK A;  4WUJ A;  2W27 A;  2YKF A;  4E04 A;  4MN5 A;  1UGU A;  2OWH A;  3EEH A;  1LSX A;  5DJT A;  4I3A A;  3F1N A;  2OOL A;  3BY8 A;  4JGQ A;  3LIF A;  4KUK A;  3VE3 A;  1XJ4 A;  3BWL A;  5AVF A;  3NOU C;  4L9G A;  4GCZ A;  2L0W A;  4M4X A;  2BAS A;  2V1A A;  1EW0 A;  4NXG A;  4NXF A;  2L4R A;  5HDS A;  1OJ5 A;  3A0S A;  4EES A;  4XT2 B;  3SW1 A;  3PYP A;  3UB9 A;  2V0U A;  3MQQ A;  2ZOI A;  5EFW A;  3LIA A;  4DJ2 A;  2H28 A;  2JHE A;  3RTY A;  1D06 A;  3F1P B;  2PDR A;  1OT6 A;  2KDK A;  4LRZ E;  5HD3 A;  1DP8 A;  1VB6 A;  2VV6 A;  1ODV A;  4B9O A;  3F1O B;  3H82 A;  4HH3 A;  2WKQ A;  4HIA A;  1G28 A;  1TS6 A;  3K3C A;  2D02 A;  3UME A;  5F6A A;  4GW9 A;  5TBM B;  4EEU A;  1OTE A;  4GHI A;  3LYX A;  3NOT C;  3ZQ5 A;  4BBV A;  4EER A;  2PR5 A;  3LI9 A;  3OLO A;  1GSW A;  3P7N A;  1XJ6 A;  4R6L A;  2M1C A;  4EQ1 A;  1P97 A;  2PD7 A;  2INW A;  4LLO B;  2VV8 A;  4HP9 A;  1P0Z A;  1V9Z A;  4NXB A;  2YKH A;  4WN5 A;  2QJ7 A;  3NOP C;  1S67 L;  3ULF A;  1GSX A;  3H7W A;  1LSW A;  3C2W A;  1NWZ A;  1XFQ A;  2V9A A;  2Z6D A;  4YWZ A;  3VE4 A;  3UB7 A;  2QHK A;  1F98 A;  4HNB A;  2VLG A;  3GDI A;  3ICY A;  4GS9 B;  3T50 A;  1T1C A;  2HV1 A;  2GJ3 A;  2A24 A;  3E4O A;  4H6J B;  3C8C A;  1DP9 A;  1X0O A;  5J4E A;  4KUO A;  4LPZ A;  3UE6 A;  4F3L A;  1BYW A;  1TS0 A;  4RQ9 A;  3UB8 A;  4R3A A;  4WL9 A;  3H9W A;  5KIZ A;  5J7E A;  4HHD A;  5HWT A;  2D01 A;  3KX0 X;  4KQD A;  3VOL A;  4HJ6 A;  1WA9 A;  4HJ3 A;  1T18 A;  4PKY G;  3F1N B;  1LSV A;  3G6O A;  4L9F A;  5HSQ A;  4HH2 A;  1DP6 A;  1N9L A;  5AVE A;  3IS2 A;  3D72 A;  3E4Q A;  1OTI A;  1OTA A;  4WLA A;  2VEA A;  5J3W A;  1TS7 A;  1S4R A;  3MFX A;  5DKL A;  1OT9 A;  4EEP A;  2Z6C A;  1T1A A;  3FC7 A;  3UB6 A;  2PYP A;  4LRY C;  4MN6 A;  1JNU A;  4R70 A;  4EET B;  3LID A;  3GEC A;  2V1B A;  1Y28 A;  4HQA A;  5HZH A;  3MR0 A;  2J80 A;  2JN7 A;  1KOU A;  3E4P A;  2W0N A;  4NXE A;  1OTD A;  2OWJ A;  5DJU A;  4I3J A;  3RH8 B;  1OJG A;  3H82 B;  3MQO A;  3LIC A;  2EA9 A;  2QJ5 A;  2I9V A;  5HDD A;  3HJK A;  4JGP A;  3CWF A;  2PYR A;  4HY8 A;  5HD5 A;  1S1Z A;  2KX6 A;  1XJ3 A;  3F1P A;  4HJ4 A;  5I5L A;  4GHI B;  1XFN A;  3F1O A;  4R38 A;  3EWK A;  2B02 A;  2R78 A;  1UWP X;  2PHY A;  3NJA A;  5IU1 A;  3HJI A;  2P7J A;  5TBM A;  2ZBB A;  1GSV A;  5F69 A;  3B33 A;  5A8B A;  5F5Y A;  3MXQ A;  2VV7 A;  2PD8 A;  4PKY A;  3CAX A;  5IS1 A;  1LL8 A;  4LRX C;  2WKR A;  4L9E A;  5HWW A;  4EXO A;  1N9O A;  5F68 A;  3H7W B;  2K7S A;  4I38 A;  2QWS A;  1F9I A;  1UWN X;  1V9Y A;  5HDC A;  3K3D A;  3CLO A;  3IBR A;  3LIE A;  3BY9 A;  3FG8 A;  4JGR A;  4JGO A;  4WF0 A;  1D7E A;  1TS8 A;  4HOI A;  4I39 A;  4HP4 A;  4I3I A;  2A24 B;  3MJQ A; 
#chains in the Genus database with same CATH topology
 1N9N A;  2Q9M A;  5G4Y A;  3LUQ A;  4DE1 A;  4X69 A;  2W1R A;  1SKO A;  2IWD A;  3IH8 A;  3LI8 A;  1XPB A;  2A2L A;  1I2W A;  3BFC A;  2L1M A;  4EW7 A;  3KO6 A;  2WYX A;  2H5S A;  4MBF A;  1KDS A;  4KZA A;  4XT2 A;  2WKP A;  4BL2 A;  2PU4 A;  5HAP A;  4ZJ3 A;  2XDM A;  1ONG A;  3V3R A;  5TR7 A;  2JKR M;  4GLQ A;  3UB5 P;  1L0F A;  4Y7P A;  3C7U A;  1XJ2 A;  4Y0O A;  5FEF A;  3PHY A;  4WZ5 A;  4ZDX A;  5FI6 A;  1FIL A;  4BMW A;  4WUJ A;  2J8Y A;  3VOY A;  4DKI A;  4KZ5 A;  1JTD A;  1UGU A;  2HJ9 C;  3F1N A;  3OPH A;  4A5R A;  1S6R A;  2E8I A;  3LIF A;  4OPY A;  3OC2 A;  1LL9 A;  1XJ4 A;  3SH8 A;  3BWL A;  3NOU C;  5EEC A;  1F2K A;  1CK3 A;  4GCZ A;  2L0W A;  4OOM A;  3VP1 A;  4O0P A;  3MXR A;  4NXG A;  2HP6 A;  3BJN A;  3NDG A;  5F82 A;  4S2P A;  2C6W B;  3N8L A;  3A3D A;  3C7V A;  5EFW A;  4QWO A;  3S7Q A;  2Y2N A;  4BQM A;  4KG2 A;  3OBF A;  3RTY A;  1DY6 A;  5CEC A;  2KDK A;  4LRZ E;  4N1H A;  1L2S A;  1VM1 A;  4B9O A;  1CJF A;  3F1O B;  3H82 A;  3CMZ A;  1E3U A;  3G34 A;  4HIA A;  4XUX A;  4LV0 A;  2D02 A;  3N6I A;  4EBL A;  1P9W A;  4O01 A;  3OPR A;  4EEU A;  3MF0 A;  4B88 A;  4X1M A;  3T4Q A;  1MC0 A;  4ID4 A;  1G68 A;  3HLB A;  4KG5 A;  4KZ9 A;  3ZQ5 A;  4S2K A;  4MMN A;  1HZO A;  2ZQD A;  1H5X A;  3MZD A;  3Q82 A;  3B42 A;  1YMX A;  1S0W A;  3LI9 A;  3ZG7 B;  3P7N A;  1E25 A;  4RVA A;  2M1C A;  1IYS A;  4CLC E;  4LGW A;  4Q8I A;  2XRN A;  4OQ0 A;  4GD8 A;  2VV8 A;  2QPN A;  4QJG A;  1PWG A;  1P0Z A;  1CI8 A;  2BTF P;  3N7W A;  2YKH A;  5L07 A;  4CJN A;  3S7P A;  3ULF A;  3TOI A;  2OAQ 1;  3IXG A;  5FQ9 A;  2ZL1 B;  4IBR A;  2HZ5 A;  5DVA A;  3A3J A;  1K4F A;  1HD8 A;  5HPI A;  1NWZ A;  4K91 A;  3MBZ A;  1FCM A;  4OLG A;  4UAA A;  5DF7 A;  3IXD A;  1IYP A;  4HNB A;  3HL9 A;  4R4R A;  2VLG A;  3ICY A;  3VMA A;  4GS9 B;  4MLL A;  5FI7 A;  1C3B A;  5FAP A;  2IWC A;  3MSH A;  5AQ7 A;  3C8C A;  1WYB A;  1IKI A;  5J4E A;  4LPZ A;  2EXB A;  4JLF A;  3TW8 A;  2HP5 A;  2B5R A;  3RXX A;  1BYW A;  5FA7 A;  4RQ9 A;  2PBY A;  4WL9 A;  3H9W A;  2XRO A;  1FR6 A;  1IEM A;  2Y2J A;  3Q7V A;  1DJB A;  1RGY A;  3V50 A;  4OQG A;  2EWW A;  4KQD A;  3VOL A;  4JXV A;  3B3X A;  1BLS A;  3Q1F A;  5EVI A;  1T18 A;  5HSQ A;  4O8G A;  1ESU A;  1G6O A;  4KG6 A;  1XGJ A;  3IS2 A;  3E4Q A;  2Y2L A;  4WBG A;  4Z9Q A;  3S7N A;  1K0K A;  1YLJ A;  2DRW A;  3PBS A;  4MEZ A;  1TS7 A;  2H0Y A;  4P85 A;  3UO9 A;  2VX8 A;  2HDS A;  3DTK A;  1OT9 A;  1T1A A;  4BWI A;  1YLW A;  4WMC D;  4N1X A;  3PAE A;  3ITB A;  1L0E A;  4E6X A;  4R70 A;  3WRZ A;  3V39 A;  5AQ9 A;  1KGG A;  1PZP A;  2V1B A;  3T4J A;  3EQV A;  2M7V A;  3BQA A;  4ZBE A;  1YQS A;  2W0N A;  4NXE A;  2OWJ A;  3Q7Z A;  4I3J A;  1OJG A;  5FEG A;  5KMW A;  3MQO A;  5FL3 A;  2EFX A;  5HDD A;  2HDU A;  3HJK A;  3N8S A;  1ALQ A;  4FH4 A;  2HJE A;  3QP1 A;  3M6H A;  3CWF A;  5HD5 A;  1NZU A;  4IVK A;  1ZG6 A;  3CPT B;  2KX6 A;  1MKI A;  4OON A;  5I5L A;  1XA1 A;  4DDS A;  2Y2G A;  1J9M A;  3E0Y A;  3HLC A;  4OP8 A;  2FH5 A;  1XFN A;  1K57 A;  4N92 A;  2XD5 A;  4EBP A;  1IOU A;  4E3K A;  5I94 A;  4ARZ B;  3HBR A;  3LY3 A;  1UWP X;  2CC1 A;  5IU1 A;  3HJI A;  4ZJ2 A;  3S1Y A;  4L0L A;  1K4E A;  3BFG A;  3M6B A;  5F5Y A;  2J9P A;  3OOV A;  4MBK A;  3MFD A;  1FQG A;  2WGI A;  2VV7 A;  1PNE A;  3CAX A;  3N8R A;  2PAV P;  5HPF A;  1K55 C;  3HUO A;  3PXP A;  4LRX C;  2WKR A;  4CLC C;  4U0T A;  3P98 A;  1KVL A;  3BLS A;  3FPV A;  2K7S A;  3HLE A;  5FAQ A;  1F9I A;  4X1L A;  4YOF A;  4QU3 A;  1FCO A;  3LO7 A;  3IBR A;  2JE5 A;  2O9C A;  4YFM A;  4DN0 A;  2GNX A;  3PBT A;  3MS6 A;  2WZX A;  4I3I A;  4R23 A;  4Y2F A;  1E3U D;  1YLP A;  2V0W A;  3GRJ A;  4ME4 A;  2ZMA A;  5GL9 A;  4OQH A;  4E6W A;  1YPR A;  3O87 A;  3UE1 A;  3JYI A;  1M6K A;  5M19 A;  3CHW P;  3MMH A;  1LT0 A;  5TJJ A;  3GQZ A;  1JWP A;  2C5W B;  2CMN A;  3T4K A;  4EU0 A;  1AXB A;  1S1Y A;  1YLY A;  2VGJ A;  3UMD A;  1KDW A;  2B18 A;  2PRF A;  3PBR A;  3EOI A;  3QHY A;  5CEB A;  1ZKJ A;  5GLA A;  3A0R A;  2Y79 A;  1T1B A;  4BEN A;  3FKW A;  1MKM A;  1G6A A;  2ZOH A;  3A0V A;  3ITA A;  5DKK A;  4EUZ A;  1L3L A;  2XLN A;  4E04 A;  4E3O A;  3WS2 A;  5HFO A;  4BD0 A;  3EEH A;  4I3A A;  2Y8H A;  2WAD A;  2OOL A;  4B4Z A;  3BY8 A;  4DRT A;  5AJG A;  2M7U A;  5HX9 A;  4L9G A;  2OSU A;  3KYZ A;  4PAU A;  1JTG A;  1YAX A;  1Q2P A;  1EW0 A;  4QY6 A;  1ZC2 A;  2LB5 A;  2L4R A;  2G2W A;  2JKF A;  5HDS A;  3KSI A;  1NLY A;  4EES A;  4XT2 B;  4PHT A;  3PYP A;  2ZD8 A;  3SOI A;  1JWV A;  2Y2M A;  1IEL A;  3E2L A;  3QP6 A;  3MQQ A;  3E98 A;  2BG1 A;  3SZT A;  3IF6 A;  3LIA A;  3T1Q B;  2DCF A;  1VEU B;  5AQB A;  4PM7 A;  4Y5F A;  2JHE A;  3PR6 A;  1NZO A;  1D06 A;  2KLI A;  1KGF A;  4P6B A;  1SDN A;  2FFY A;  5G18 A;  1W79 A;  2AVX A;  1D1J A;  4YNR A;  5JYO A;  5HD3 A;  2ZQ8 A;  1ODV A;  4JF6 A;  4X55 A;  3PBO A;  4HH3 A;  2K31 A;  3TSG A;  3ZGA B;  3GVB A;  3K3C A;  1PI4 A;  3GSG A;  2O9B A;  2VK3 A;  2XH9 A;  5FQQ A;  3NIA A;  5IT5 A;  5MC7 A;  1ERQ A;  4GW9 A;  4P87 A;  3VFH A;  1FOF A;  4LV3 A;  1PYY A;  1H8Y A;  1OTE A;  1SDE A;  1RGZ A;  3BLM A;  1NLZ A;  5GLB A;  5AQA A;  4GD6 A;  1P9R A;  4M3K A;  1SHV A;  1MY8 A;  2Q0O A;  2PR5 A;  4S2N C;  1XXM A;  4N9K A;  2IA2 A;  3QP8 A;  1BLC A;  2JKT I;  3O86 A;  4R6L A;  1P97 A;  2WGW B;  2INW A;  3IH9 A;  1PWD A;  2A3U A;  4CLC B;  3ZNT A;  1Z09 A;  4NXB A;  4ZTK A;  3R4K A;  1S67 L;  4WEL A;  1K25 A;  5CGW A;  1L0D A;  3ZG8 B;  5CGS A;  4UHU A;  1LSW A;  3GV9 A;  1AWI A;  3DW0 A;  3L7H A;  1XFQ A;  1NRJ A;  4O7D A;  3JVU A;  3WS4 A;  1W8Y A;  4IJG A;  4YWZ A;  2RL3 A;  3LR4 A;  3UB7 A;  3DWK A;  4UA7 A;  1Y4O A;  1VET B;  4X25 A;  1CI9 A;  3BYD A;  1KGE A;  3T50 A;  3A3I A;  4RYE A;  2JC7 A;  2V2F F;  2JBF A;  1K54 A;  1MPL A;  4H6J B;  4KZ8 A;  4MNR A;  3V67 A;  3IWQ A;  1X0O A;  4RX2 A;  4OVD A;  5M18 A;  5DTT A;  4NEE D;  5A92 A;  2X01 A;  1GA9 A;  4C6Y A;  1W7F A;  4KQR A;  3KSG A;  4R3A A;  4QD4 A;  4ZRR A;  3UY6 A;  1KE3 A;  1MWT A;  3OPP A;  2D01 A;  3KX0 X;  3LR5 A;  4HJ6 A;  3U2A A;  3BFD A;  4YIN A;  3CUE A;  1LSV A;  4L9F A;  1J3W A;  2HF6 A;  2DMW A;  1DP6 A;  3RJU A;  1N9L A;  5DF9 A;  5AVE A;  4LV1 A;  5J3W A;  5FQM A;  2W1T B;  1I5Q A;  2HDQ A;  1S4R A;  2VGL S;  1TD5 A;  4R3B A;  1PZO A;  2PYP A;  4MN6 A;  1I2S A;  1JNU A;  3NUL A;  3SS3 A;  3ZFZ A;  1VHM A;  2MJ6 A;  2QZ6 A;  3MR0 A;  4DXC A;  4MBH A;  4Y0T A;  1WYC A;  3G32 A;  3RH8 B;  3T4O A;  4HEF A;  3CZD A;  4OQI A;  3BEC A;  4DMZ A;  2WZZ A;  4JGP A;  3T4S A;  5GHY A;  2JKG A;  1LHY A;  4HY8 A;  1XA7 A;  3Q07 A;  4FCF A;  4D2O A;  1K56 A;  4WYY A;  5CHU A;  1S1Z A;  3T4T A;  2ZMV A;  2HP9 A;  4FSF A;  3P01 A;  2X71 A;  4GHI B;  2OAP 1;  3ZNY A;  4GZB A;  1NXY A;  4JBF A;  2Y55 A;  3W4P A;  1Y54 A;  1IYO A;  4JPM A;  3F1O A;  3IWI A;  3G31 A;  2KOI A;  3EWK A;  2B02 A;  3NJA A;  4NG2 A;  4B4X A;  3BFF A;  3T1X A;  3I7J A;  3R7W B;  3ZDJ A;  3HLD A;  5A93 A;  5A8B A;  2J3T C;  3GMW A;  3TG9 A;  2PD8 A;  4S2J A;  1BTL A;  3UN7 A;  2EX8 A;  3PAG A;  5IS1 A;  1LL8 A;  4DDY A;  5CTM A;  1N9O A;  1TVF A;  3H7W B;  1IFQ A;  2FFF B;  3WWX A;  1PRQ A;  2WKE A;  2QWS A;  2LB9 A;  3HUN A;  1K6R A;  1VQQ A;  3NBL A;  1V9Y A;  3RFB A;  4OKP A;  3CLO A;  3DAV A;  4JKT A;  3LIE A;  3FG8 A;  4NET A;  1D7E A;  1TS8 A;  4HOI A;  1PW1 A;  4I39 A;  4HP4 A;  2A24 B;  2ZL1 A;  2ZC4 B;  3PBQ A;  1ESI A;  5CHJ A;  5TGF A;  1O07 A;  3S22 A;  2WUQ A;  3K2N A;  2VJW A;  4FD8 A;  2PBD P;  4F3L B;  1DRM A;  3NHQ A;  1CEG A;  2XF3 A;  2P9V B;  2ZQ7 A;  4GS9 A;  4UEY A;  4R4S A;  1S66 L;  3IHB A;  1DJC A;  4WZ5 C;  5L10 A;  1YMS A;  4MCW A;  1S4S A;  1KE4 A;  4QY5 A;  2PR6 A;  3DBA A;  4N9L A;  3C38 A;  3VFF A;  3VOZ A;  4ZJ1 A;  2VZW A;  2QMI A;  4OPR A;  2QKP A;  3ZYT A;  2R9W A;  4BLM A;  1M40 A;  4EBN A;  2ZQ9 A;  4WEK A;  4UA9 A;  2XD1 A;  2W27 A;  3BW6 A;  4MN5 A;  2OLV A;  2OWH A;  1LSX A;  4QHC A;  5EE8 A;  4KUK A;  3MQ0 A;  2ZJ9 A;  3VE3 A;  1IKG A;  1TDL A;  1BSG A;  5FDS A;  3T1R A;  2V1A A;  2Q9N A;  4Y15 A;  3G2Z A;  3A0S A;  5GHX A;  2EX6 A;  2ZM2 A;  3IX3 A;  1HTZ A;  2G7U A;  2J9O A;  2WKH A;  3C4P A;  1FCN A;  5HAI A;  1LLB A;  3QNC A;  1OPX A;  2H28 A;  2A49 A;  4S2L A;  5HL1 A;  2I72 A;  3F1P B;  3P09 A;  4RA7 A;  2PDR A;  1OT6 A;  1RCJ A;  2Y2Q A;  4RX3 A;  4C75 A;  4JXS A;  2G2U A;  1DP8 A;  1TDG A;  2VV6 A;  3BQ8 A;  4EUV A;  4FUW A;  4G3W A;  3W4O A;  4E3M A;  2Y59 A;  4NKP A;  5F6A A;  5TBM B;  1BUE A;  3CPT A;  3T4L A;  4PM9 A;  1FSW A;  1YT4 A;  1ONH A;  5KSC A;  3LYX A;  1KE0 A;  4CLC D;  4PM5 A;  1SZV A;  4WEJ A;  3HUM A;  5A91 A;  4Y3I A;  3S4X A;  3EEA A;  3HLW A;  4KZ6 A;  3T1S A;  4CPK A;  3OLO A;  4HBT A;  4OOL A;  5U47 A;  4ARZ A;  1GSW A;  5CTN A;  1XJ6 A;  5DFX A;  3G35 A;  1NRF A;  3LY4 A;  4WZ4 A;  4E3I A;  4GKU A;  4LLO B;  4KQQ A;  2ZMF A;  1Z6F A;  4ETZ A;  4JXG A;  3IT9 A;  3TE8 A;  1V9Z A;  3IX8 A;  4Z1W A;  1BLH A;  2OV5 A;  4GB7 A;  1GSX A;  4U3T A;  4LFU A;  5E2E A;  4G3K A;  1L0G A;  3IWO A;  3C2W A;  4CQH A;  1XX2 A;  4P6Z S;  2GZA A;  2NUT C;  3HRE A;  3IXH A;  1FIK A;  1K56 D;  1SKO B;  2IWB A;  5DTK A;  1MWS A;  2QHK A;  1RP5 A;  1KVM A;  1F98 A;  4P6Z M;  1K6S A;  3NC8 A;  3NY4 A;  2V8C A;  1T1C A;  2HV1 A;  1YM1 A;  4OLD A;  3E4O A;  4OP5 A;  1ES2 A;  1GA0 A;  4R3J A;  3EQU A;  3BRM A;  1PI5 A;  1XKZ A;  4KUO A;  3UDI A;  4F94 A;  3DWZ A;  3MKE A;  3MZF A;  5FAO A;  3PTE A;  5EVI C;  3UE6 A;  1ACF A;  4HES A;  1TS0 A;  5GLD A;  1W8Q A;  5J7E A;  3ZG0 A;  3W4Q A;  3C5A A;  3VSK A;  1WA9 A;  4HJ3 A;  3UPO A;  3A3F A;  3F1N B;  3G6O A;  2OLU A;  5CHM A;  3MXS A;  4HH2 A;  1PW8 A;  3ISG A;  3O5Y A;  2NUP C;  5HAR A;  3PBN A;  5D3O A;  2VEA A;  3AGD A;  2Z2M B;  1LI0 A;  1YLT A;  4KZ4 A;  5LBR A;  4EWF A;  3MFX A;  5CGX A;  5EOE A;  3NCK A;  2ZC7 A;  3UDX A;  3UB6 A;  2HPB A;  4KZ7 A;  4LRY C;  2JKT M;  1GHI A;  4EET B;  3LID A;  3CJM A;  3G2Y A;  4HQA A;  3SS4 A;  5HZH A;  3SH9 A;  2JN7 A;  1BUL A;  2Y2P A;  1KOU A;  3E4P A;  1E4D A;  5FQK A;  4Y17 A;  5EM1 A;  3D3O A;  5GHZ A;  3ZG9 B;  4GNU A;  3H82 B;  3ZCZ A;  3V5M A;  2EXA A;  3LIC A;  2XFT A;  3OZH A;  2FZ0 A;  3UPP A;  1ZTU A;  1ERM A;  1K57 C;  3FWL A;  1VEU A;  3KSF A;  1XJ3 A;  4D60 A;  4OPZ A;  4FH2 A;  1PWC A;  2JKR I;  2ACG A;  1QME A;  5EV0 A;  1H8M A;  4JXW A;  5IHV A;  4X6T A;  4PM6 A;  3NDE A;  2PU2 A;  3S7O A;  3C4O A;  4R38 A;  4UQI S;  2PHY A;  4QPR A;  3JVV A;  5CRF A;  2ZBB A;  1BLP A;  1SCW A;  3IX4 A;  3TRC A;  4UQI M;  2H10 A;  1F5M A;  5GLC A;  5HW3 A;  3IQA A;  3MXQ A;  3NI9 A;  5FQI A;  1FSY A;  4PKY A;  4H8R A;  3LEZ A;  1G5U A;  4HBU A;  2WAE A;  5HWW A;  1TF1 A;  3SS5 A;  4EXO A;  3FV7 A;  3QNB A;  5DFY A;  4XUZ A;  5JYP A;  2W3H A;  5F68 A;  1W63 Q;  3HCY A;  5EPH A;  4GN2 A;  4X68 A;  2WGW A;  1NYY A;  1K55 A;  4CLC A;  3BY9 A;  5TFQ A;  2Y2O A;  4Q0I A;  2ZC5 B;  4JGO A;  3O88 A;  2J3W A;  2E8J A;  2X02 A;  5L2F A;  5E43 A;  3MJQ A;  3FYZ A;  3LR3 A;  3MKF A;  4WM9 A;  5E2F A;  1T19 A;  4LCL A;  1IYQ A;  2V20 A;  3OCL A;  2VGL M;  2ZQA A;  4NK3 A;  3QP4 A;  2Z2L B;  4K08 A;  3VP4 A;  4BBU A;  3LIB A;  5HWV A;  1VET A;  2Y4A A;  3DTM A;  3IHA A;  1BZA A;  3VP2 A;  2O0Y A;  3Q7V B;  4OPQ A;  4E3L A;  3UNW A;  4H6J A;  3CI6 A;  2P04 A;  1NY0 A;  4Y0U A;  5EVI B;  1OME A;  3V3S A;  5G4Z A;  1MBL A;  4I5S A;  2WAF A;  3ZHH A;  3BFE A;  4GJ4 A;  1H8Z A;  4HI4 A;  3OCN A;  1MZU A;  3IS2 B;  5C5K A;  1OTB A;  4DJ3 A;  1BT5 A;  5HAQ A;  4BBT A;  4X53 A;  4EQI A;  4K0W A;  3DTE A;  3GR2 A;  4LV2 A;  2YKF A;  2V8F A;  3FKV A;  1QMF A;  4GDN A;  2XQZ A;  3FPW A;  1GHP A;  5EUA A;  5DJT A;  2Y2H A;  3Q81 A;  4JGQ A;  2Y2K A;  4IHQ A;  3BEB A;  5K5B A;  3HLG A;  1HLU P;  5AVF A;  1EWZ A;  3IBJ A;  3CG5 A;  1O7E A;  3IF6 C;  2BAS A;  4M4X A;  4R0Q A;  4ESP A;  3QP2 A;  2W1T A;  4NXF A;  1JWZ A;  1N9B A;  1OJ5 A;  3TJZ C;  3BM6 A;  3SH7 A;  3LFV A;  4ZAM A;  2K2N A;  5FDH A;  3SW1 A;  3UB9 A;  3MZE A;  5FQJ A;  5BOH A;  1XGI A;  2V0U A;  1GCE A;  1LI9 A;  2EX2 A;  3FZC A;  3CIT A;  2ZOI A;  2WGV A;  4DJ2 A;  1NJ4 A;  2B95 A;  3IXB A;  5E2G A;  3WS1 A;  4Y13 A;  3DTI A;  2W3D A;  4E3N A;  2HDR A;  4BD1 A;  3RXW A;  2W3G A;  3HVF A;  1VB6 A;  2XGN A;  3UPN A;  2EFU A;  2WKQ A;  4LEN A;  1CF0 A;  2VA0 A;  1G28 A;  1TS6 A;  3WRT A;  4Q0H A;  1YSP A;  3UME A;  4G3V A;  3IF5 A;  2J3T D;  2XFS A;  1WE4 A;  3M2K A;  4EV4 A;  5CED A;  4GHI A;  4IVI A;  3NOT C;  3AGE A;  1A0K A;  1MXO A;  4KZB A;  1W63 M;  5EM0 A;  2R9X A;  4BBV A;  4GDB A;  4EER A;  3KYE A;  4X56 A;  3D4F A;  4PMA A;  2V1Z A;  4BJP A;  4IUK A;  3LCE A;  3UE3 A;  4E3J A;  1W5D A;  4EQ1 A;  2ZC6 B;  3R7W A;  2PD7 A;  4JF4 A;  4HP9 A;  4ETX A;  3WS5 A;  4S2N A;  4DXB A;  3N4I A;  4WN5 A;  2QJ7 A;  4U0X A;  3NOP C;  3LEQ A;  2QYB A;  4IED A;  4JF5 A;  4DF6 A;  4B93 A;  3H7W A;  3JPU A;  1NYM A;  1K54 C;  3U4L P;  1ZG4 A;  2V9A A;  2Z6D A;  1CEF A;  3VE4 A;  3LR0 A;  2XEP A;  4FTX A;  3GDI A;  3KYQ A;  3OPL A;  5FI2 A;  2GJ3 A;  1YLZ A;  5J8X A;  2A24 A;  1XP4 A;  1PFL A;  3O3V A;  3UE0 A;  1DP9 A;  2UV0 E;  3ZG5 A;  4S2O A;  4P0M A;  3B47 A;  4II7 A;  2O9A A;  2XA7 S;  4KQO A;  2J7V A;  2EWV A;  5HL6 A;  5FAS A;  1SKF A;  3CUE C;  4F3L A;  4OH0 A;  3UB8 A;  4R1G A;  3W8K A;  4S2I A;  3ZVT A;  2GDN A;  2Y2I A;  2XA7 M;  5KIZ A;  2P9V A;  1CQA A;  4HHD A;  5HWT A;  4XXR A;  3L9K A;  4PM8 A;  3D9Y A;  5EOO A;  5F1G A;  4PKY G;  3KSH A;  5EVI D;  5EVL A;  3A3E A;  4PPR A;  1H3Q A;  2WKI A;  4KEN B;  1STZ A;  2EX9 A;  4K0X A;  3VP3 A;  3D72 A;  1YSQ A;  1OTI A;  1OTA A;  4WLA A;  2XR0 A;  1K38 A;  4QB8 A;  5CER A;  2ZM0 A;  2HGV A;  4GOG A;  3C30 A;  5E2H A;  3E2K A;  2W3F A;  3M2J A;  5DKL A;  4MN7 A;  4EEP A;  2Z6C A;  3FC7 A;  1N4O A;  2XK1 A;  4Q0J A;  2XSS A;  2UWX A;  5KZH A;  3IF6 B;  2O99 A;  3GEC A;  3QP5 A;  2GX5 A;  5FSR A;  1Y28 A;  5DF8 A;  5F83 A;  3VSL A;  2J80 A;  3AGF A;  2ZC3 B;  1OTD A;  5DJU A;  5KSH A;  5A90 A;  5CXW A;  2WK0 A;  4DE2 A;  2EA9 A;  1MWU A;  2QJ5 A;  2I9V A;  1Q2Q A;  5DTS A;  1TEM A;  2Y91 A;  2PYR A;  2W3E A;  3W2Z A;  2P74 A;  2H0T A;  3F1P A;  4HJ4 A;  4C3Q A;  5CX7 A;  2ZLY A;  3LGO A;  4MDZ A;  5EVE A;  1JVJ A;  3T12 B;  1GHM A;  2DNS A;  4OOY A;  3EGX C;  3ZVW A;  4S2M A;  3VV4 A;  4AFI A;  2R78 A;  5L09 A;  2P7J A;  5F1F A;  2BLS A;  2VKS A;  5TBM A;  4FOF A;  1GSV A;  1ZHH B;  2VGK A;  5F69 A;  3B33 A;  3NEC A;  4DE3 A;  3UDF A;  3WS0 A;  1EI5 A;  3EGD C;  2PT7 A;  1U60 A;  4LCM A;  5M1A A;  4L9E A;  4IBX A;  1YKD A;  3VP0 A;  1LL5 A;  1ERO A;  1ES3 A;  2ZQC A;  3G4P A;  3G30 A;  3GTC A;  4I38 A;  1DJA A;  1UWN X;  1H0M A;  4KZ3 A;  5HDC A;  3K3D A;  4DE0 A;  1ES5 A;  2JCH A;  4UA6 A;  1PIO A;  5L8M A;  5FAT A;  4JGR A;  1HVB A;  4WF0 A;  1ES4 A;  1FR1 A;  4WMC A;  2RCX A;  1MWR A;  4IUH A;  4BL3 A;  2ZM8 A;  2P08 A;  3HLF A; 
#chains in the Genus database with same CATH homology
 3LR3 A;  3PBQ A;  1N9N A;  2V0W A;  1T19 A;  4ME4 A;  5G4Y A;  3OCL A;  3LUQ A;  2W1R A;  2VGL M;  3K2N A;  2VJW A;  4K08 A;  4BBU A;  4F3L B;  3LI8 A;  2A2L A;  1DRM A;  3LIB A;  3NHQ A;  5HWV A;  2L1M A;  4EW7 A;  3KO6 A;  2O0Y A;  4GS9 A;  4UEY A;  3MMH A;  1LT0 A;  5TJJ A;  1S66 L;  4H6J A;  3CI6 A;  2P04 A;  2CMN A;  3T4K A;  4XT2 A;  2WKP A;  5G4Z A;  4I5S A;  4MCW A;  1S4S A;  4EU0 A;  1S1Y A;  4GJ4 A;  3UMD A;  2B18 A;  2PR6 A;  3DBA A;  4HI4 A;  3PBR A;  3EOI A;  3OCN A;  3C38 A;  1MZU A;  3IS2 B;  2JKR M;  4GLQ A;  5C5K A;  1OTB A;  4DJ3 A;  1XJ2 A;  4BBT A;  2VZW A;  3A0R A;  2Y79 A;  1T1B A;  2QKP A;  3ZYT A;  3PHY A;  1MKM A;  2ZOH A;  3A0V A;  4WEK A;  4BMW A;  5DKK A;  4WUJ A;  2W27 A;  2YKF A;  4E04 A;  3BW6 A;  4MN5 A;  3FPW A;  1UGU A;  2OWH A;  3EEH A;  1LSX A;  5DJT A;  4I3A A;  2Y8H A;  2HJ9 C;  3F1N A;  2OOL A;  3BY8 A;  4JGQ A;  3LIF A;  5AJG A;  4KUK A;  3MQ0 A;  3VE3 A;  2M7U A;  3OC2 A;  4IHQ A;  1XJ4 A;  5K5B A;  3BWL A;  5AVF A;  3NOU C;  4L9G A;  3KYZ A;  4PAU A;  3IBJ A;  4GCZ A;  1YAX A;  2L0W A;  4M4X A;  2BAS A;  4OOM A;  2V1A A;  4O0P A;  1EW0 A;  4NXG A;  2W1T A;  2LB5 A;  2L4R A;  3BJN A;  4NXF A;  5HDS A;  1OJ5 A;  3A0S A;  3KSI A;  1NLY A;  3TJZ C;  4EES A;  3LFV A;  2K2N A;  4XT2 B;  4PHT A;  3SW1 A;  2G7U A;  3PYP A;  3UB9 A;  2V0U A;  3CIT A;  3MQQ A;  2ZOI A;  3E98 A;  5EFW A;  3S7Q A;  3LIA A;  1OPX A;  4DJ2 A;  2H28 A;  4Y5F A;  2JHE A;  3PR6 A;  3OBF A;  3RTY A;  1D06 A;  2KLI A;  3F1P B;  2PDR A;  1OT6 A;  2KDK A;  2W3D A;  4YNR A;  4LRZ E;  2W3G A;  5HD3 A;  1DP8 A;  1VB6 A;  2VV6 A;  1ODV A;  3BQ8 A;  3PBO A;  4B9O A;  4EUV A;  3F1O B;  3H82 A;  4HH3 A;  2K31 A;  2WKQ A;  4HIA A;  4G3W A;  2VA0 A;  1G28 A;  1TS6 A;  3K3C A;  2D02 A;  4Q0H A;  2O9B A;  1P9W A;  1YSP A;  3UME A;  4NKP A;  4O01 A;  4G3V A;  5IT5 A;  5F6A A;  5MC7 A;  2J3T D;  4GW9 A;  5TBM B;  3T4L A;  4EEU A;  3MF0 A;  1OTE A;  3T4Q A;  4GHI A;  3LYX A;  3NOT C;  1MC0 A;  4CLC D;  4WEJ A;  1NLZ A;  1W63 M;  3ZQ5 A;  1P9R A;  4MMN A;  4Y3I A;  4BBV A;  3EEA A;  4EER A;  3B42 A;  2PR5 A;  3LI9 A;  4BJP A;  4IUK A;  3OLO A;  4OOL A;  4ARZ A;  1GSW A;  2IA2 A;  3P7N A;  1XJ6 A;  5DFX A;  3UE3 A;  2JKT I;  4R6L A;  2M1C A;  4CLC E;  4EQ1 A;  1P97 A;  2XRN A;  3R7W A;  2PD7 A;  2INW A;  4LLO B;  2VV8 A;  4HP9 A;  2ZMF A;  4ETX A;  1P0Z A;  4ETZ A;  4CLC B;  3TE8 A;  1V9Z A;  4NXB A;  2YKH A;  4WN5 A;  2QJ7 A;  3R4K A;  4Z1W A;  3S7P A;  3NOP C;  1S67 L;  3ULF A;  2QYB A;  2OAQ 1;  4WEL A;  1GSX A;  4B93 A;  3H7W A;  4G3K A;  1LSW A;  3C2W A;  4CQH A;  4P6Z S;  2GZA A;  2NUT C;  5HPI A;  1NWZ A;  1XFQ A;  1NRJ A;  3JVU A;  2V9A A;  2Z6D A;  4IJG A;  4YWZ A;  3LR4 A;  3UB7 A;  3VE4 A;  3LR0 A;  2QHK A;  1F98 A;  4P6Z M;  4HNB A;  2VLG A;  3GDI A;  3ICY A;  4GS9 B;  3T50 A;  3KYQ A;  1T1C A;  2HV1 A;  2GJ3 A;  2A24 A;  3E4O A;  4H6J B;  3C8C A;  3V67 A;  1DP9 A;  1X0O A;  5J4E A;  3EQU A;  4KUO A;  4LPZ A;  3B47 A;  4II7 A;  4NEE D;  2O9A A;  2XA7 S;  4KQO A;  3UE6 A;  3TW8 A;  2EWV A;  5HL6 A;  3CUE C;  4F3L A;  1BYW A;  1TS0 A;  4RQ9 A;  3KSG A;  3UB8 A;  4R3A A;  4WL9 A;  4ZRR A;  3H9W A;  2XRO A;  5KIZ A;  2XA7 M;  5J7E A;  4HHD A;  5HWT A;  2D01 A;  2EWW A;  3KX0 X;  3LR5 A;  4KQD A;  3VOL A;  4HJ6 A;  3U2A A;  1WA9 A;  4HJ3 A;  1T18 A;  4PKY G;  3KSH A;  3F1N B;  3CUE A;  1LSV A;  3G6O A;  4L9F A;  2HF6 A;  5HSQ A;  1H3Q A;  2DMW A;  4O8G A;  4HH2 A;  1DP6 A;  1G6O A;  1N9L A;  5DF9 A;  5AVE A;  3O5Y A;  1STZ A;  3IS2 A;  2NUP C;  3D72 A;  1YSQ A;  3E4Q A;  1OTI A;  1OTA A;  3PBN A;  4WLA A;  2VEA A;  5J3W A;  3S7N A;  2W1T B;  3PBS A;  2HGV A;  1TS7 A;  3C30 A;  5LBR A;  1S4R A;  2VGL S;  3MFX A;  1TD5 A;  2W3F A;  2VX8 A;  5DKL A;  4MN7 A;  1OT9 A;  4EEP A;  2Z6C A;  1T1A A;  3FC7 A;  4BWI A;  3UB6 A;  2PYP A;  4LRY C;  4MN6 A;  2JKT M;  2XSS A;  1JNU A;  4Q0J A;  4R70 A;  4EET B;  3LID A;  2O99 A;  3GEC A;  2V1B A;  2GX5 A;  3T4J A;  1VHM A;  1Y28 A;  4HQA A;  2MJ6 A;  3EQV A;  2M7V A;  5HZH A;  3BQA A;  3MR0 A;  2J80 A;  2JN7 A;  1KOU A;  3E4P A;  2W0N A;  4NXE A;  1OTD A;  2OWJ A;  5DJU A;  5KSH A;  4I3J A;  3RH8 B;  3T4O A;  1OJG A;  3D3O A;  3H82 B;  3MQO A;  5FL3 A;  3LIC A;  4DMZ A;  2EA9 A;  2QJ5 A;  2I9V A;  5HDD A;  2FZ0 A;  3HJK A;  4JGP A;  3T4S A;  2HJE A;  1ZTU A;  3CWF A;  2PYR A;  4HY8 A;  5HD5 A;  2W3E A;  1S1Z A;  3W2Z A;  3T4T A;  3KSF A;  2KX6 A;  2ZMV A;  1XJ3 A;  3F1P A;  4FSF A;  4HJ4 A;  3P01 A;  5CX7 A;  5I5L A;  4GHI B;  2JKR I;  2OAP 1;  4MDZ A;  1H8M A;  3E0Y A;  2FH5 A;  1XFN A;  3EGX C;  3S7O A;  3F1O A;  1IOU A;  4R38 A;  4UQI S;  2KOI A;  3EWK A;  3VV4 A;  4AFI A;  2B02 A;  4ARZ B;  2R78 A;  1UWP X;  2PHY A;  4QPR A;  3NJA A;  3JVV A;  5IU1 A;  3HJI A;  2P7J A;  2VKS A;  5TBM A;  2ZBB A;  4L0L A;  4FOF A;  1GSV A;  1ZHH B;  3TRC A;  4UQI M;  3R7W B;  5F69 A;  1F5M A;  3B33 A;  5A8B A;  5F5Y A;  2J3T C;  3OOV A;  3MXQ A;  2VV7 A;  2PD8 A;  4PKY A;  3EGD C;  2PT7 A;  3CAX A;  5IS1 A;  5HPF A;  1LL8 A;  3PXP A;  4LRX C;  2WKR A;  4CLC C;  4L9E A;  1YKD A;  5HWW A;  1TF1 A;  4EXO A;  1N9O A;  5DFY A;  2W3H A;  3H7W B;  1W63 Q;  1IFQ A;  5F68 A;  3HCY A;  3FPV A;  2K7S A;  4I38 A;  2QWS A;  1F9I A;  1UWN X;  2LB9 A;  1V9Y A;  5HDC A;  4YOF A;  3RFB A;  3K3D A;  3CLO A;  4CLC A;  3IBR A;  3LIE A;  3BY9 A;  5L8M A;  2O9C A;  3FG8 A;  4Q0I A;  4JGR A;  4JGO A;  4DN0 A;  2GNX A;  4WF0 A;  1D7E A;  3PBT A;  1TS8 A;  2J3W A;  4HOI A;  4I39 A;  4HP4 A;  4I3I A;  2A24 B;  3MJQ A;  4IUH A;  4Y2F A;  2P08 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...