3T1XA

Mglb r124a e127a monomer
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
134
structure length
134
Chain Sequence
LVLYGAPYERAVEVLEETLRETGARYALLIDRKGFVLAHKEALWAPKPPPLDTLATLVASNAAATQALAKLLGEARFQEEVHQGERMGLYVDEAGEHALLVLVFDETAPLGKVKLHGKAAAAALARIAEEALAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Gliding protein MglB
publication title Structural analysis of the Ras-like G protein MglA and its cognate GAP MglB and implications for bacterial polarity.
pubmed doi rcsb
source organism Thermus thermophilus
total genus 31
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03259 Robl_LC7 Roadblock/LC7 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 3t1xA00
5FDSA 2B95A 3NULA 1VEUA 1FIKA 3T1QB 1FILA 3T12B 2PRFA 4D60A 2JKGA 1CQAA 1CF0A 4FUWA 3T1RA 2JKFA 1PFLA 2V8FA 1K0KA 3NECA 4FTXA 2V8CA 4X1LA 4ESPA 1PNEA 3D9YA 1Z09A 2HZ5A 1AWIA 5EVEA 3L7HA 3DAVA 1D1JA 5EV0A 3T1XA 5FEFA 3U4LP 1F2KA 2PBDP 1HLUP 5FEGA 5EM0A 1SKOA 2ACGA 4X25A 2ZL1A 3MSHA 3LEQA 2E8JA 1ACFA 1PRQA 2BTFP 5EM1A 1VETA 3LGOA 1SKOB 3CPTA 1J3WA 1SZVA 2ZL1B 3UB5P 3CHWP 1G5UA 3T1SA 2PAVP 1VETB 3CPTB 1YPRA 2VK3A 3L9KA 1VEUB 3MS6A 1CJFA 3KYEA 1Y4OA 1A0KA 4X1MA 4QWOA
chains in the Genus database with same CATH superfamily
2JKTI 2B95A 2JN7A 4RA7A 4PM5A 1S4SA 3MKFA 4E3KA 3T1QB 4B93A 1PI5A 4GNUA 4WYYA 2PU2A 4R6LA 1CQAA 1YSPA 2MJ6A 1OTBA 2ZJ9A 5GLCA 5TBMA 3BRMA 4NEED 3CI6A 1VM1A 4E3IA 4EUZA 1I2WA 4JF5A 2HJ9C 1XPBA 2L4RA 4N1HA 1PNEA 1XJ4A 3DW0A 2EWVA 1Z09A 1BULA 2FFFB 3VOLA 2XEPA 3ZG5A 4JGPA 3NY4A 4NKPA 1KVLA 1K56D 3CMZA 4OOMA 1KVMA 5FDHA 3A3JA 4S2LA 3RJUA 5EVIB 3EEAA 4ZJ2A 3Q82A 2ZL1A 4P6ZS 4FSFA 1ES5A 2KX6A 3SH7A 2P9VA 5FAOA 5L09A 3SS3A 1S1YA 4RX2A 3ZNYA 4U0XA 1W8YA 3KSFA 1O07A 3M2JA 5DKLA 3HVFA 3G6OA 3PAGA 2XD5A 2VK3A 2OV5A 5AVEA 1DRMA 1NRFA 3E2KA 3ZCZA 2BG1A 3V39A 2QJ7A 4RYEA 1K38A 3KYQA 4MNRA 1T18A 3OCNA 3ITAA 3V3RA 4OLDA 3QHYA 2EX8A 4YINA 3TRCA 4GD8A 2Y2OA 4N92A 1KDWA 1H5XA 3W4QA 2ZM2A 2GZAA 4ARZA 2Q0OA 2PRFA 2UV0E 5JYOA 4NXBA 1TS0A 1OT9A 3BJNA 3TOIA 2WK0A 4DE3A 3G30A 4GB7A 5KSCA 1FR1A 4LCLA 5KZHA 2ZMVA 3RTYA 3NOTC 4OQIA 3VE4A 3GVBA 2EX9A 3VP4A 3RH8B 1F5MA 4MBFA 2DNSA 4S2IA 1SKFA 3LIEA 1PWGA 1K4FA 2ZQDA 3C7VA 5EECA 2WKQA 4CLCE 4UAAA 1UWPX 3UB8A 5J3WA 1TVFA 3W2ZA 2E8JA 1K54C 5EM1A 4ZDXA 1V9ZA 5I94A 2PYRA 1J3WA 2V2FF 1ES4A 4L0LA 3ZVTA 2Y2KA 4HY8A 3G31A 1BYWA 1K6SA 3ISGA 2R78A 2VV8A 3T4QA 3SS5A 3EGXC 2EXBA 5AQBA 2Y55A 2DRWA 4MBHA 2B18A 1CJFA 5F5YA 3C30A 1BLCA 2JKRI 5E2GA 3BLMA 1XJ2A 4X56A 4UA7A 3ZVWA 2IWBA 4OQHA 3MF0A 3D4FA 4R0QA 4H6JB 4EU0A 1FILA 4F3LB 5TBMB 5CHMA 3K2NA 2ZC4B 4MMNA 1TS8A 1KE0A 2J8YA 1CF0A 3T1RA 3S7OA 4OKPA 3PYPA 5FA7A 1GSWA 3WRZA 2B5RA 1K0KA 2V0WA 3FG8A 5I5LA 3EOIA 2JKTM 3IS2A 2PU4A 4OOLA 2VX8A 1G6OA 4FD8A 2XH9A 4GZBA 4JF6A 4FH4A 1UWNX 3HUNA 2VJWA 2ZMFA 1TF1A 3P01A 4Q8IA 4I3IA 3FC7A 1S67L 1JWZA 4IVIA 1CI9A 1YKDA 3E2LA 2P9VB 4X25A 1FSYA 1ONGA 5AVFA 4PHTA 1L0DA 2INWA 4WL9A 1PRQA 1S66L 4Y0OA 2L0WA 3UMDA 4BD1A 2DMWA 3QNBA 4YNRA 3TE8A 3UB5P 1TS7A 5DVAA 1ONHA 5FATA 3VFFA 3PXPA 2Y79A 3M6BA 4EETB 4LRYC 3OZHA 3HL9A 4WF0A 4WEKA 4OOYA 1OJGA 4G3VA 2X71A 3VOZA 4QWOA 1LLBA 4KG6A 3UE1A 3UN7A 4HH2A 3H9WA 1IKIA 4ARZB 3T4LA 1S6RA 2XFTA 4B4XA 1Q2QA 1F9IA 4DF6A 3JPUA 4H8RA 2XA7S 1RGZA 2Z2MB 3GMWA 1HTZA 2JE5A 4FH2A 2Y4AA 4E04A 1CEGA 5K5BA 1OMEA 3N8SA 3Q7VB 3SH8A 5AJGA 2XSSA 3MQOA 4DXBA 1OJ5A 3LR5A 4KZ8A 3LR4A 2Z2LB 1NWZA 2VA0A 2WGVA 1MWTA 5FSRA 3IF6C 4GDBA 4E3LA 2HP9A 2R9WA 3FKWA 3MBZA 1MZUA 3LY4A 3PBTA 1M40A 1G68A 1T1BA 5TGFA 1X0OA 1SDNA 2EWWA 5FQJA 4EERA 3UB9A 1ES3A 3QP2A 2XDMA 3FZCA 4FOFA 5EFWA 2HDRA 1N9BA 5GHYA 1WYCA 1IELA 1RP5A 1SKOB 3C38A 1YLYA 1LSWA 2JBFA 1XXMA 1LHYA 3O3VA 2W3FA 3GECA 2Y2JA 2EX6A 3QNCA 5F82A 3S1YA 4BD0A 5FQQA 5J7EA 3UPOA 3E4PA 2BLSA 5E2FA 4MCWA 4I38A 4R3JA 5CGSA 1XFNA 2H0YA 5HDDA 2VGKA 3NULA 5HPFA 2OAP1 1LI9A 1STZA 2A49A 2XFSA 2X02A 4JF4A 3IX4A 2A2LA 1LSXA 1XA1A 3DTKA 3F1NA 4S2OA 4R4RA 3N6IA 1FQGA 2O0YA 5FL3A 1XKZA 3IS2B 2EFXA 1W5DA 4NXGA 1K55C 2C6WB 1LL8A 3NECA 2A24B 2W0NA 2JCHA 3FYZA 2ZC3B 3OCLA 4KQDA 1NJ4A 4IJGA 2YKHA 1XP4A 4GKUA 4CQHA 4OONA 3DAVA 4Y13A 4GDNA 3U4LP 3V50A 1PYYA 4LGWA 2K7SA 2ZC7A 3KO6A 4FCFA 2G2WA 3F1PA 4HI4A 5L8MA 1C3BA 4Y7PA 4AFIA 5CECA 1WE4A 5FASA 1K54A 3HUOA 3FKVA 5EPHA 1U60A 4OH0A 3LIDA 3WWXA 2X01A 2HJEA 4ZBEA 3NOUC 5HD3A 1I2SA 4UEYA 3OBFA 2NUTC 4X6TA 1MBLA 1T19A 3UE6A 4DDYA 4P6ZM 4QPRA 3HLGA 4XUXA 2XQZA 1M6KA 1A0KA 3K3CA 4LV2A 4EWFA 3N4IA 3BQAA 1L0FA 1S1ZA 4MLLA 4NXFA 3TG9A 4I39A 4LRXC 4XUZA 4E6XA 3NJAA 3S7NA 1BUEA 4K08A 2AVXA 5HARA 5DTSA 1SHVA 5DF9A 1QMEA 2VV7A 5DF7A 1K56A 2XLNA 3BFEA 2W3EA 3VSKA 4Y0TA 2JHEA 3ULFA 2WKRA 2V8FA 2WKPA 2J80A 4DJ2A 4DXCA 4ZAMA 3LICA 5GHZA 3SH9A 2HDUA 3LR0A 1ZG6A 3FPVA 4ZTKA 4BWIA 2WUQA 1E3UA 4KQQA 3G34A 2H28A 4X53A 4BL2A 4MN6A 2PHYA 5CEBA 3W4PA 2PD7A 1PWCA 3WS4A 3IBJA 4WZ5C 1TDLA 3U2AA 4WM9A 1MKIA 2FZ0A 4XXRA 3E0YA 1IYSA 2G7UA 1KE3A 2J3TC 4BQMA 4GD6A 3A3FA 2Y2NA 1JTDA 3A3DA 1TDGA 1IOUA 1K6RA 3M2KA 4KZ6A 1GHPA 1VQQA 2EA9A 4CJNA 1VB6A 3S4XA 3UE0A 5DTTA 5F69A 1E3UD 4PM7A 4PM9A 4ME4A 4S2KA 3VP1A 1ESUA 2VGLS 5DKKA 1G6AA 4X1MA 2VGJA 5TR7A 5CX7A 4UA9A 4Q0IA 5HWWA 5C5KA 5CHJA 2P74A 4DMZA 4UHUA 2VV6A 3B3XA 4BBUA 1FCNA 5CRFA 1P9RA 4S2MA 2ZC5B 3HLCA 4QJGA 2BASA 4OPQA 3DTIA 4NETA 4WBGA 4GW9A 3VFHA 2XD1A 4G3WA 3I7JA 4Z1WA 3LFVA 3BEBA 4BBTA 4X1LA 4ESPA 2Z6DA 3D9YA 3MFXA 4B9OA 1IKGA 1EW0A 1PWDA 3IF6A 5EVEA 1TEMA 4YFMA 3LIFA 2VKSA 1F2KA 1HLUP 2Y2IA 4IEDA 2XGNA 3F1PB 1YLWA 3VV4A 4O0PA 3RFBA 3DTEA 3MSHA 3ZNTA 1D7EA 3CG5A 1RCJA 2R9XA 2WAEA 4R3AA 1GSVA 4OP5A 2EX2A 1VETA 3BFFA 3IXGA 4GHIA 2KOIA 4K91A 3IXBA 1XJ3A 1BTLA 1YLPA 3LI9A 2QMIA 4KENB 3CHWP 2Y2LA 4P87A 4M3KA 5CGWA 3N8LA 3CAXA 2W27A 4PM8A 3G2ZA 3A0SA 2LB5A 1YMXA 2ZD8A 3QP6A 4LENA 2IA2A 5EUAA 3S7QA 1L2SA 2QWSA 4P0MA 1P9WA 3HJIA 4IBRA 4WLAA 4Y2FA 5FDSA 1IYPA 2NUPC 3R4KA 2Y91A 3T4KA 2XK1A 5IT5A 4NK3A 1EROA 1FOFA 2VZWA 5TJJA 4RQ9A 2ZM8A 1JTGA 4CPKA 1IYOA 3WS0A 3CITA 1PZPA 4HP9A 4O01A 1H8ZA 5CGXA 2OWHA 2IWCA 4Y5FA 4BENA 4EXOA 2PBYA 3VOYA 3MXSA 4LLOB 3C5AA 4JXSA 4MEZA 4OVDA 3UO9A 4HJ3A 3M6HA 5A90A 1K55A 4HP4A 2Y8HA 2OAQ1 3TJZC 4YWZA 2J9PA 4OPRA 4MN7A 1Q2PA 1D1JA 2LB9A 3ZQ5A 2HPBA 2XA7M 1P97A 4OPZA 2K31A 5HWVA 3ZGAB 3A0RA 3PBNA 3IT9A 5HDSA 3NCKA 5HL6A 4HJ6A 1FSWA 4U0TA 3LGOA 3UDFA 3ZHHA 4KUKA 5KIZA 1NZUA 2ZL1B 3IXHA 3CZDA 3A3EA 2PAVP 3E98A 1K57C 1MPLA 1W7FA 4CLCD 4ZRRA 2JC7A 3PTEA 5HL1A 5DJTA 3NI9A 5AQAA 1NZOA 1ZKJA 3O86A 4WEJA 4S2PA 3A0VA 1RGYA 2D01A 3IHBA 2C5WB 3EGDC 4EEUA 2V0UA 4R4SA 3MXQA 4D2OA 2H0TA 1W63Q 4OP8A 1D06A 1YLJA 4JPMA 5CERA 4HNBA 5DF8A 5FI6A 3NBLA 2ZM0A 2GJ3A 4A5RA 2W3HA 2IWDA 5BOHA 4JXVA 4IVKA 3IWIA 4LV1A 1YM1A 4BMWA 3MKEA 5EV0A 3T1XA 3B42A 3JVVA 3LIBA 3CLOA 2GX5A 1OT6A 3FWLA 4XT2A 3WS1A 4GHIB 5EOEA 5KMWA 1N9LA 4R23A 4E6WA 3IWOA 4WMCA 2QYBA 4WZ5A 2M7VA 3CPTA 4GJ4A 3UDXA 1LI0A 3T4TA 1W79A 3KYZA 1VHMA 3K3DA 1LSVA 3A3IA 2WZXA 1N9NA 2WYXA 2Q9NA 4PKYG 1TS6A 1CI8A 3MFDA 2EFUA 2PR6A 1F98A 1YAXA 3CUEC 5GL9A 2ZOHA 1BLSA 3OOVA 3F1OA 3OLOA 3LY3A 1PW1A 5EE8A 1GA0A 5HZHA 4HESA 5HX9A 1Y54A 1FIKA 3NC8A 5CTNA 4P6BA 3UB7A 5IHVA 1GHIA 4HHDA 2I72A 1KGGA 4WMCD 5J8XA 4KZ7A 5A91A 2XROA 3ZYTA 3EWKA 3GRJA 5L07A 1MC0A 3IF5A 1Y28A 3EQUA 2J3TD 1DJCA 2HP6A 1OPXA 2OLVA 3LYXA 2KLIA 1OTEA 1YSQA 5EVIA 3GV9A 2KDKA 1XA7A 1PI4A 4Y15A 2Y2GA 1KGEA 4BBVA 2WKIA 3B47A 4C6YA 5CTMA 3VMAA 5EOOA 3R7WA 4EW7A 1N4OA 2JKRM 4CLCC 3BY8A 4BLMA 3V5MA 1ZG4A 3GTCA 4QD4A 5IS1A 3SZTA 5M18A 2YKFA 1SZVA 3NOPC 1JWPA 1MXOA 4OQ0A 3C7UA 2ZC6B 3AGFA 2M7UA 4Z9QA 3LR3A 3JVUA 2H5SA 1YPRA 1P0ZA 4KZBA 1MKMA 2OOLA 5EVID 2PR5A 4I3AA 1LL5A 2Y2PA 1ODVA 5G4YA 4PAUA 4N1XA 4S2NC 4EUVA 3QP1A 1HVBA 4G3KA 2ZQ8A 4O8GA 3KSHA 1TD5A 3C4PA 3TSGA 1NYMA 1KGFA 4S2JA 2I9VA 4EQIA 3UMEA 5IU1A 1T1AA 1PFLA 4OPYA 4HH3A 4I5SA 5FI7A 1NXYA 2PYPA 3BY9A 4E3NA 2GNXA 3C2WA 5JYPA 2VGLM 2P08A 4OLGA 5HWTA 4E3JA 3KX0X 4MN5A 4RVAA 3HLBA 4WELA 5M1AA 5CHUA 1LT0A 1OTAA 5AQ7A 4XT2B 4LPZA 2L1MA 3RXXA 2QPNA 1N9OA 2G2UA 2J7VA 2E8IA 1ESIA 3PBSA 3IHAA 2ZQAA 2ZQCA 5HFOA 5HAPA 4R1GA 4PPRA 4X69A 1PIOA 4JBFA 2V1BA 4DDSA 2V1ZA 4HBTA 3F1OB 3T4SA 3PAEA 3S7PA 4IHQA 4ETZA 1MWUA 4GLQA 3G4PA 1NRJA 1K57A 4WUJA 1KE4A 1WA9A 1YMSA 4H6JA 4F3LA 2Q9MA 1W8QA 1XGIA 4DRTA 3BFCA 1ZC2A 1L0GA 4I3JA 4KZ5A 4KQOA 3T50A 4ZJ3A 1JVJA 1DP9A 5GLDA 4LRZE 1GHMA 1O7EA 4JGQA 4B88A 1J9MA 4RX3A 2VLGA 1MWRA 4UQIS 3LEZA 1MWSA 2EXAA 2QZ6A 4Y3IA 3IBRA 4DKIA 1GSXA 2JKFA 5A93A 1BSGA 1H8MA 3F1NB 3MMHA 4HOIA 2CC1A 4KUOA 2D02A 1YT4A 1ES2A 4QHCA 2HGVA 3T4OA 4JKTA 4JXGA 4IUKA 2WZZA 5FEFA 2PDRA 3R7WB 3QP5A 2O99A 3HBRA 1I5QA 2PT7A 1AXBA 4O7DA 5EVIC 3HCYA 5M19A 1ZTUA 3CWFA 1IFQA 3JYIA 5DTKA 3GQZA 1NLZA 4OQGA 3LEQA 5CXWA 1NY0A 3QP8A 4C3QA 1DP6A 3ZG8B 4ETXA 4DE1A 2HP5A 3UE3A 4HQAA 4NG2A 3O87A 3OPLA 1W63M 5L10A 1KDSA 2WGIA 4GCZA 3W4OA 3VP3A 3DWZA 3NDEA 1EWZA 5FQ9A 2WAFA 2ZLYA 4EBPA 3P98A 3SS4A 1JWVA 3Q07A 2HDSA 3KYEA 3LUQA 1Y4OA 2Y59A 3NDGA 5DFXA 3CUEA 1FCOA 5F1FA 3Q7VA 4Q0HA 3HLDA 4QU3A 3BFDA 4HJ4A 2OSUA 4N9LA 5FQKA 3MXRA 5J4EA 3VP0A 5E2HA 2Y2HA 3BWLA 5KSHA 3MR0A 1OTDA 3BFGA 3B33A 2JKGA 3SW1A 3UDIA 3BLSA 4WZ4A 4FUWA 1L3LA 1E25A 2QKPA 3H82A 4QB8A 4ZJ1A 4K0WA 2J9OA 4JXWA 1AWIA 3FV7A 3LIAA 3RXWA 1DY6A 5FAQA 4DE0A 3CJMA 4L9EA 3G32A 1L0EA 4JGOA 3MQQA 3GR2A 4HBUA 4KZAA 1SKOA 2CMNA 3G35A 1KOUA 1UGUA 4YOFA 2HF6A 5FQMA 2BTFP 5G18A 1K25A 3Q81A 4KG5A 4CLCA 4BJPA 3OPRA 1CEFA 2W3GA 1PW8A 5EVLA 1G5UA 3T1SA 1DJAA 1GCEA 1H3QA 3IH8A 3PHYA 1BT5A 4L9FA 2OLUA 4II7A 1H8YA 5GHXA 1YQSA 3L9KA 4R70A 3MS6A 2XR0A 4M4XA 3IQAA 5MC7A 5HAIA 1ERQA 3ZFZA 5CEDA 3GDIA 4IUHA 3V67A 4S2NA 2WGWA 3KSIA 1S0WA 3NIAA 2A24A 4NXEA 3N7WA 4EV4A 5G4ZA 2FFYA 5E2EA 4ID4A 3MJQA 4U3TA 2Z6CA 1IEMA 3T4JA 3WS5A 4DN0A 5L2FA 2WKHA 2O9BA 2V9AA 5E43A 3DBAA 4L9GA 4LV0A 5LBRA 3L7HA 3SOIA 2PD8A 5FAPA 4GS9A 1DJBA 2HV1A 4Y0UA 5EM0A 1OTIA 3E4QA 4EEPA 4HEFA 3IF6B 3DTMA 4DE2A 2H10A 3BW6A 4E3OA 3S22A 2RL3A 3UNWA 4IBXA 3KSGA 2O9CA 4KZ9A 4R3BA 3PBOA 5HSQA 1Z6FA 1VETB 3HREA 2J3WA 1H0MA 5HDCA 4LCMA 1BZAA 1S4RA 2QHKA 3VP2A 1XFQA 3IX3A 1SDEA 1YLZA 3IH9A 2K2NA 2W1TA 2WKEA 3H7WA 3N8RA 5D3OA 5HPIA 1VEUA 4N9KA 3VE3A 3OPPA 4KQRA 2Y2QA 4GN2A 5DJUA 5HD5A 2GDNA 4R38A 3ZG7B 4D60A 5FQIA 1GA9A 1G28A 3H82B 3MZFA 2OWJA 4LFUA 5HAQA 2QJ5A 5F83A 3VSLA 2XF3A 4FTXA 3IX8A 1MY8A 3WRTA 3UY6A 2M1CA 1XX2A 2HZ5A 2V1AA 3EEHA 3P7NA 4MDZA 3O88A 3V3SA 3MQ0A 2XRNA 2PBDP 5FEGA 4PMAA 4X55A 5F1GA 4KZ4A 2RCXA 3BQ8A 3BM6A 2ZMAA 3Q7ZA 3ZDJA 2ZQ9A 3AGEA 4CLCB 4DJ3A 4KG2A 3WS2A 1HZOA 3G2YA 4UA6A 1ACFA 4EESA 3EQVA 4WN5A 3AGDA 4EQ1A 3ZG9B 4K0XA 2FH5A 5F6AA 3HLEA 3LO7A 1XJ6A 4HIAA 1ERMA 4LV3A 3HUMA 5DFYA 1ALQA 2HDQA 3C4OA 4EBLA 5HW3A 4QY5A 5TFQA 3FPWA 3PBRA 3HJKA 3ZG0A 3ICYA 5GLAA 2WGWB 4F94A 3LI8A 5AQ9A 3PBQA 1PZOA 5GLBA 1T1CA 1FR6A 2W3DA 2P04A 5A8BA 3HLWA 4PKYA 1LL9A 3T12B 2Y2MA 3HLFA 3O5YA 5A92A 3BECA 4P85A 3IXDA 2W1RA 1NLYA 3C8CA 3QP4A 1BLPA 5U47A 2V8CA 4B4ZA 1JNUA 2P7JA 3E4OA 1WYBA 3BYDA 1BLHA 1SCWA 1HD8A 5FI2A 3IWQA 4GS9B 4KZ3A 4E3MA 1XGJA 1EI5A 3NHQA 3MZDA 2ZBBA 2B02A 3UB6A 2VEAA 5F68A 2DCFA 1IYQA 3D3OA 3W8KA 4UQIM 2ACGA 3DWKA 4C75A 1V9YA 4MBKA 1DP8A 1QMFA 3D72A 4EBNA 2V20A 4Y17A 1ZHHB 3UPNA 1E4DA 4BL3A 1CK3A 1NYYA 3GSGA 4JGRA 3Q1FA 4X68A 2ZQ7A 3PR6A 4JLFA 4QY6A 3LCEA 3CPTB 3OC2A 1FCMA 4GOGA 2ZOIA 3TW8A 2A3UA 2W1TB 3ITBA 2WADA 3H7WB 3OPHA 3P09A 4Q0JA 3MZEA 1VEUB 2O9AA 1K4EA 1YLTA 4PM6A 3UPPA 2UWXA
chains in the Genus database with same CATH topology
5FDSA 2B95A 3NULA 1VEUA 1FIKA 3T1QB 1FILA 3T12B 2PRFA 4D60A 2JKGA 1CQAA 1CF0A 4FUWA 3T1RA 2JKFA 1PFLA 2V8FA 1K0KA 3NECA 4FTXA 2V8CA 4X1LA 4ESPA 1PNEA 3D9YA 1Z09A 2HZ5A 1AWIA 5EVEA 3L7HA 3DAVA 1D1JA 5EV0A 3T1XA 5FEFA 3U4LP 1F2KA 2PBDP 1HLUP 5FEGA 5EM0A 1SKOA 2ACGA 4X25A 2ZL1A 3MSHA 3LEQA 2E8JA 1ACFA 1PRQA 2BTFP 5EM1A 1VETA 3LGOA 1SKOB 3CPTA 1J3WA 1SZVA 2ZL1B 3UB5P 3CHWP 1G5UA 3T1SA 2PAVP 1VETB 3CPTB 1YPRA 2VK3A 3L9KA 1VEUB 3MS6A 1CJFA 3KYEA 1Y4OA 1A0KA 4X1MA 4QWOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FDS A;  2B95 A;  3NUL A;  1VEU A;  1FIK A;  3T1Q B;  1FIL A;  3T12 B;  2PRF A;  4D60 A;  2JKG A;  1CQA A;  1CF0 A;  4FUW A;  3T1R A;  2JKF A;  1PFL A;  2V8F A;  1K0K A;  3NEC A;  4FTX A;  2V8C A;  4X1L A;  4ESP A;  1PNE A;  3D9Y A;  1Z09 A;  2HZ5 A;  1AWI A;  5EVE A;  3L7H A;  3DAV A;  1D1J A;  5EV0 A;  3T1X A;  5FEF A;  3U4L P;  1F2K A;  2PBD P;  1HLU P;  5FEG A;  5EM0 A;  1SKO A;  2ACG A;  4X25 A;  2ZL1 A;  3MSH A;  3LEQ A;  2E8J A;  1ACF A;  1PRQ A;  2BTF P;  5EM1 A;  1VET A;  3LGO A;  1SKO B;  3CPT A;  1J3W A;  1SZV A;  2ZL1 B;  3UB5 P;  3CHW P;  1G5U A;  3T1S A;  2PAV P;  1VET B;  3CPT B;  1YPR A;  2VK3 A;  3L9K A;  1VEU B;  3MS6 A;  1CJF A;  3KYE A;  1Y4O A;  1A0K A;  4X1M A;  4QWO A; 
#chains in the Genus database with same CATH topology
 2JKT I;  2B95 A;  2JN7 A;  4RA7 A;  4PM5 A;  1S4S A;  3MKF A;  4E3K A;  3T1Q B;  4B93 A;  1PI5 A;  4GNU A;  4WYY A;  2PU2 A;  4R6L A;  1CQA A;  1YSP A;  2MJ6 A;  1OTB A;  2ZJ9 A;  5GLC A;  5TBM A;  3BRM A;  4NEE D;  3CI6 A;  1VM1 A;  4E3I A;  4EUZ A;  1I2W A;  4JF5 A;  2HJ9 C;  1XPB A;  2L4R A;  4N1H A;  1PNE A;  1XJ4 A;  3DW0 A;  2EWV A;  1Z09 A;  1BUL A;  2FFF B;  3VOL A;  2XEP A;  3ZG5 A;  4JGP A;  3NY4 A;  4NKP A;  1KVL A;  1K56 D;  3CMZ A;  4OOM A;  1KVM A;  5FDH A;  3A3J A;  4S2L A;  3RJU A;  5EVI B;  3EEA A;  4ZJ2 A;  3Q82 A;  2ZL1 A;  4P6Z S;  4FSF A;  1ES5 A;  2KX6 A;  3SH7 A;  2P9V A;  5FAO A;  5L09 A;  3SS3 A;  1S1Y A;  4RX2 A;  3ZNY A;  4U0X A;  1W8Y A;  3KSF A;  1O07 A;  3M2J A;  5DKL A;  3HVF A;  3G6O A;  3PAG A;  2XD5 A;  2VK3 A;  2OV5 A;  5AVE A;  1DRM A;  1NRF A;  3E2K A;  3ZCZ A;  2BG1 A;  3V39 A;  2QJ7 A;  4RYE A;  1K38 A;  3KYQ A;  4MNR A;  1T18 A;  3OCN A;  3ITA A;  3V3R A;  4OLD A;  3QHY A;  2EX8 A;  4YIN A;  3TRC A;  4GD8 A;  2Y2O A;  4N92 A;  1KDW A;  1H5X A;  3W4Q A;  2ZM2 A;  2GZA A;  4ARZ A;  2Q0O A;  2PRF A;  2UV0 E;  5JYO A;  4NXB A;  1TS0 A;  1OT9 A;  3BJN A;  3TOI A;  2WK0 A;  4DE3 A;  3G30 A;  4GB7 A;  5KSC A;  1FR1 A;  4LCL A;  5KZH A;  2ZMV A;  3RTY A;  3NOT C;  4OQI A;  3VE4 A;  3GVB A;  2EX9 A;  3VP4 A;  3RH8 B;  1F5M A;  4MBF A;  2DNS A;  4S2I A;  1SKF A;  3LIE A;  1PWG A;  1K4F A;  2ZQD A;  3C7V A;  5EEC A;  2WKQ A;  4CLC E;  4UAA A;  1UWP X;  3UB8 A;  5J3W A;  1TVF A;  3W2Z A;  2E8J A;  1K54 C;  5EM1 A;  4ZDX A;  1V9Z A;  5I94 A;  2PYR A;  1J3W A;  2V2F F;  1ES4 A;  4L0L A;  3ZVT A;  2Y2K A;  4HY8 A;  3G31 A;  1BYW A;  1K6S A;  3ISG A;  2R78 A;  2VV8 A;  3T4Q A;  3SS5 A;  3EGX C;  2EXB A;  5AQB A;  2Y55 A;  2DRW A;  4MBH A;  2B18 A;  1CJF A;  5F5Y A;  3C30 A;  1BLC A;  2JKR I;  5E2G A;  3BLM A;  1XJ2 A;  4X56 A;  4UA7 A;  3ZVW A;  2IWB A;  4OQH A;  3MF0 A;  3D4F A;  4R0Q A;  4H6J B;  4EU0 A;  1FIL A;  4F3L B;  5TBM B;  5CHM A;  3K2N A;  2ZC4 B;  4MMN A;  1TS8 A;  1KE0 A;  2J8Y A;  1CF0 A;  3T1R A;  3S7O A;  4OKP A;  3PYP A;  5FA7 A;  1GSW A;  3WRZ A;  2B5R A;  1K0K A;  2V0W A;  3FG8 A;  5I5L A;  3EOI A;  2JKT M;  3IS2 A;  2PU4 A;  4OOL A;  2VX8 A;  1G6O A;  4FD8 A;  2XH9 A;  4GZB A;  4JF6 A;  4FH4 A;  1UWN X;  3HUN A;  2VJW A;  2ZMF A;  1TF1 A;  3P01 A;  4Q8I A;  4I3I A;  3FC7 A;  1S67 L;  1JWZ A;  4IVI A;  1CI9 A;  1YKD A;  3E2L A;  2P9V B;  4X25 A;  1FSY A;  1ONG A;  5AVF A;  4PHT A;  1L0D A;  2INW A;  4WL9 A;  1PRQ A;  1S66 L;  4Y0O A;  2L0W A;  3UMD A;  4BD1 A;  2DMW A;  3QNB A;  4YNR A;  3TE8 A;  3UB5 P;  1TS7 A;  5DVA A;  1ONH A;  5FAT A;  3VFF A;  3PXP A;  2Y79 A;  3M6B A;  4EET B;  4LRY C;  3OZH A;  3HL9 A;  4WF0 A;  4WEK A;  4OOY A;  1OJG A;  4G3V A;  2X71 A;  3VOZ A;  4QWO A;  1LLB A;  4KG6 A;  3UE1 A;  3UN7 A;  4HH2 A;  3H9W A;  1IKI A;  4ARZ B;  3T4L A;  1S6R A;  2XFT A;  4B4X A;  1Q2Q A;  1F9I A;  4DF6 A;  3JPU A;  4H8R A;  2XA7 S;  1RGZ A;  2Z2M B;  3GMW A;  1HTZ A;  2JE5 A;  4FH2 A;  2Y4A A;  4E04 A;  1CEG A;  5K5B A;  1OME A;  3N8S A;  3Q7V B;  3SH8 A;  5AJG A;  2XSS A;  3MQO A;  4DXB A;  1OJ5 A;  3LR5 A;  4KZ8 A;  3LR4 A;  2Z2L B;  1NWZ A;  2VA0 A;  2WGV A;  1MWT A;  5FSR A;  3IF6 C;  4GDB A;  4E3L A;  2HP9 A;  2R9W A;  3FKW A;  3MBZ A;  1MZU A;  3LY4 A;  3PBT A;  1M40 A;  1G68 A;  1T1B A;  5TGF A;  1X0O A;  1SDN A;  2EWW A;  5FQJ A;  4EER A;  3UB9 A;  1ES3 A;  3QP2 A;  2XDM A;  3FZC A;  4FOF A;  5EFW A;  2HDR A;  1N9B A;  5GHY A;  1WYC A;  1IEL A;  1RP5 A;  1SKO B;  3C38 A;  1YLY A;  1LSW A;  2JBF A;  1XXM A;  1LHY A;  3O3V A;  2W3F A;  3GEC A;  2Y2J A;  2EX6 A;  3QNC A;  5F82 A;  3S1Y A;  4BD0 A;  5FQQ A;  5J7E A;  3UPO A;  3E4P A;  2BLS A;  5E2F A;  4MCW A;  4I38 A;  4R3J A;  5CGS A;  1XFN A;  2H0Y A;  5HDD A;  2VGK A;  3NUL A;  5HPF A;  2OAP 1;  1LI9 A;  1STZ A;  2A49 A;  2XFS A;  2X02 A;  4JF4 A;  3IX4 A;  2A2L A;  1LSX A;  1XA1 A;  3DTK A;  3F1N A;  4S2O A;  4R4R A;  3N6I A;  1FQG A;  2O0Y A;  5FL3 A;  1XKZ A;  3IS2 B;  2EFX A;  1W5D A;  4NXG A;  1K55 C;  2C6W B;  1LL8 A;  3NEC A;  2A24 B;  2W0N A;  2JCH A;  3FYZ A;  2ZC3 B;  3OCL A;  4KQD A;  1NJ4 A;  4IJG A;  2YKH A;  1XP4 A;  4GKU A;  4CQH A;  4OON A;  3DAV A;  4Y13 A;  4GDN A;  3U4L P;  3V50 A;  1PYY A;  4LGW A;  2K7S A;  2ZC7 A;  3KO6 A;  4FCF A;  2G2W A;  3F1P A;  4HI4 A;  5L8M A;  1C3B A;  4Y7P A;  4AFI A;  5CEC A;  1WE4 A;  5FAS A;  1K54 A;  3HUO A;  3FKV A;  5EPH A;  1U60 A;  4OH0 A;  3LID A;  3WWX A;  2X01 A;  2HJE A;  4ZBE A;  3NOU C;  5HD3 A;  1I2S A;  4UEY A;  3OBF A;  2NUT C;  4X6T A;  1MBL A;  1T19 A;  3UE6 A;  4DDY A;  4P6Z M;  4QPR A;  3HLG A;  4XUX A;  2XQZ A;  1M6K A;  1A0K A;  3K3C A;  4LV2 A;  4EWF A;  3N4I A;  3BQA A;  1L0F A;  1S1Z A;  4MLL A;  4NXF A;  3TG9 A;  4I39 A;  4LRX C;  4XUZ A;  4E6X A;  3NJA A;  3S7N A;  1BUE A;  4K08 A;  2AVX A;  5HAR A;  5DTS A;  1SHV A;  5DF9 A;  1QME A;  2VV7 A;  5DF7 A;  1K56 A;  2XLN A;  3BFE A;  2W3E A;  3VSK A;  4Y0T A;  2JHE A;  3ULF A;  2WKR A;  2V8F A;  2WKP A;  2J80 A;  4DJ2 A;  4DXC A;  4ZAM A;  3LIC A;  5GHZ A;  3SH9 A;  2HDU A;  3LR0 A;  1ZG6 A;  3FPV A;  4ZTK A;  4BWI A;  2WUQ A;  1E3U A;  4KQQ A;  3G34 A;  2H28 A;  4X53 A;  4BL2 A;  4MN6 A;  2PHY A;  5CEB A;  3W4P A;  2PD7 A;  1PWC A;  3WS4 A;  3IBJ A;  4WZ5 C;  1TDL A;  3U2A A;  4WM9 A;  1MKI A;  2FZ0 A;  4XXR A;  3E0Y A;  1IYS A;  2G7U A;  1KE3 A;  2J3T C;  4BQM A;  4GD6 A;  3A3F A;  2Y2N A;  1JTD A;  3A3D A;  1TDG A;  1IOU A;  1K6R A;  3M2K A;  4KZ6 A;  1GHP A;  1VQQ A;  2EA9 A;  4CJN A;  1VB6 A;  3S4X A;  3UE0 A;  5DTT A;  5F69 A;  1E3U D;  4PM7 A;  4PM9 A;  4ME4 A;  4S2K A;  3VP1 A;  1ESU A;  2VGL S;  5DKK A;  1G6A A;  4X1M A;  2VGJ A;  5TR7 A;  5CX7 A;  4UA9 A;  4Q0I A;  5HWW A;  5C5K A;  5CHJ A;  2P74 A;  4DMZ A;  4UHU A;  2VV6 A;  3B3X A;  4BBU A;  1FCN A;  5CRF A;  1P9R A;  4S2M A;  2ZC5 B;  3HLC A;  4QJG A;  2BAS A;  4OPQ A;  3DTI A;  4NET A;  4WBG A;  4GW9 A;  3VFH A;  2XD1 A;  4G3W A;  3I7J A;  4Z1W A;  3LFV A;  3BEB A;  4BBT A;  4X1L A;  4ESP A;  2Z6D A;  3D9Y A;  3MFX A;  4B9O A;  1IKG A;  1EW0 A;  1PWD A;  3IF6 A;  5EVE A;  1TEM A;  4YFM A;  3LIF A;  2VKS A;  1F2K A;  1HLU P;  2Y2I A;  4IED A;  2XGN A;  3F1P B;  1YLW A;  3VV4 A;  4O0P A;  3RFB A;  3DTE A;  3MSH A;  3ZNT A;  1D7E A;  3CG5 A;  1RCJ A;  2R9X A;  2WAE A;  4R3A A;  1GSV A;  4OP5 A;  2EX2 A;  1VET A;  3BFF A;  3IXG A;  4GHI A;  2KOI A;  4K91 A;  3IXB A;  1XJ3 A;  1BTL A;  1YLP A;  3LI9 A;  2QMI A;  4KEN B;  3CHW P;  2Y2L A;  4P87 A;  4M3K A;  5CGW A;  3N8L A;  3CAX A;  2W27 A;  4PM8 A;  3G2Z A;  3A0S A;  2LB5 A;  1YMX A;  2ZD8 A;  3QP6 A;  4LEN A;  2IA2 A;  5EUA A;  3S7Q A;  1L2S A;  2QWS A;  4P0M A;  1P9W A;  3HJI A;  4IBR A;  4WLA A;  4Y2F A;  5FDS A;  1IYP A;  2NUP C;  3R4K A;  2Y91 A;  3T4K A;  2XK1 A;  5IT5 A;  4NK3 A;  1ERO A;  1FOF A;  2VZW A;  5TJJ A;  4RQ9 A;  2ZM8 A;  1JTG A;  4CPK A;  1IYO A;  3WS0 A;  3CIT A;  1PZP A;  4HP9 A;  4O01 A;  1H8Z A;  5CGX A;  2OWH A;  2IWC A;  4Y5F A;  4BEN A;  4EXO A;  2PBY A;  3VOY A;  3MXS A;  4LLO B;  3C5A A;  4JXS A;  4MEZ A;  4OVD A;  3UO9 A;  4HJ3 A;  3M6H A;  5A90 A;  1K55 A;  4HP4 A;  2Y8H A;  2OAQ 1;  3TJZ C;  4YWZ A;  2J9P A;  4OPR A;  4MN7 A;  1Q2P A;  1D1J A;  2LB9 A;  3ZQ5 A;  2HPB A;  2XA7 M;  1P97 A;  4OPZ A;  2K31 A;  5HWV A;  3ZGA B;  3A0R A;  3PBN A;  3IT9 A;  5HDS A;  3NCK A;  5HL6 A;  4HJ6 A;  1FSW A;  4U0T A;  3LGO A;  3UDF A;  3ZHH A;  4KUK A;  5KIZ A;  1NZU A;  2ZL1 B;  3IXH A;  3CZD A;  3A3E A;  2PAV P;  3E98 A;  1K57 C;  1MPL A;  1W7F A;  4CLC D;  4ZRR A;  2JC7 A;  3PTE A;  5HL1 A;  5DJT A;  3NI9 A;  5AQA A;  1NZO A;  1ZKJ A;  3O86 A;  4WEJ A;  4S2P A;  3A0V A;  1RGY A;  2D01 A;  3IHB A;  2C5W B;  3EGD C;  4EEU A;  2V0U A;  4R4S A;  3MXQ A;  4D2O A;  2H0T A;  1W63 Q;  4OP8 A;  1D06 A;  1YLJ A;  4JPM A;  5CER A;  4HNB A;  5DF8 A;  5FI6 A;  3NBL A;  2ZM0 A;  2GJ3 A;  4A5R A;  2W3H A;  2IWD A;  5BOH A;  4JXV A;  4IVK A;  3IWI A;  4LV1 A;  1YM1 A;  4BMW A;  3MKE A;  5EV0 A;  3T1X A;  3B42 A;  3JVV A;  3LIB A;  3CLO A;  2GX5 A;  1OT6 A;  3FWL A;  4XT2 A;  3WS1 A;  4GHI B;  5EOE A;  5KMW A;  1N9L A;  4R23 A;  4E6W A;  3IWO A;  4WMC A;  2QYB A;  4WZ5 A;  2M7V A;  3CPT A;  4GJ4 A;  3UDX A;  1LI0 A;  3T4T A;  1W79 A;  3KYZ A;  1VHM A;  3K3D A;  1LSV A;  3A3I A;  2WZX A;  1N9N A;  2WYX A;  2Q9N A;  4PKY G;  1TS6 A;  1CI8 A;  3MFD A;  2EFU A;  2PR6 A;  1F98 A;  1YAX A;  3CUE C;  5GL9 A;  2ZOH A;  1BLS A;  3OOV A;  3F1O A;  3OLO A;  3LY3 A;  1PW1 A;  5EE8 A;  1GA0 A;  5HZH A;  4HES A;  5HX9 A;  1Y54 A;  1FIK A;  3NC8 A;  5CTN A;  4P6B A;  3UB7 A;  5IHV A;  1GHI A;  4HHD A;  2I72 A;  1KGG A;  4WMC D;  5J8X A;  4KZ7 A;  5A91 A;  2XRO A;  3ZYT A;  3EWK A;  3GRJ A;  5L07 A;  1MC0 A;  3IF5 A;  1Y28 A;  3EQU A;  2J3T D;  1DJC A;  2HP6 A;  1OPX A;  2OLV A;  3LYX A;  2KLI A;  1OTE A;  1YSQ A;  5EVI A;  3GV9 A;  2KDK A;  1XA7 A;  1PI4 A;  4Y15 A;  2Y2G A;  1KGE A;  4BBV A;  2WKI A;  3B47 A;  4C6Y A;  5CTM A;  3VMA A;  5EOO A;  3R7W A;  4EW7 A;  1N4O A;  2JKR M;  4CLC C;  3BY8 A;  4BLM A;  3V5M A;  1ZG4 A;  3GTC A;  4QD4 A;  5IS1 A;  3SZT A;  5M18 A;  2YKF A;  1SZV A;  3NOP C;  1JWP A;  1MXO A;  4OQ0 A;  3C7U A;  2ZC6 B;  3AGF A;  2M7U A;  4Z9Q A;  3LR3 A;  3JVU A;  2H5S A;  1YPR A;  1P0Z A;  4KZB A;  1MKM A;  2OOL A;  5EVI D;  2PR5 A;  4I3A A;  1LL5 A;  2Y2P A;  1ODV A;  5G4Y A;  4PAU A;  4N1X A;  4S2N C;  4EUV A;  3QP1 A;  1HVB A;  4G3K A;  2ZQ8 A;  4O8G A;  3KSH A;  1TD5 A;  3C4P A;  3TSG A;  1NYM A;  1KGF A;  4S2J A;  2I9V A;  4EQI A;  3UME A;  5IU1 A;  1T1A A;  1PFL A;  4OPY A;  4HH3 A;  4I5S A;  5FI7 A;  1NXY A;  2PYP A;  3BY9 A;  4E3N A;  2GNX A;  3C2W A;  5JYP A;  2VGL M;  2P08 A;  4OLG A;  5HWT A;  4E3J A;  3KX0 X;  4MN5 A;  4RVA A;  3HLB A;  4WEL A;  5M1A A;  5CHU A;  1LT0 A;  1OTA A;  5AQ7 A;  4XT2 B;  4LPZ A;  2L1M A;  3RXX A;  2QPN A;  1N9O A;  2G2U A;  2J7V A;  2E8I A;  1ESI A;  3PBS A;  3IHA A;  2ZQA A;  2ZQC A;  5HFO A;  5HAP A;  4R1G A;  4PPR A;  4X69 A;  1PIO A;  4JBF A;  2V1B A;  4DDS A;  2V1Z A;  4HBT A;  3F1O B;  3T4S A;  3PAE A;  3S7P A;  4IHQ A;  4ETZ A;  1MWU A;  4GLQ A;  3G4P A;  1NRJ A;  1K57 A;  4WUJ A;  1KE4 A;  1WA9 A;  1YMS A;  4H6J A;  4F3L A;  2Q9M A;  1W8Q A;  1XGI A;  4DRT A;  3BFC A;  1ZC2 A;  1L0G A;  4I3J A;  4KZ5 A;  4KQO A;  3T50 A;  4ZJ3 A;  1JVJ A;  1DP9 A;  5GLD A;  4LRZ E;  1GHM A;  1O7E A;  4JGQ A;  4B88 A;  1J9M A;  4RX3 A;  2VLG A;  1MWR A;  4UQI S;  3LEZ A;  1MWS A;  2EXA A;  2QZ6 A;  4Y3I A;  3IBR A;  4DKI A;  1GSX A;  2JKF A;  5A93 A;  1BSG A;  1H8M A;  3F1N B;  3MMH A;  4HOI A;  2CC1 A;  4KUO A;  2D02 A;  1YT4 A;  1ES2 A;  4QHC A;  2HGV A;  3T4O A;  4JKT A;  4JXG A;  4IUK A;  2WZZ A;  5FEF A;  2PDR A;  3R7W B;  3QP5 A;  2O99 A;  3HBR A;  1I5Q A;  2PT7 A;  1AXB A;  4O7D A;  5EVI C;  3HCY A;  5M19 A;  1ZTU A;  3CWF A;  1IFQ A;  3JYI A;  5DTK A;  3GQZ A;  1NLZ A;  4OQG A;  3LEQ A;  5CXW A;  1NY0 A;  3QP8 A;  4C3Q A;  1DP6 A;  3ZG8 B;  4ETX A;  4DE1 A;  2HP5 A;  3UE3 A;  4HQA A;  4NG2 A;  3O87 A;  3OPL A;  1W63 M;  5L10 A;  1KDS A;  2WGI A;  4GCZ A;  3W4O A;  3VP3 A;  3DWZ A;  3NDE A;  1EWZ A;  5FQ9 A;  2WAF A;  2ZLY A;  4EBP A;  3P98 A;  3SS4 A;  1JWV A;  3Q07 A;  2HDS A;  3KYE A;  3LUQ A;  1Y4O A;  2Y59 A;  3NDG A;  5DFX A;  3CUE A;  1FCO A;  5F1F A;  3Q7V A;  4Q0H A;  3HLD A;  4QU3 A;  3BFD A;  4HJ4 A;  2OSU A;  4N9L A;  5FQK A;  3MXR A;  5J4E A;  3VP0 A;  5E2H A;  2Y2H A;  3BWL A;  5KSH A;  3MR0 A;  1OTD A;  3BFG A;  3B33 A;  2JKG A;  3SW1 A;  3UDI A;  3BLS A;  4WZ4 A;  4FUW A;  1L3L A;  1E25 A;  2QKP A;  3H82 A;  4QB8 A;  4ZJ1 A;  4K0W A;  2J9O A;  4JXW A;  1AWI A;  3FV7 A;  3LIA A;  3RXW A;  1DY6 A;  5FAQ A;  4DE0 A;  3CJM A;  4L9E A;  3G32 A;  1L0E A;  4JGO A;  3MQQ A;  3GR2 A;  4HBU A;  4KZA A;  1SKO A;  2CMN A;  3G35 A;  1KOU A;  1UGU A;  4YOF A;  2HF6 A;  5FQM A;  2BTF P;  5G18 A;  1K25 A;  3Q81 A;  4KG5 A;  4CLC A;  4BJP A;  3OPR A;  1CEF A;  2W3G A;  1PW8 A;  5EVL A;  1G5U A;  3T1S A;  1DJA A;  1GCE A;  1H3Q A;  3IH8 A;  3PHY A;  1BT5 A;  4L9F A;  2OLU A;  4II7 A;  1H8Y A;  5GHX A;  1YQS A;  3L9K A;  4R70 A;  3MS6 A;  2XR0 A;  4M4X A;  3IQA A;  5MC7 A;  5HAI A;  1ERQ A;  3ZFZ A;  5CED A;  3GDI A;  4IUH A;  3V67 A;  4S2N A;  2WGW A;  3KSI A;  1S0W A;  3NIA A;  2A24 A;  4NXE A;  3N7W A;  4EV4 A;  5G4Z A;  2FFY A;  5E2E A;  4ID4 A;  3MJQ A;  4U3T A;  2Z6C A;  1IEM A;  3T4J A;  3WS5 A;  4DN0 A;  5L2F A;  2WKH A;  2O9B A;  2V9A A;  5E43 A;  3DBA A;  4L9G A;  4LV0 A;  5LBR A;  3L7H A;  3SOI A;  2PD8 A;  5FAP A;  4GS9 A;  1DJB A;  2HV1 A;  4Y0U A;  5EM0 A;  1OTI A;  3E4Q A;  4EEP A;  4HEF A;  3IF6 B;  3DTM A;  4DE2 A;  2H10 A;  3BW6 A;  4E3O A;  3S22 A;  2RL3 A;  3UNW A;  4IBX A;  3KSG A;  2O9C A;  4KZ9 A;  4R3B A;  3PBO A;  5HSQ A;  1Z6F A;  1VET B;  3HRE A;  2J3W A;  1H0M A;  5HDC A;  4LCM A;  1BZA A;  1S4R A;  2QHK A;  3VP2 A;  1XFQ A;  3IX3 A;  1SDE A;  1YLZ A;  3IH9 A;  2K2N A;  2W1T A;  2WKE A;  3H7W A;  3N8R A;  5D3O A;  5HPI A;  1VEU A;  4N9K A;  3VE3 A;  3OPP A;  4KQR A;  2Y2Q A;  4GN2 A;  5DJU A;  5HD5 A;  2GDN A;  4R38 A;  3ZG7 B;  4D60 A;  5FQI A;  1GA9 A;  1G28 A;  3H82 B;  3MZF A;  2OWJ A;  4LFU A;  5HAQ A;  2QJ5 A;  5F83 A;  3VSL A;  2XF3 A;  4FTX A;  3IX8 A;  1MY8 A;  3WRT A;  3UY6 A;  2M1C A;  1XX2 A;  2HZ5 A;  2V1A A;  3EEH A;  3P7N A;  4MDZ A;  3O88 A;  3V3S A;  3MQ0 A;  2XRN A;  2PBD P;  5FEG A;  4PMA A;  4X55 A;  5F1G A;  4KZ4 A;  2RCX A;  3BQ8 A;  3BM6 A;  2ZMA A;  3Q7Z A;  3ZDJ A;  2ZQ9 A;  3AGE A;  4CLC B;  4DJ3 A;  4KG2 A;  3WS2 A;  1HZO A;  3G2Y A;  4UA6 A;  1ACF A;  4EES A;  3EQV A;  4WN5 A;  3AGD A;  4EQ1 A;  3ZG9 B;  4K0X A;  2FH5 A;  5F6A A;  3HLE A;  3LO7 A;  1XJ6 A;  4HIA A;  1ERM A;  4LV3 A;  3HUM A;  5DFY A;  1ALQ A;  2HDQ A;  3C4O A;  4EBL A;  5HW3 A;  4QY5 A;  5TFQ A;  3FPW A;  3PBR A;  3HJK A;  3ZG0 A;  3ICY A;  5GLA A;  2WGW B;  4F94 A;  3LI8 A;  5AQ9 A;  3PBQ A;  1PZO A;  5GLB A;  1T1C A;  1FR6 A;  2W3D A;  2P04 A;  5A8B A;  3HLW A;  4PKY A;  1LL9 A;  3T12 B;  2Y2M A;  3HLF A;  3O5Y A;  5A92 A;  3BEC A;  4P85 A;  3IXD A;  2W1R A;  1NLY A;  3C8C A;  3QP4 A;  1BLP A;  5U47 A;  2V8C A;  4B4Z A;  1JNU A;  2P7J A;  3E4O A;  1WYB A;  3BYD A;  1BLH A;  1SCW A;  1HD8 A;  5FI2 A;  3IWQ A;  4GS9 B;  4KZ3 A;  4E3M A;  1XGJ A;  1EI5 A;  3NHQ A;  3MZD A;  2ZBB A;  2B02 A;  3UB6 A;  2VEA A;  5F68 A;  2DCF A;  1IYQ A;  3D3O A;  3W8K A;  4UQI M;  2ACG A;  3DWK A;  4C75 A;  1V9Y A;  4MBK A;  1DP8 A;  1QMF A;  3D72 A;  4EBN A;  2V20 A;  4Y17 A;  1ZHH B;  3UPN A;  1E4D A;  4BL3 A;  1CK3 A;  1NYY A;  3GSG A;  4JGR A;  3Q1F A;  4X68 A;  2ZQ7 A;  3PR6 A;  4JLF A;  4QY6 A;  3LCE A;  3CPT B;  3OC2 A;  1FCM A;  4GOG A;  2ZOI A;  3TW8 A;  2A3U A;  2W1T B;  3ITB A;  2WAD A;  3H7W B;  3OPH A;  3P09 A;  4Q0J A;  3MZE A;  1VEU B;  2O9A A;  1K4E A;  1YLT A;  4PM6 A;  3UPP A;  2UWX A; 
#chains in the Genus database with same CATH homology
 5FDS A;  2B95 A;  3NUL A;  1VEU A;  1FIK A;  3T1Q B;  1FIL A;  3T12 B;  2PRF A;  4D60 A;  2JKG A;  1CQA A;  1CF0 A;  4FUW A;  3T1R A;  2JKF A;  1PFL A;  2V8F A;  1K0K A;  3NEC A;  4FTX A;  2V8C A;  4X1L A;  4ESP A;  1PNE A;  3D9Y A;  1Z09 A;  2HZ5 A;  1AWI A;  5EVE A;  3L7H A;  3DAV A;  1D1J A;  5EV0 A;  3T1X A;  5FEF A;  3U4L P;  1F2K A;  2PBD P;  1HLU P;  5FEG A;  5EM0 A;  1SKO A;  2ACG A;  4X25 A;  2ZL1 A;  3MSH A;  3LEQ A;  2E8J A;  1ACF A;  1PRQ A;  2BTF P;  5EM1 A;  1VET A;  3LGO A;  1SKO B;  3CPT A;  1J3W A;  1SZV A;  2ZL1 B;  3UB5 P;  3CHW P;  1G5U A;  3T1S A;  2PAV P;  1VET B;  3CPT B;  1YPR A;  2VK3 A;  3L9K A;  1VEU B;  3MS6 A;  1CJF A;  3KYE A;  1Y4O A;  1A0K A;  4X1M A;  4QWO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...