3T1SA

Mglb homodimer
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
133
structure length
133
Chain Sequence
SLVLYGAPYERAVEVLEETLRETGARYALLIDRKGFVLAHKEALWAPKPPPLDTLATLVASNAAATQALAKLLGEARFQEEVHQGERMGLYVDEAGEHALLVLVFDETAPLGKVKLHGKRAAEALARIAEEAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Gliding protein MglB
publication title Structural analysis of the Ras-like G protein MglA and its cognate GAP MglB and implications for bacterial polarity.
pubmed doi rcsb
source organism Thermus thermophilus
total genus 39
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03259 Robl_LC7 Roadblock/LC7 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 3t1sA00
4X25A 2ACGA 2JKFA 3L9KA 1HLUP 3NULA 4D60A 1VEUB 1PRQA 1FILA 3T1RA 1K0KA 3T12B 3KYEA 2PBDP 1ACFA 1A0KA 2V8FA 2PAVP 1PNEA 4FTXA 1G5UA 1SKOB 4FUWA 1J3WA 3T1QB 3CPTB 3LEQA 3DAVA 4QWOA 5EVEA 1VEUA 3CHWP 1D1JA 4X1MA 3MSHA 1CF0A 3T1XA 1YPRA 2PRFA 2ZL1B 5FEFA 1SKOA 1SZVA 2HZ5A 5EM0A 1AWIA 2VK3A 4ESPA 5EV0A 3CPTA 3MS6A 2BTFP 1VETB 3NECA 1Z09A 3LGOA 2E8JA 1Y4OA 4X1LA 1FIKA 1CJFA 3T1SA 2ZL1A 2B95A 2V8CA 3L7HA 5FDSA 2JKGA 3D9YA 5EM1A 1PFLA 3U4LP 5FEGA 1CQAA 1VETA 3UB5P 1F2KA
chains in the Genus database with same CATH superfamily
5FQIA 3Q7ZA 1NLYA 1GCEA 1Z6FA 5F1FA 4WUJA 2VEAA 2Y2PA 3WS4A 2AVXA 1W79A 4IJGA 2P9VB 4ZRRA 3QP1A 1HZOA 5M19A 4WZ5A 4L9GA 1LSVA 2WKPA 1S4SA 2EXBA 2VGJA 2HGVA 3AGDA 3MF0A 4ME4A 4P87A 1S6RA 3NOPC 5FAOA 1D1JA 4KQQA 3UB7A 4ARZA 1LSWA 3EQUA 4QY6A 1P97A 2J8YA 2PRFA 2M1CA 5U47A 1K4EA 1SKOA 3VP0A 2KX6A 1IKGA 1Y28A 5L2FA 4EW7A 3DTIA 4QU3A 2HP6A 1HD8A 1IELA 3ZVWA 5FASA 1JWPA 3HUNA 1E3UA 3GR2A 4N1XA 3E0YA 4EU0A 4U3TA 3IF6C 2OWHA 3W8KA 2UV0E 3UB8A 2W3EA 5FATA 4Q0HA 5FI7A 2MJ6A 4UA7A 2R78A 2HDQA 4Y2FA 3G6OA 4XT2B 1T19A 1G28A 3D9YA 3BYDA 5L10A 2PR5A 3SH9A 5E43A 2PU2A 4E3JA 4LV3A 3IHAA 1FSWA 2K7SA 1BLPA 2GZAA 2O0YA 3B42A 5GHYA 1F2KA 1F98A 5EE8A 3QNBA 3GSGA 3VP1A 1PRQA 5EVLA 1FILA 4PM5A 1PZPA 1OJGA 4C6YA 2DNSA 4FH2A 4L0LA 1I2SA 4HY8A 1GSWA 4FSFA 1G5UA 3EGDC 2Y91A 1IYQA 4LENA 4ZTKA 2OWJA 4KQOA 5EFWA 5GLDA 3BQ8A 2QYBA 3WS1A 4DRTA 4JKTA 1DJBA 2Y2QA 5IT5A 1GHMA 2Y55A 3LY3A 5FQMA 4EUZA 4WF0A 3N8RA 3UO9A 3T1XA 3LIAA 3G34A 1GHPA 4NXBA 1YSQA 3MXSA 1S1ZA 3UPOA 4PHTA 5HAQA 4LPZA 1Y54A 4ZJ2A 3OPLA 3ZNTA 3E4PA 4GD8A 5DFYA 2X01A 1YLWA 4DJ2A 3FWLA 3KSGA 4I3IA 1OT6A 1D7EA 4JGPA 4X69A 3CLOA 3NJAA 4X1LA 4ZDXA 3QNCA 4L9EA 3T1SA 4JF4A 2ZL1A 5AQ7A 5F83A 5CHUA 4OPZA 2V1AA 5DFXA 1M40A 2W0NA 1KOUA 2M7VA 4UA9A 4HBUA 4H6JB 5BOHA 1PYYA 2ACGA 5HSQA 5HPIA 1NJ4A 3T4TA 1H3QA 4S2NC 2JKRM 3MQ0A 2PD8A 2Q9NA 2Y2GA 2XFTA 2OV5A 2PD7A 5DKKA 2HDRA 1DJAA 4JXSA 5AQAA 3HUOA 3PBOA 4OP5A 2VZWA 4Y0UA 1ERMA 5DTKA 2PR6A 4QWOA 4LV1A 2OLVA 2J7VA 4CQHA 1VEUA 3MJQA 1XXMA 3CHWP 2BASA 3BRMA 4S2KA 3N8LA 1PWCA 2ZC4B 3R7WB 2VJWA 4GW9A 3I7JA 1KDSA 4Y3IA 2V1ZA 4MLLA 4EBPA 3CI6A 3ITAA 3E2KA 4ESPA 1YM1A 2VK3A 2A2LA 3MMHA 2A24B 3BWLA 1MZUA 4DMZA 1K55C 3BQAA 3CZDA 5JYOA 5CTMA 4MDZA 2C6WB 1LL8A 1N9LA 1CI9A 3C4PA 2E8JA 5F82A 1BLSA 2OOLA 2ZM2A 2A3UA 1P0ZA 5CHMA 3MQOA 3G30A 2EWWA 1SDNA 5CGXA 4DDYA 1F9IA 1NYMA 3K2NA 3G4PA 2XEPA 4EQIA 5E2GA 3NI9A 3ZG7B 1SDEA 3C38A 5E2HA 5HWTA 3L9KA 3BFFA 2XA7M 2QKPA 1K6SA 4G3KA 3HBRA 3H82B 4NXFA 3Q07A 1S67L 3T4JA 3ITBA 4IUKA 5CX7A 1MWRA 2FFFB 4EERA 2W27A 2ZM0A 1T1BA 4IBXA 4HNBA 3Q7VB 3S7PA 3BECA 1YMXA 2ZM8A 5EVIA 2XA7S 1FQGA 2UWXA 1MWSA 4NXGA 2HDSA 3MR0A 3TOIA 5G4ZA 3D4FA 1ES5A 2M7UA 3JVVA 1ES4A 1XJ3A 4JGOA 4QY5A 1L0FA 4HOIA 3DW0A 3G32A 2I9VA 3CPTA 4OQIA 4LV2A 3M6BA 3MZDA 2R9XA 4HIAA 1MWUA 5KIZA 1W5DA 4CJNA 1VETB 2JKTM 2W3FA 1YKDA 2XR0A 2Y2OA 4DE2A 3VFHA 2WKRA 1GSVA 3QHYA 4OQHA 1V9ZA 5EUAA 2Y2HA 3V67A 1ALQA 1N4OA 1XGIA 1IOUA 2V8CA 3O87A 4EBNA 1T1AA 3SH7A 3N8SA 3H7WA 1C3BA 3FYZA 4WL9A 2XK1A 2JKTI 3UMEA 2JN7A 5FI2A 3V39A 4OOYA 3MXRA 2W1TA 5HAIA 3ZCZA 3VE4A 3LIEA 1N9OA 1FR6A 4BL3A 3MZFA 3IS2A 4Y15A 3KYEA 1ZKJA 1OT9A 2PBDP 2WAEA 3OPHA 1YSPA 4E6WA 5EVID 2GNXA 3GRJA 1PNEA 3DTMA 3UDIA 2XF3A 2ZQCA 2V2FF 3K3CA 3P98A 1X0OA 3N4IA 3JPUA 3G2ZA 1RP5A 4LRXC 1L2SA 5A91A 4XXRA 1OPXA 4JLFA 3VP2A 3F1PB 3MSHA 2P9VA 1CF0A 4HJ3A 2V0WA 1S4RA 2ZC5B 1YPRA 1K56D 3IWQA 4KZBA 4P6ZM 4DE3A 1ES3A 4N1HA 1OMEA 4Q8IA 4HP4A 1YLYA 3N6IA 2L0WA 1S66L 3P01A 1CEFA 2V0UA 4O8GA 5J7EA 4KG5A 3ZDJA 2XDMA 5FQJA 2ZC6B 2C5WB 2R9WA 3LFVA 2Q0OA 5CGSA 1ODVA 2Z2MB 3H9WA 4KQDA 1VM1A 3NECA 3S22A 1DP6A 2VV6A 3VOLA 2ZMAA 1OTDA 2WGWB 4P6ZS 4S2OA 1CK3A 4RYEA 1RGZA 4CLCD 2ZQAA 3P7NA 4KZ7A 5CXWA 4PM6A 3UB5P 5DVAA 3BEBA 2ZC3B 2P04A 4CLCB 4B88A 3C30A 4IVKA 3TRCA 1V9YA 4MNRA 4X56A 3NOTC 4F94A 3HLBA 4MEZA 4FCFA 4XT2A 4FTXA 1AXBA 3MXQA 4N92A 4G3WA 3ZVTA 3PBNA 4FOFA 4Q0JA 3RFBA 3B33A 3BW6A 4R0QA 1YLTA 4ZBEA 3VE3A 3MFXA 1BZAA 3HJKA 3UY6A 4WZ5C 4HH2A 1O07A 2ZQ9A 3A0SA 2J9OA 3ZG5A 2EFXA 4PKYA 3FPWA 4BD1A 4HJ4A 4K0WA 3A3FA 3UB6A 4S2LA 2QJ7A 1WA9A 3N7WA 5A8BA 1EI5A 3LYXA 3GV9A 2VGKA 4M3KA 1L0EA 3BY8A 1GSXA 4EBLA 3T4SA 4R38A 3IBRA 2B5RA 4EWFA 1QMFA 3EGXC 4DDSA 1ONGA 3M2JA 4FH4A 2Y2KA 3HVFA 1L0DA 4R3JA 4OVDA 4N9LA 1ZG4A 2O9BA 4QB8A 4X68A 3IBJA 5HWWA 1XFNA 3SOIA 3PBSA 1O7EA 3T1RA 1UWNX 3A3DA 1D06A 3VOYA 2B18A 3C7UA 2NUTC 4S2MA 4I5SA 3GVBA 1H8MA 4Y0TA 2WGIA 4QD4A 3E98A 4H6JA 3UN7A 2EWVA 3LEQA 1FR1A 2ZQ7A 1BYWA 1OTBA 4YFMA 3QP6A 4IHQA 2YKFA 3KX0X 3IXGA 1ERQA 3BJNA 5HD3A 1HVBA 1IFQA 1ZHHB 4WMCD 1XX2A 2E8IA 1YLZA 4I3JA 3V3SA 4BWIA 3TSGA 2XGNA 2J3TC 1VHMA 3FZCA 1STZA 5E2EA 1FOFA 4DN0A 3EWKA 2FH5A 5HL1A 3GTCA 1YT4A 3UNWA 1Z09A 2ZQDA 2NUPC 3R7WA 1FIKA 1JVJA 1XP4A 5DJUA 4X53A 1H0MA 5DJTA 3UE3A 3VSKA 5FSRA 4HI4A 1MKIA 1K25A 4WBGA 2QPNA 1EWZA 3LIBA 2PT7A 4PKYG 3V50A 2A24A 5IHVA 4Y13A 2A49A 3SH8A 5L09A 4LRYC 5AVFA 1TDGA 2K2NA 3ZGAB 5HAPA 4UQIM 4Y5FA 3UDXA 1L0GA 4O7DA 2JHEA 3IF6B 2Y2LA 3S7QA 1NZOA 2B02A 3MBZA 3PYPA 1KVLA 4JF6A 4YINA 1FCMA 3IF5A 4GNUA 3IWOA 4FUWA 5HPFA 2QMIA 2P08A 5HDCA 3IH8A 3LIDA 3C4OA 5HWVA 1W63M 2CMNA 3DTKA 4GJ4A 2ZBBA 4JBFA 3T4KA 4UQIS 1WYCA 3UB9A 1G6AA 1OTEA 3NBLA 4E04A 1PIOA 3H82A 4WEKA 2ZOHA 1TS8A 2G2UA 2J80A 3F1OB 3OZHA 1H8YA 3C7VA 1BLCA 1I5QA 3CMZA 1TDLA 5EV0A 3Q7VA 1WYBA 5A93A 3C8CA 3HLEA 4OKPA 2J9PA 1UGUA 3UPNA 4OOLA 4DE1A 2P7JA 4B93A 3VP4A 1SKFA 1Y4OA 2G2WA 1PWGA 1CJFA 3BLMA 1F5MA 3HLDA 4WM9A 3IT9A 3MZEA 2L4RA 2HP5A 4GLQA 2J3WA 2JKGA 4HP9A 3BFGA 3NDEA 4E3NA 5TJJA 5HDSA 3G31A 3U4LP 5CHJA 3OPPA 3IHBA 1VETA 4QHCA 2Y2JA 5HX9A 1VB6A 2Q9MA 3T4QA 5G4YA 3NULA 4DF6A 4GD6A 4UHUA 1OJ5A 1XJ4A 4XUXA 1UWPX 1KGGA 4OH0A 4PPRA 5FDHA 2OAQ1 2CC1A 1FCOA 4I38A 1E25A 4BMWA 4Q0IA 5EOEA 1W63Q 1H8ZA 3AGEA 1NLZA 4ZJ1A 4BQMA 3LR3A 4GDNA 4L9FA 4BJPA 4GS9B 3VMAA 4KZ9A 4FD8A 2O9CA 4RX3A 1LI9A 1PZOA 3A3JA 3IX3A 4IEDA 3PBTA 4PAUA 1K54A 2PDRA 1E4DA 3WS0A 3OC2A 3OCLA 3OCNA 4PM9A 5EOOA 3RH8B 3A3EA 5D3OA 1JNUA 1ESIA 3D3OA 4PM8A 1JTDA 1S1YA 5M18A 4S2PA 3F1PA 3CG5A 1XJ2A 4RQ9A 1NXYA 4E3IA 2WZZA 3S4XA 3CUEA 4OOMA 4EV4A 4O0PA 4ZAMA 2XD5A 5TGFA 5FI6A 4LCLA 3Q1FA 4Z9QA 1XJ6A 1YAXA 3Q82A 4BBTA 1K56A 2W3GA 1L3LA 2FFYA 3UE6A 3RXXA 4MBHA 5CECA 4KUOA 2JKFA 2WGWA 3A3IA 3UE0A 1KE0A 3ZG8B 1FSYA 3LI9A 4EXOA 4BBUA 4C75A 2XFSA 3LR0A 2HPBA 3PBRA 1ESUA 3T1QB 1IYOA 2GX5A 3O5YA 1IEMA 4CLCA 4KENB 2OLUA 5EPHA 2WZXA 1BULA 2HF6A 3JYIA 3VV4A 4ID4A 4OLDA 2OAP1 5AVEA 5HD5A 3ZYTA 2KDKA 2Z2LB 3FKWA 4OLGA 3TW8A 2WGVA 4UA6A 4U0TA 1MKMA 5GLCA 3IXHA 2D02A 4F3LB 1TS6A 4CLCE 3IXBA 5EM0A 3ZG9B 3OLOA 2IWBA 2VGLM 2Y2MA 4DXBA 4JXWA 2W3DA 3WWXA 1M6KA 3FKVA 2IA2A 3VOZA 4C3QA 4HQAA 1S0WA 1XKZA 5L8MA 4I3AA 3LGOA 3LUQA 1K57A 3RXWA 2VKSA 3A0VA 2RL3A 4ETZA 3NCKA 2X02A 2XROA 5DTSA 4E3MA 2VGLS 4B4ZA 3OPRA 4HH3A 3C5AA 4GHIB 4MCWA 5GHZA 2Z6CA 4XUZA 2YKHA 4RX2A 1G68A 1LLBA 3PTEA 1IKIA 5DF8A 1OTIA 3A0RA 2Y2NA 1PWDA 5F5YA 5CRFA 2V9AA 1SCWA 1A0KA 3QP5A 2V8FA 1YLJA 4PMAA 1KGFA 4I39A 5TBMB 1W7FA 4K08A 3CITA 3W4OA 3U2AA 4LRZE 1P9RA 4X1MA 4K0XA 5FL3A 5C5KA 3HL9A 2XH9A 5A92A 5GL9A 4KZ4A 3K3DA 5FEFA 2EA9A 5HZHA 5HARA 3EOIA 2GJ3A 2BTFP 4ZJ3A 3PBQA 3BM6A 2DMWA 3GQZA 3M2KA 1HTZA 1IYPA 2ZQ8A 3FG8A 3F1NB 3WRZA 2ZLYA 3BFEA 4R4RA 4O01A 5IS1A 2XRNA 4GOGA 3AGFA 2H0YA 3GDIA 2WYXA 1T18A 1YQSA 3LEZA 3ICYA 1BT5A 3VFFA 2W3HA 4WMCA 4WZ4A 4GZBA 2JCHA 5FEGA 3LIFA 4WN5A 4X25A 2QZ6A 3ULFA 5K5BA 2K31A 1J9MA 4X6TA 2H10A 1NY0A 3HLWA 4LV0A 2WK0A 2Y2IA 4M4XA 4KZ5A 3WS5A 4YWZA 5F6AA 4E3KA 3CAXA 2XLNA 2Z6DA 1TS0A 4HESA 4UAAA 1KE4A 2ZMVA 4K91A 5J4EA 2GDNA 3V5MA 2QHKA 2D01A 2HV1A 1H5XA 3S7NA 4YOFA 4OQ0A 2Y8HA 1GA9A 4H8RA 1U60A 5M1AA 4NG2A 1N9BA 2WKQA 4UEYA 3IF6A 5CTNA 2EXAA 1LI0A 4E3OA 1LL9A 4KZ6A 5AQBA 4A5RA 1K4FA 2EX8A 2BLSA 2ZJ9A 3KSHA 2Y4AA 5FQ9A 4OP8A 4EUVA 3RTYA 2I72A 4B9OA 1EROA 5FAQA 2P74A 4RA7A 1XPBA 1TVFA 1IYSA 2PU4A 3T50A 1BSGA 5GHXA 1K38A 3LI8A 4R23A 3IWIA 3F1OA 3UDFA 4P6BA 4BENA 2HDUA 2V20A 3KYQA 3DTEA 5EM1A 5F69A 3SZTA 3C2WA 4Z1WA 1NYYA 3FC7A 4E6XA 1HLUP 2KLIA 1TD5A 5JYPA 1DY6A 3WS2A 1LT0A 3PHYA 3W4QA 3UE1A 2ZMFA 4ARZB 2HJ9C 3E4QA 4LCMA 1N9NA 2RCXA 3HREA 2JE5A 1JTGA 2Y79A 5FAPA 3SW1A 1E3UD 4R3AA 3VP3A 1SKOB 4BL2A 5I94A 4Y0OA 1BTLA 4R1GA 1ES2A 2INWA 2VLGA 1KDWA 1MWTA 3M6HA 1YLPA 1JWZA 4EEPA 3NIAA 4MN5A 3P09A 3UPPA 3HLFA 3BFCA 3QP4A 3QP2A 3BLSA 4S2IA 5L07A 3TG9A 1RGYA 5DF7A 5CEDA 5LBRA 2QJ5A 1KVMA 4DKIA 4QPRA 1DRMA 4GDBA 5CGWA 3SS4A 1TEMA 4Y7PA 3KO6A 1YMSA 2DCFA 1W8QA 4KZ8A 1GHIA 3W2ZA 3IX4A 2OSUA 4GS9A 3BY9A 3IQAA 5I5LA 1I2WA 3CJMA 2HJEA 1QMEA 3SS5A 5HL6A 3O88A 4OQGA 4S2NA 5FDSA 2J3TD 2WKHA 5KZHA 3R4KA 4HHDA 1G6OA 1MBLA 3V3RA 3KSIA 4DXCA 5KSCA 4KZ3A 4KG6A 3EQVA 2BG1A 3MFDA 3LR4A 4NEED 4R4SA 4DE0A 1TF1A 4HJ6A 5IU1A 4WELA 2JKRI 4NK3A 3WRTA 3PAEA 2PAVP 2VV7A 3LR5A 5DF9A 4P85A 4LGWA 2H28A 4WYYA 1KGEA 3DAVA 4D2OA 3HJIA 2PYRA 3HLGA 1PW8A 4S2JA 1K55A 2O99A 3DBAA 3S1YA 4HBTA 4EESA 4II7A 3NC8A 4OPYA 3CWFA 3SS3A 4R6LA 4YNRA 2ZL1B 1SZVA 4GN2A 2H0TA 4JPMA 2XD1A 2LB9A 1NZUA 3MKEA 1DP9A 3PR6A 1NWZA 3IH9A 5CEBA 5KSHA 5J3WA 1CI8A 4IUHA 5MC7A 2VA0A 3T4OA 4IVIA 2X71A 2XQZA 1K54C 4JXGA 3Q81A 3FV7A 5HW3A 4WLAA 2PYPA 2DRWA 4NKPA 4F3LA 2FZ0A 3OBFA 3G35A 3ZG0A 4X55A 5EVIC 2ZD8A 3ZHHA 3LCEA 2PHYA 1SHVA 4MMNA 1PFLA 2QWSA 4OONA 5DKLA 3BFDA 3CUEC 1NRJA 1PI5A 3T4LA 1KE3A 4GCZA 4D60A 1VEUB 2V1BA 3T12B 2EX6A 3KYZA 2JC7A 3VSLA 1ACFA 3JVUA 1NRFA 3EEAA 5F68A 2WUQA 2HP9A 2LB5A 2WADA 1LL5A 3HCYA 4GHIA 4OPQA 3UMDA 4EEUA 5EVEA 2VX8A 3S7OA 3IX8A 5HFOA 4JXVA 1FCNA 3O86A 5CERA 4Y17A 4MN6A 3ZNYA 5DTTA 5J8XA 3G2YA 3TJZC 1OTAA 1LSXA 4KG2A 2HZ5A 1AWIA 4CLCC 4GB7A 4ETXA 4MBKA 3W4PA 4QJGA 5TBMA 2WKIA 4BBVA 4E3LA 1RCJA 3LO7A 2KOIA 4RVAA 5FA7A 2EFUA 3TE8A 4R3BA 1GA0A 4KZAA 1MC0A 3GECA 4P0MA 4NXEA 5EECA 4NETA 5G18A 2B95A 1BUEA 2XSSA 4WEJA 3KSFA 3FPVA 3HLCA 4B4XA 5GLAA 1EW0A 4KUKA 4LLOB 1Q2PA 3PXPA 2WKEA 1DP8A 3DWZA 1CQAA 4BLMA 3QP8A 1K57C 2PBYA 2Y59A 3NDGA 1CEGA 2EX9A 3F1NA 5EVIB 1TS7A 1BLHA 1JWVA 1K0KA 2EX2A 1LHYA 1XA1A 2G7UA 5KMWA 4JF5A 4JGQA 2WAFA 3B3XA 1XA7A 1P9WA 1PW1A 5GLBA 2W1RA 1MXOA 4N9KA 4CPKA 4GKUA 5HDDA 2L1MA 2JBFA 3B47A 3NHQA 3NY4A 5TFQA 1J3WA 5E2FA 4IBRA 3ISGA 1MY8A 3CPTB 5AJGA 3D72A 4HEFA 3LICA 3E4OA 4BD0A 1WE4A 4MBFA 4LFUA 1W8YA 1DJCA 1PI4A 3GMWA 1ZC2A 1K6RA 4OPRA 4R70A 2VV8A 5TR7A 5AQ9A 2IWCA 1ZG6A 4PM7A 4AFIA 3MKFA 3LY4A 1ZTUA 2IWDA 3NOUC 3E2LA 3H7WB 4MN7A 3MS6A 4EQ1A 5A90A 1XFQA 3ZFZA 3OOVA 4EETB 2O9AA 2W1TB 4KQRA 3O3VA 3RJUA 5F1GA 5FQKA 1VQQA 1T1CA 1XGJA 4G3VA 3IS2B 3EEHA 1MPLA 5FQQA 3L7HA 4JGRA 2ZC7A 3HUMA 1Q2QA 1ONHA 4DJ3A 3PAGA 3IXDA 3DWKA 2ZOIA 2H5SA 3MQQA 4U0XA 3ZQ5A
chains in the Genus database with same CATH topology
4X25A 2ACGA 2JKFA 3L9KA 1HLUP 3NULA 4D60A 1VEUB 1PRQA 1FILA 3T1RA 1K0KA 3T12B 3KYEA 2PBDP 1ACFA 1A0KA 2V8FA 2PAVP 1PNEA 4FTXA 1G5UA 1SKOB 4FUWA 1J3WA 3T1QB 3CPTB 3LEQA 3DAVA 4QWOA 5EVEA 1VEUA 3CHWP 1D1JA 4X1MA 3MSHA 1CF0A 3T1XA 1YPRA 2PRFA 2ZL1B 5FEFA 1SKOA 1SZVA 2HZ5A 5EM0A 1AWIA 2VK3A 4ESPA 5EV0A 3CPTA 3MS6A 2BTFP 1VETB 3NECA 1Z09A 3LGOA 2E8JA 1Y4OA 4X1LA 1FIKA 1CJFA 3T1SA 2ZL1A 2B95A 2V8CA 3L7HA 5FDSA 2JKGA 3D9YA 5EM1A 1PFLA 3U4LP 5FEGA 1CQAA 1VETA 3UB5P 1F2KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X25 A;  2ACG A;  2JKF A;  3L9K A;  1HLU P;  3NUL A;  4D60 A;  1VEU B;  1PRQ A;  1FIL A;  3T1R A;  1K0K A;  3T12 B;  3KYE A;  2PBD P;  1ACF A;  1A0K A;  2V8F A;  2PAV P;  1PNE A;  4FTX A;  1G5U A;  1SKO B;  4FUW A;  1J3W A;  3T1Q B;  3CPT B;  3LEQ A;  3DAV A;  4QWO A;  5EVE A;  1VEU A;  3CHW P;  1D1J A;  4X1M A;  3MSH A;  1CF0 A;  3T1X A;  1YPR A;  2PRF A;  2ZL1 B;  5FEF A;  1SKO A;  1SZV A;  2HZ5 A;  5EM0 A;  1AWI A;  2VK3 A;  4ESP A;  5EV0 A;  3CPT A;  3MS6 A;  2BTF P;  1VET B;  3NEC A;  1Z09 A;  3LGO A;  2E8J A;  1Y4O A;  4X1L A;  1FIK A;  1CJF A;  3T1S A;  2ZL1 A;  2B95 A;  2V8C A;  3L7H A;  5FDS A;  2JKG A;  3D9Y A;  5EM1 A;  1PFL A;  3U4L P;  5FEG A;  1CQA A;  1VET A;  3UB5 P;  1F2K A; 
#chains in the Genus database with same CATH topology
 5FQI A;  3Q7Z A;  1NLY A;  1GCE A;  1Z6F A;  5F1F A;  4WUJ A;  2VEA A;  2Y2P A;  3WS4 A;  2AVX A;  1W79 A;  4IJG A;  2P9V B;  4ZRR A;  3QP1 A;  1HZO A;  5M19 A;  4WZ5 A;  4L9G A;  1LSV A;  2WKP A;  1S4S A;  2EXB A;  2VGJ A;  2HGV A;  3AGD A;  3MF0 A;  4ME4 A;  4P87 A;  1S6R A;  3NOP C;  5FAO A;  1D1J A;  4KQQ A;  3UB7 A;  4ARZ A;  1LSW A;  3EQU A;  4QY6 A;  1P97 A;  2J8Y A;  2PRF A;  2M1C A;  5U47 A;  1K4E A;  1SKO A;  3VP0 A;  2KX6 A;  1IKG A;  1Y28 A;  5L2F A;  4EW7 A;  3DTI A;  4QU3 A;  2HP6 A;  1HD8 A;  1IEL A;  3ZVW A;  5FAS A;  1JWP A;  3HUN A;  1E3U A;  3GR2 A;  4N1X A;  3E0Y A;  4EU0 A;  4U3T A;  3IF6 C;  2OWH A;  3W8K A;  2UV0 E;  3UB8 A;  2W3E A;  5FAT A;  4Q0H A;  5FI7 A;  2MJ6 A;  4UA7 A;  2R78 A;  2HDQ A;  4Y2F A;  3G6O A;  4XT2 B;  1T19 A;  1G28 A;  3D9Y A;  3BYD A;  5L10 A;  2PR5 A;  3SH9 A;  5E43 A;  2PU2 A;  4E3J A;  4LV3 A;  3IHA A;  1FSW A;  2K7S A;  1BLP A;  2GZA A;  2O0Y A;  3B42 A;  5GHY A;  1F2K A;  1F98 A;  5EE8 A;  3QNB A;  3GSG A;  3VP1 A;  1PRQ A;  5EVL A;  1FIL A;  4PM5 A;  1PZP A;  1OJG A;  4C6Y A;  2DNS A;  4FH2 A;  4L0L A;  1I2S A;  4HY8 A;  1GSW A;  4FSF A;  1G5U A;  3EGD C;  2Y91 A;  1IYQ A;  4LEN A;  4ZTK A;  2OWJ A;  4KQO A;  5EFW A;  5GLD A;  3BQ8 A;  2QYB A;  3WS1 A;  4DRT A;  4JKT A;  1DJB A;  2Y2Q A;  5IT5 A;  1GHM A;  2Y55 A;  3LY3 A;  5FQM A;  4EUZ A;  4WF0 A;  3N8R A;  3UO9 A;  3T1X A;  3LIA A;  3G34 A;  1GHP A;  4NXB A;  1YSQ A;  3MXS A;  1S1Z A;  3UPO A;  4PHT A;  5HAQ A;  4LPZ A;  1Y54 A;  4ZJ2 A;  3OPL A;  3ZNT A;  3E4P A;  4GD8 A;  5DFY A;  2X01 A;  1YLW A;  4DJ2 A;  3FWL A;  3KSG A;  4I3I A;  1OT6 A;  1D7E A;  4JGP A;  4X69 A;  3CLO A;  3NJA A;  4X1L A;  4ZDX A;  3QNC A;  4L9E A;  3T1S A;  4JF4 A;  2ZL1 A;  5AQ7 A;  5F83 A;  5CHU A;  4OPZ A;  2V1A A;  5DFX A;  1M40 A;  2W0N A;  1KOU A;  2M7V A;  4UA9 A;  4HBU A;  4H6J B;  5BOH A;  1PYY A;  2ACG A;  5HSQ A;  5HPI A;  1NJ4 A;  3T4T A;  1H3Q A;  4S2N C;  2JKR M;  3MQ0 A;  2PD8 A;  2Q9N A;  2Y2G A;  2XFT A;  2OV5 A;  2PD7 A;  5DKK A;  2HDR A;  1DJA A;  4JXS A;  5AQA A;  3HUO A;  3PBO A;  4OP5 A;  2VZW A;  4Y0U A;  1ERM A;  5DTK A;  2PR6 A;  4QWO A;  4LV1 A;  2OLV A;  2J7V A;  4CQH A;  1VEU A;  3MJQ A;  1XXM A;  3CHW P;  2BAS A;  3BRM A;  4S2K A;  3N8L A;  1PWC A;  2ZC4 B;  3R7W B;  2VJW A;  4GW9 A;  3I7J A;  1KDS A;  4Y3I A;  2V1Z A;  4MLL A;  4EBP A;  3CI6 A;  3ITA A;  3E2K A;  4ESP A;  1YM1 A;  2VK3 A;  2A2L A;  3MMH A;  2A24 B;  3BWL A;  1MZU A;  4DMZ A;  1K55 C;  3BQA A;  3CZD A;  5JYO A;  5CTM A;  4MDZ A;  2C6W B;  1LL8 A;  1N9L A;  1CI9 A;  3C4P A;  2E8J A;  5F82 A;  1BLS A;  2OOL A;  2ZM2 A;  2A3U A;  1P0Z A;  5CHM A;  3MQO A;  3G30 A;  2EWW A;  1SDN A;  5CGX A;  4DDY A;  1F9I A;  1NYM A;  3K2N A;  3G4P A;  2XEP A;  4EQI A;  5E2G A;  3NI9 A;  3ZG7 B;  1SDE A;  3C38 A;  5E2H A;  5HWT A;  3L9K A;  3BFF A;  2XA7 M;  2QKP A;  1K6S A;  4G3K A;  3HBR A;  3H82 B;  4NXF A;  3Q07 A;  1S67 L;  3T4J A;  3ITB A;  4IUK A;  5CX7 A;  1MWR A;  2FFF B;  4EER A;  2W27 A;  2ZM0 A;  1T1B A;  4IBX A;  4HNB A;  3Q7V B;  3S7P A;  3BEC A;  1YMX A;  2ZM8 A;  5EVI A;  2XA7 S;  1FQG A;  2UWX A;  1MWS A;  4NXG A;  2HDS A;  3MR0 A;  3TOI A;  5G4Z A;  3D4F A;  1ES5 A;  2M7U A;  3JVV A;  1ES4 A;  1XJ3 A;  4JGO A;  4QY5 A;  1L0F A;  4HOI A;  3DW0 A;  3G32 A;  2I9V A;  3CPT A;  4OQI A;  4LV2 A;  3M6B A;  3MZD A;  2R9X A;  4HIA A;  1MWU A;  5KIZ A;  1W5D A;  4CJN A;  1VET B;  2JKT M;  2W3F A;  1YKD A;  2XR0 A;  2Y2O A;  4DE2 A;  3VFH A;  2WKR A;  1GSV A;  3QHY A;  4OQH A;  1V9Z A;  5EUA A;  2Y2H A;  3V67 A;  1ALQ A;  1N4O A;  1XGI A;  1IOU A;  2V8C A;  3O87 A;  4EBN A;  1T1A A;  3SH7 A;  3N8S A;  3H7W A;  1C3B A;  3FYZ A;  4WL9 A;  2XK1 A;  2JKT I;  3UME A;  2JN7 A;  5FI2 A;  3V39 A;  4OOY A;  3MXR A;  2W1T A;  5HAI A;  3ZCZ A;  3VE4 A;  3LIE A;  1N9O A;  1FR6 A;  4BL3 A;  3MZF A;  3IS2 A;  4Y15 A;  3KYE A;  1ZKJ A;  1OT9 A;  2PBD P;  2WAE A;  3OPH A;  1YSP A;  4E6W A;  5EVI D;  2GNX A;  3GRJ A;  1PNE A;  3DTM A;  3UDI A;  2XF3 A;  2ZQC A;  2V2F F;  3K3C A;  3P98 A;  1X0O A;  3N4I A;  3JPU A;  3G2Z A;  1RP5 A;  4LRX C;  1L2S A;  5A91 A;  4XXR A;  1OPX A;  4JLF A;  3VP2 A;  3F1P B;  3MSH A;  2P9V A;  1CF0 A;  4HJ3 A;  2V0W A;  1S4R A;  2ZC5 B;  1YPR A;  1K56 D;  3IWQ A;  4KZB A;  4P6Z M;  4DE3 A;  1ES3 A;  4N1H A;  1OME A;  4Q8I A;  4HP4 A;  1YLY A;  3N6I A;  2L0W A;  1S66 L;  3P01 A;  1CEF A;  2V0U A;  4O8G A;  5J7E A;  4KG5 A;  3ZDJ A;  2XDM A;  5FQJ A;  2ZC6 B;  2C5W B;  2R9W A;  3LFV A;  2Q0O A;  5CGS A;  1ODV A;  2Z2M B;  3H9W A;  4KQD A;  1VM1 A;  3NEC A;  3S22 A;  1DP6 A;  2VV6 A;  3VOL A;  2ZMA A;  1OTD A;  2WGW B;  4P6Z S;  4S2O A;  1CK3 A;  4RYE A;  1RGZ A;  4CLC D;  2ZQA A;  3P7N A;  4KZ7 A;  5CXW A;  4PM6 A;  3UB5 P;  5DVA A;  3BEB A;  2ZC3 B;  2P04 A;  4CLC B;  4B88 A;  3C30 A;  4IVK A;  3TRC A;  1V9Y A;  4MNR A;  4X56 A;  3NOT C;  4F94 A;  3HLB A;  4MEZ A;  4FCF A;  4XT2 A;  4FTX A;  1AXB A;  3MXQ A;  4N92 A;  4G3W A;  3ZVT A;  3PBN A;  4FOF A;  4Q0J A;  3RFB A;  3B33 A;  3BW6 A;  4R0Q A;  1YLT A;  4ZBE A;  3VE3 A;  3MFX A;  1BZA A;  3HJK A;  3UY6 A;  4WZ5 C;  4HH2 A;  1O07 A;  2ZQ9 A;  3A0S A;  2J9O A;  3ZG5 A;  2EFX A;  4PKY A;  3FPW A;  4BD1 A;  4HJ4 A;  4K0W A;  3A3F A;  3UB6 A;  4S2L A;  2QJ7 A;  1WA9 A;  3N7W A;  5A8B A;  1EI5 A;  3LYX A;  3GV9 A;  2VGK A;  4M3K A;  1L0E A;  3BY8 A;  1GSX A;  4EBL A;  3T4S A;  4R38 A;  3IBR A;  2B5R A;  4EWF A;  1QMF A;  3EGX C;  4DDS A;  1ONG A;  3M2J A;  4FH4 A;  2Y2K A;  3HVF A;  1L0D A;  4R3J A;  4OVD A;  4N9L A;  1ZG4 A;  2O9B A;  4QB8 A;  4X68 A;  3IBJ A;  5HWW A;  1XFN A;  3SOI A;  3PBS A;  1O7E A;  3T1R A;  1UWN X;  3A3D A;  1D06 A;  3VOY A;  2B18 A;  3C7U A;  2NUT C;  4S2M A;  4I5S A;  3GVB A;  1H8M A;  4Y0T A;  2WGI A;  4QD4 A;  3E98 A;  4H6J A;  3UN7 A;  2EWV A;  3LEQ A;  1FR1 A;  2ZQ7 A;  1BYW A;  1OTB A;  4YFM A;  3QP6 A;  4IHQ A;  2YKF A;  3KX0 X;  3IXG A;  1ERQ A;  3BJN A;  5HD3 A;  1HVB A;  1IFQ A;  1ZHH B;  4WMC D;  1XX2 A;  2E8I A;  1YLZ A;  4I3J A;  3V3S A;  4BWI A;  3TSG A;  2XGN A;  2J3T C;  1VHM A;  3FZC A;  1STZ A;  5E2E A;  1FOF A;  4DN0 A;  3EWK A;  2FH5 A;  5HL1 A;  3GTC A;  1YT4 A;  3UNW A;  1Z09 A;  2ZQD A;  2NUP C;  3R7W A;  1FIK A;  1JVJ A;  1XP4 A;  5DJU A;  4X53 A;  1H0M A;  5DJT A;  3UE3 A;  3VSK A;  5FSR A;  4HI4 A;  1MKI A;  1K25 A;  4WBG A;  2QPN A;  1EWZ A;  3LIB A;  2PT7 A;  4PKY G;  3V50 A;  2A24 A;  5IHV A;  4Y13 A;  2A49 A;  3SH8 A;  5L09 A;  4LRY C;  5AVF A;  1TDG A;  2K2N A;  3ZGA B;  5HAP A;  4UQI M;  4Y5F A;  3UDX A;  1L0G A;  4O7D A;  2JHE A;  3IF6 B;  2Y2L A;  3S7Q A;  1NZO A;  2B02 A;  3MBZ A;  3PYP A;  1KVL A;  4JF6 A;  4YIN A;  1FCM A;  3IF5 A;  4GNU A;  3IWO A;  4FUW A;  5HPF A;  2QMI A;  2P08 A;  5HDC A;  3IH8 A;  3LID A;  3C4O A;  5HWV A;  1W63 M;  2CMN A;  3DTK A;  4GJ4 A;  2ZBB A;  4JBF A;  3T4K A;  4UQI S;  1WYC A;  3UB9 A;  1G6A A;  1OTE A;  3NBL A;  4E04 A;  1PIO A;  3H82 A;  4WEK A;  2ZOH A;  1TS8 A;  2G2U A;  2J80 A;  3F1O B;  3OZH A;  1H8Y A;  3C7V A;  1BLC A;  1I5Q A;  3CMZ A;  1TDL A;  5EV0 A;  3Q7V A;  1WYB A;  5A93 A;  3C8C A;  3HLE A;  4OKP A;  2J9P A;  1UGU A;  3UPN A;  4OOL A;  4DE1 A;  2P7J A;  4B93 A;  3VP4 A;  1SKF A;  1Y4O A;  2G2W A;  1PWG A;  1CJF A;  3BLM A;  1F5M A;  3HLD A;  4WM9 A;  3IT9 A;  3MZE A;  2L4R A;  2HP5 A;  4GLQ A;  2J3W A;  2JKG A;  4HP9 A;  3BFG A;  3NDE A;  4E3N A;  5TJJ A;  5HDS A;  3G31 A;  3U4L P;  5CHJ A;  3OPP A;  3IHB A;  1VET A;  4QHC A;  2Y2J A;  5HX9 A;  1VB6 A;  2Q9M A;  3T4Q A;  5G4Y A;  3NUL A;  4DF6 A;  4GD6 A;  4UHU A;  1OJ5 A;  1XJ4 A;  4XUX A;  1UWP X;  1KGG A;  4OH0 A;  4PPR A;  5FDH A;  2OAQ 1;  2CC1 A;  1FCO A;  4I38 A;  1E25 A;  4BMW A;  4Q0I A;  5EOE A;  1W63 Q;  1H8Z A;  3AGE A;  1NLZ A;  4ZJ1 A;  4BQM A;  3LR3 A;  4GDN A;  4L9F A;  4BJP A;  4GS9 B;  3VMA A;  4KZ9 A;  4FD8 A;  2O9C A;  4RX3 A;  1LI9 A;  1PZO A;  3A3J A;  3IX3 A;  4IED A;  3PBT A;  4PAU A;  1K54 A;  2PDR A;  1E4D A;  3WS0 A;  3OC2 A;  3OCL A;  3OCN A;  4PM9 A;  5EOO A;  3RH8 B;  3A3E A;  5D3O A;  1JNU A;  1ESI A;  3D3O A;  4PM8 A;  1JTD A;  1S1Y A;  5M18 A;  4S2P A;  3F1P A;  3CG5 A;  1XJ2 A;  4RQ9 A;  1NXY A;  4E3I A;  2WZZ A;  3S4X A;  3CUE A;  4OOM A;  4EV4 A;  4O0P A;  4ZAM A;  2XD5 A;  5TGF A;  5FI6 A;  4LCL A;  3Q1F A;  4Z9Q A;  1XJ6 A;  1YAX A;  3Q82 A;  4BBT A;  1K56 A;  2W3G A;  1L3L A;  2FFY A;  3UE6 A;  3RXX A;  4MBH A;  5CEC A;  4KUO A;  2JKF A;  2WGW A;  3A3I A;  3UE0 A;  1KE0 A;  3ZG8 B;  1FSY A;  3LI9 A;  4EXO A;  4BBU A;  4C75 A;  2XFS A;  3LR0 A;  2HPB A;  3PBR A;  1ESU A;  3T1Q B;  1IYO A;  2GX5 A;  3O5Y A;  1IEM A;  4CLC A;  4KEN B;  2OLU A;  5EPH A;  2WZX A;  1BUL A;  2HF6 A;  3JYI A;  3VV4 A;  4ID4 A;  4OLD A;  2OAP 1;  5AVE A;  5HD5 A;  3ZYT A;  2KDK A;  2Z2L B;  3FKW A;  4OLG A;  3TW8 A;  2WGV A;  4UA6 A;  4U0T A;  1MKM A;  5GLC A;  3IXH A;  2D02 A;  4F3L B;  1TS6 A;  4CLC E;  3IXB A;  5EM0 A;  3ZG9 B;  3OLO A;  2IWB A;  2VGL M;  2Y2M A;  4DXB A;  4JXW A;  2W3D A;  3WWX A;  1M6K A;  3FKV A;  2IA2 A;  3VOZ A;  4C3Q A;  4HQA A;  1S0W A;  1XKZ A;  5L8M A;  4I3A A;  3LGO A;  3LUQ A;  1K57 A;  3RXW A;  2VKS A;  3A0V A;  2RL3 A;  4ETZ A;  3NCK A;  2X02 A;  2XRO A;  5DTS A;  4E3M A;  2VGL S;  4B4Z A;  3OPR A;  4HH3 A;  3C5A A;  4GHI B;  4MCW A;  5GHZ A;  2Z6C A;  4XUZ A;  2YKH A;  4RX2 A;  1G68 A;  1LLB A;  3PTE A;  1IKI A;  5DF8 A;  1OTI A;  3A0R A;  2Y2N A;  1PWD A;  5F5Y A;  5CRF A;  2V9A A;  1SCW A;  1A0K A;  3QP5 A;  2V8F A;  1YLJ A;  4PMA A;  1KGF A;  4I39 A;  5TBM B;  1W7F A;  4K08 A;  3CIT A;  3W4O A;  3U2A A;  4LRZ E;  1P9R A;  4X1M A;  4K0X A;  5FL3 A;  5C5K A;  3HL9 A;  2XH9 A;  5A92 A;  5GL9 A;  4KZ4 A;  3K3D A;  5FEF A;  2EA9 A;  5HZH A;  5HAR A;  3EOI A;  2GJ3 A;  2BTF P;  4ZJ3 A;  3PBQ A;  3BM6 A;  2DMW A;  3GQZ A;  3M2K A;  1HTZ A;  1IYP A;  2ZQ8 A;  3FG8 A;  3F1N B;  3WRZ A;  2ZLY A;  3BFE A;  4R4R A;  4O01 A;  5IS1 A;  2XRN A;  4GOG A;  3AGF A;  2H0Y A;  3GDI A;  2WYX A;  1T18 A;  1YQS A;  3LEZ A;  3ICY A;  1BT5 A;  3VFF A;  2W3H A;  4WMC A;  4WZ4 A;  4GZB A;  2JCH A;  5FEG A;  3LIF A;  4WN5 A;  4X25 A;  2QZ6 A;  3ULF A;  5K5B A;  2K31 A;  1J9M A;  4X6T A;  2H10 A;  1NY0 A;  3HLW A;  4LV0 A;  2WK0 A;  2Y2I A;  4M4X A;  4KZ5 A;  3WS5 A;  4YWZ A;  5F6A A;  4E3K A;  3CAX A;  2XLN A;  2Z6D A;  1TS0 A;  4HES A;  4UAA A;  1KE4 A;  2ZMV A;  4K91 A;  5J4E A;  2GDN A;  3V5M A;  2QHK A;  2D01 A;  2HV1 A;  1H5X A;  3S7N A;  4YOF A;  4OQ0 A;  2Y8H A;  1GA9 A;  4H8R A;  1U60 A;  5M1A A;  4NG2 A;  1N9B A;  2WKQ A;  4UEY A;  3IF6 A;  5CTN A;  2EXA A;  1LI0 A;  4E3O A;  1LL9 A;  4KZ6 A;  5AQB A;  4A5R A;  1K4F A;  2EX8 A;  2BLS A;  2ZJ9 A;  3KSH A;  2Y4A A;  5FQ9 A;  4OP8 A;  4EUV A;  3RTY A;  2I72 A;  4B9O A;  1ERO A;  5FAQ A;  2P74 A;  4RA7 A;  1XPB A;  1TVF A;  1IYS A;  2PU4 A;  3T50 A;  1BSG A;  5GHX A;  1K38 A;  3LI8 A;  4R23 A;  3IWI A;  3F1O A;  3UDF A;  4P6B A;  4BEN A;  2HDU A;  2V20 A;  3KYQ A;  3DTE A;  5EM1 A;  5F69 A;  3SZT A;  3C2W A;  4Z1W A;  1NYY A;  3FC7 A;  4E6X A;  1HLU P;  2KLI A;  1TD5 A;  5JYP A;  1DY6 A;  3WS2 A;  1LT0 A;  3PHY A;  3W4Q A;  3UE1 A;  2ZMF A;  4ARZ B;  2HJ9 C;  3E4Q A;  4LCM A;  1N9N A;  2RCX A;  3HRE A;  2JE5 A;  1JTG A;  2Y79 A;  5FAP A;  3SW1 A;  1E3U D;  4R3A A;  3VP3 A;  1SKO B;  4BL2 A;  5I94 A;  4Y0O A;  1BTL A;  4R1G A;  1ES2 A;  2INW A;  2VLG A;  1KDW A;  1MWT A;  3M6H A;  1YLP A;  1JWZ A;  4EEP A;  3NIA A;  4MN5 A;  3P09 A;  3UPP A;  3HLF A;  3BFC A;  3QP4 A;  3QP2 A;  3BLS A;  4S2I A;  5L07 A;  3TG9 A;  1RGY A;  5DF7 A;  5CED A;  5LBR A;  2QJ5 A;  1KVM A;  4DKI A;  4QPR A;  1DRM A;  4GDB A;  5CGW A;  3SS4 A;  1TEM A;  4Y7P A;  3KO6 A;  1YMS A;  2DCF A;  1W8Q A;  4KZ8 A;  1GHI A;  3W2Z A;  3IX4 A;  2OSU A;  4GS9 A;  3BY9 A;  3IQA A;  5I5L A;  1I2W A;  3CJM A;  2HJE A;  1QME A;  3SS5 A;  5HL6 A;  3O88 A;  4OQG A;  4S2N A;  5FDS A;  2J3T D;  2WKH A;  5KZH A;  3R4K A;  4HHD A;  1G6O A;  1MBL A;  3V3R A;  3KSI A;  4DXC A;  5KSC A;  4KZ3 A;  4KG6 A;  3EQV A;  2BG1 A;  3MFD A;  3LR4 A;  4NEE D;  4R4S A;  4DE0 A;  1TF1 A;  4HJ6 A;  5IU1 A;  4WEL A;  2JKR I;  4NK3 A;  3WRT A;  3PAE A;  2PAV P;  2VV7 A;  3LR5 A;  5DF9 A;  4P85 A;  4LGW A;  2H28 A;  4WYY A;  1KGE A;  3DAV A;  4D2O A;  3HJI A;  2PYR A;  3HLG A;  1PW8 A;  4S2J A;  1K55 A;  2O99 A;  3DBA A;  3S1Y A;  4HBT A;  4EES A;  4II7 A;  3NC8 A;  4OPY A;  3CWF A;  3SS3 A;  4R6L A;  4YNR A;  2ZL1 B;  1SZV A;  4GN2 A;  2H0T A;  4JPM A;  2XD1 A;  2LB9 A;  1NZU A;  3MKE A;  1DP9 A;  3PR6 A;  1NWZ A;  3IH9 A;  5CEB A;  5KSH A;  5J3W A;  1CI8 A;  4IUH A;  5MC7 A;  2VA0 A;  3T4O A;  4IVI A;  2X71 A;  2XQZ A;  1K54 C;  4JXG A;  3Q81 A;  3FV7 A;  5HW3 A;  4WLA A;  2PYP A;  2DRW A;  4NKP A;  4F3L A;  2FZ0 A;  3OBF A;  3G35 A;  3ZG0 A;  4X55 A;  5EVI C;  2ZD8 A;  3ZHH A;  3LCE A;  2PHY A;  1SHV A;  4MMN A;  1PFL A;  2QWS A;  4OON A;  5DKL A;  3BFD A;  3CUE C;  1NRJ A;  1PI5 A;  3T4L A;  1KE3 A;  4GCZ A;  4D60 A;  1VEU B;  2V1B A;  3T12 B;  2EX6 A;  3KYZ A;  2JC7 A;  3VSL A;  1ACF A;  3JVU A;  1NRF A;  3EEA A;  5F68 A;  2WUQ A;  2HP9 A;  2LB5 A;  2WAD A;  1LL5 A;  3HCY A;  4GHI A;  4OPQ A;  3UMD A;  4EEU A;  5EVE A;  2VX8 A;  3S7O A;  3IX8 A;  5HFO A;  4JXV A;  1FCN A;  3O86 A;  5CER A;  4Y17 A;  4MN6 A;  3ZNY A;  5DTT A;  5J8X A;  3G2Y A;  3TJZ C;  1OTA A;  1LSX A;  4KG2 A;  2HZ5 A;  1AWI A;  4CLC C;  4GB7 A;  4ETX A;  4MBK A;  3W4P A;  4QJG A;  5TBM A;  2WKI A;  4BBV A;  4E3L A;  1RCJ A;  3LO7 A;  2KOI A;  4RVA A;  5FA7 A;  2EFU A;  3TE8 A;  4R3B A;  1GA0 A;  4KZA A;  1MC0 A;  3GEC A;  4P0M A;  4NXE A;  5EEC A;  4NET A;  5G18 A;  2B95 A;  1BUE A;  2XSS A;  4WEJ A;  3KSF A;  3FPV A;  3HLC A;  4B4X A;  5GLA A;  1EW0 A;  4KUK A;  4LLO B;  1Q2P A;  3PXP A;  2WKE A;  1DP8 A;  3DWZ A;  1CQA A;  4BLM A;  3QP8 A;  1K57 C;  2PBY A;  2Y59 A;  3NDG A;  1CEG A;  2EX9 A;  3F1N A;  5EVI B;  1TS7 A;  1BLH A;  1JWV A;  1K0K A;  2EX2 A;  1LHY A;  1XA1 A;  2G7U A;  5KMW A;  4JF5 A;  4JGQ A;  2WAF A;  3B3X A;  1XA7 A;  1P9W A;  1PW1 A;  5GLB A;  2W1R A;  1MXO A;  4N9K A;  4CPK A;  4GKU A;  5HDD A;  2L1M A;  2JBF A;  3B47 A;  3NHQ A;  3NY4 A;  5TFQ A;  1J3W A;  5E2F A;  4IBR A;  3ISG A;  1MY8 A;  3CPT B;  5AJG A;  3D72 A;  4HEF A;  3LIC A;  3E4O A;  4BD0 A;  1WE4 A;  4MBF A;  4LFU A;  1W8Y A;  1DJC A;  1PI4 A;  3GMW A;  1ZC2 A;  1K6R A;  4OPR A;  4R70 A;  2VV8 A;  5TR7 A;  5AQ9 A;  2IWC A;  1ZG6 A;  4PM7 A;  4AFI A;  3MKF A;  3LY4 A;  1ZTU A;  2IWD A;  3NOU C;  3E2L A;  3H7W B;  4MN7 A;  3MS6 A;  4EQ1 A;  5A90 A;  1XFQ A;  3ZFZ A;  3OOV A;  4EET B;  2O9A A;  2W1T B;  4KQR A;  3O3V A;  3RJU A;  5F1G A;  5FQK A;  1VQQ A;  1T1C A;  1XGJ A;  4G3V A;  3IS2 B;  3EEH A;  1MPL A;  5FQQ A;  3L7H A;  4JGR A;  2ZC7 A;  3HUM A;  1Q2Q A;  1ONH A;  4DJ3 A;  3PAG A;  3IXD A;  3DWK A;  2ZOI A;  2H5S A;  3MQQ A;  4U0X A;  3ZQ5 A; 
#chains in the Genus database with same CATH homology
 4X25 A;  2ACG A;  2JKF A;  3L9K A;  1HLU P;  3NUL A;  4D60 A;  1VEU B;  1PRQ A;  1FIL A;  3T1R A;  1K0K A;  3T12 B;  3KYE A;  2PBD P;  1ACF A;  1A0K A;  2V8F A;  2PAV P;  1PNE A;  4FTX A;  1G5U A;  1SKO B;  4FUW A;  1J3W A;  3T1Q B;  3CPT B;  3LEQ A;  3DAV A;  4QWO A;  5EVE A;  1VEU A;  3CHW P;  1D1J A;  4X1M A;  3MSH A;  1CF0 A;  3T1X A;  1YPR A;  2PRF A;  2ZL1 B;  5FEF A;  1SKO A;  1SZV A;  2HZ5 A;  5EM0 A;  1AWI A;  2VK3 A;  4ESP A;  5EV0 A;  3CPT A;  3MS6 A;  2BTF P;  1VET B;  3NEC A;  1Z09 A;  3LGO A;  2E8J A;  1Y4O A;  4X1L A;  1FIK A;  1CJF A;  3T1S A;  2ZL1 A;  2B95 A;  2V8C A;  3L7H A;  5FDS A;  2JKG A;  3D9Y A;  5EM1 A;  1PFL A;  3U4L P;  5FEG A;  1CQA A;  1VET A;  3UB5 P;  1F2K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...