4ZDXA

Structure of oxa-51 beta-lactamase
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
241
structure length
240
Chain Sequence
SDEKAEKIKNLFNEVHTTGVLVIQQGQTQQSYGNDLARASTEYVPASTFMLNALIGLEHHKATTTEVFKWDGQKRLFPEWEKDMTLGDAMKASAIPVYQDLARRIGLELMSKEVKRVGYGNADIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSPKVQDEVQSMLFIEEKNGNKIYAKSGWGWDVDPQVGWLTGWVVQPQGNIVAFSLNLEMKKGIPSSVRKEITYKSLEQLGIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase
publication title Structural Basis for Enhancement of Carbapenemase Activity in the OXA-51 Family of Class D beta-Lactamases.
pubmed doi rcsb
source organism Acinetobacter baumannii
total genus 76
structure length 240
sequence length 241
ec nomenclature
pdb deposition date 2015-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4zdxA00
2Y2NA 3O86A 1KVMA 4BENA 1DJAA 1Z6FA 1H8ZA 2DNSA 2Y2GA 2Y2JA 3OZHA 2Z2MB 3G4PA 4QD4A 4WEJA 5IHVA 4CPKA 3HLFA 4K0XA 2P9VB 4KENB 1MBLA 4WZ5C 3N7WA 2IWBA 5E2GA 1WYCA 5CEDA 3UPNA 4X68A 4IBXA 3O3VA 2OSUA 1MKIA 1O07A 2EX6A 2V20A 1ES2A 1XXMA 4OOMA 3S1YA 1TDGA 2WKEA 1CK3A 2EFUA 3HREA 2GDNA 1NZOA 3PBQA 4DRTA 2Y2QA 1OMEA 5GHZA 4PM8A 1K57A 5FQQA 1KVLA 3ZG7B 4S2MA 3CJMA 3QHYA 4KZ9A 5CERA 4KZBA 4R3BA 1MWUA 2B5RA 2XR0A 4ZJ2A 1XGIA 4OOYA 2H5SA 5TFQA 4LCMA 4K91A 4FCFA 1E25A 5E2HA 3ZDJA 5GLDA 1K56A 3ZGAB 1H8YA 3O87A 4OLDA 1IEMA 1S0WA 4WM9A 5EPHA 3D4FA 4JPMA 4RVAA 2ZMAA 3V3RA 1MXOA 5FI7A 5FQKA 3IF6A 4N1HA 1FCMA 1XPBA 4S2IA 5HAPA 2H0YA 3BECA 1DJCA 3A3DA 4WZ5A 4YFMA 4YINA 1AXBA 2ZM0A 3HLGA 4DF6A 4Y0TA 4DDYA 4ZAMA 5CRFA 3EQVA 2ZM2A 1KGFA 1J9MA 1O7EA 2C5WB 3A3EA 4WYYA 4X69A 4PM6A 4LV1A 3ZG9B 4C6YA 4DE1A 5F82A 3LY3A 2XLNA 4QHCA 3G32A 4E3OA 3VP1A 1K55C 5KSHA 3BFGA 4OPRA 3OCNA 1GHIA 3N6IA 2ZC6B 4R0QA 4PPRA 5FAOA 4OKPA 2X02A 1FR1A 2UWXA 2XK1A 2E8IA 3A3FA 1HZOA 5F1FA 3GR2A 4Z9QA 3LO7A 3OC2A 4EWFA 5KMWA 1I5QA 5DTSA 1PI5A 4O7DA 2DRWA 1ALQA 4BL2A 1FSYA 3QNBA 3SS3A 2XFTA 5GLBA 3IF5A 2X01A 1IKGA 2WKIA 1L0GA 1LI9A 3BEBA 4UA9A 3G34A 3Q7VB 3VOYA 1FCNA 1W8YA 1YLTA 2OLUA 3G35A 2Y2OA 5JYPA 1KGGA 3PBRA 1K4FA 5EVIB 3GQZA 2P74A 4MBKA 4L0LA 1ZC2A 1LL5A 3IHBA 4R3JA 4N9LA 5EVLA 1PZPA 2XD5A 2Y91A 5FQ9A 1WE4A 3LCEA 1C3BA 1CEGA 1K55A 3ISGA 4OP8A 1K54C 4LCLA 1ONHA 4GZBA 3VP4A 3EQUA 4DE0A 3HLEA 3DWZA 4JXWA 2P9VA 4ID4A 1QMEA 3V5MA 3BFEA 2PBYA 3VOZA 3AGEA 3WS1A 1EI5A 1XX2A 3BYDA 3NC8A 1JWVA 5FQJA 1GHPA 1K25A 4ZJ3A 2ZQ9A 3BRMA 3UPOA 2PU2A 2XF3A 5JYOA 2WADA 1K6SA 4U0TA 1TVFA 1KDWA 3ZHHA 3A3JA 1BT5A 2XGNA 3FKVA 3MKFA 1FOFA 2VGJA 3PTEA 4A5RA 4GDNA 1QMFA 4P85A 4CJNA 1RP5A 2XD1A 3IXBA 3ZVWA 3PBSA 3C4PA 4NK3A 1JTGA 2JC7A 3DTMA 2FFYA 4GN2A 1PWCA 3MFDA 3HLDA 4LENA 1PWGA 1GCEA 1L0EA 2EXBA 3S22A 3HL9A 4OONA 4GD8A 4K0WA 2R9XA 4GB7A 3UDFA 2WYXA 1ES5A 3SS5A 4KZ8A 2WUQA 3P09A 4OQGA 1HD8A 1S6RA 2ZD8A 4BD0A 1EROA 2HP6A 5TGFA 4R4SA 3FWLA 4P0MA 5D3OA 2XQZA 1KE3A 1FCOA 3IXGA 2EX8A 4GD6A 5BOHA 3CZDA 2QPNA 2EXAA 4R23A 5EVIC 5A91A 5I94A 2HDQA 4JF6A 3C7VA 5FDHA 2ZC4B 4PM7A 5FAQA 4RX3A 3A3IA 1ERQA 4N1XA 4EQIA 1BLSA 3PBOA 4WMCA 3VSLA 1JWZA 3SH7A 3UPPA 5KZHA 2A3UA 3GRJA 4KZ4A 2JCHA 3BFDA 4Y0OA 4S2JA 4MEZA 2PU4A 4WZ4A 2WAEA 1GA9A 3UDIA 2I72A 3MZFA 3M6HA 4XUXA 4DXBA 3O88A 5HARA 3HLCA 3UE1A 1KE4A 1NXYA 4GOGA 3MBZA 3SH9A 1E3UA 1I2SA 1Q2PA 1M6KA 3OPPA 1W7FA 4UA7A 3G31A 3PBTA 3GSGA 4M3KA 5TR7A 2IWDA 2A49A 3ZFZA 3W4QA 1BTLA 4KQOA 5EECA 1JWPA 4OOLA 4QY5A 5EOOA 3Q7VA 1NYYA 5CGXA 3RXXA 2ZQDA 3VMAA 3GTCA 5GL9A 1CI8A 1PW8A 1GHMA 5EVIA 4IBRA 3UO9A 4HBUA 2R9WA 3MXRA 5CTMA 4BD1A 5FASA 3Q1FA 2XDMA 2HDRA 3CMZA 5DTTA 1PIOA 1MPLA 3ZCZA 1XGJA 1MWRA 1PYYA 4E3NA 2QZ6A 1DJBA 1PWDA 3AGDA 2WGWB 3SOIA 1FR6A 1SDNA 3FV7A 2X71A 4S2OA 2WKHA 3WRTA 4E6XA 4QJGA 3C4OA 1NYMA 4R4RA 5DTKA 1PI4A 2Y4AA 5E43A 1IYQA 1YT4A 1BLPA 3OCLA 1BZAA 4KG6A 4MNRA 5HAIA 3HVFA 1VQQA 2HPBA 1SCWA 4OPQA 5CXWA 1BUEA 1LHYA 4X6TA 2RL3A 1FSWA 5F83A 1CEFA 4PM5A 4KQQA 1MWSA 2Y2HA 4LV2A 3GVBA 5CGWA 3V50A 2ZQ8A 3UE3A 5HW3A 3NDEA 4RYEA 4E3IA 4KG5A 3UN7A 4BJPA 3BFFA 3WS5A 1M40A 2WAFA 3ITAA 2Q9NA 2EX9A 3Q07A 4R1GA 3Q82A 4FD8A 3M2JA 1ERMA 4GDBA 1K56D 5CGSA 3S4XA 1JTDA 2JBFA 4OP5A 1ZG6A 4X56A 1XA7A 2HP9A 4S2LA 5AQ9A 2FFFB 2C6WB 4KQRA 3M2KA 4MBFA 3Q81A 4X55A 1RGZA 2IWCA 1BULA 3HLBA 1ES3A 1XKZA 1YLPA 4OQHA 2JE5A 3LEZA 4OVDA 5F1GA 4UA6A 2ZQCA 3MZDA 3FYZA 3QNCA 3NY4A 2Y2IA 3ZG8B 5M19A 3M6BA 4KZ3A 4DE3A 2ZC3B 2CC1A 3IT9A 3FKWA 4FH4A 5A93A 4IVKA 3IH9A 2Y55A 4BLMA 1LLBA 1YLZA 4UAAA 3N4IA 5GHYA 3ZG0A 4B88A 3TOIA 3NDGA 4E6WA 2ZLYA 2BG1A 4LV3A 4S2PA 1L2SA 1BSGA 3E2KA 1LL9A 1YM1A 4UHUA 3BLSA 4BL3A 4KZAA 5E2EA 3N8SA 4KZ6A 1VM1A 2Y2KA 4KZ5A 5AQBA 2Y59A 1FQGA 1K54A 3ITBA 3PBNA 5DF8A 4B4ZA 1MWTA 3W8KA 1IYOA 5GLCA 4OPZA 4JKTA 5FI2A 1BLHA 1IYSA 3TG9A 1YMXA 3JYIA 1W79A 3W4PA 4OH0A 3UNWA 1PZOA 3GV9A 3NI9A 4QY6A 4U0XA 4Y7PA 3UDXA 1HVBA 1L0FA 4Q8IA 3HBRA 3AGFA 1SKFA 4GNUA 1TDLA 2EFXA 3E2LA 4JLFA 2OV5A 4DDSA 3FZCA 4X53A 3NIAA 2J7VA 1TEMA 4OLGA 2V1ZA 3VP0A 3RXWA 3C5AA 4JBFA 1RGYA 4S2NC 3VFFA 3IF6C 4EV4A 3WS0A 2H10A 2WGWA 4E3JA 5L2FA 4E3MA 5M18A 4OQ0A 5CTNA 1YLJA 5KSCA 1IELA 3OPRA 5AQAA 4DXCA 3UE0A 1G68A 4N92A 3VP3A 4OPYA 5DVAA 3G2YA 1YQSA 4E3KA 3BFCA 2ZC5B 5HAQA 3MKEA 3OPLA 1NJ4A 4GKUA 4QU3A 3WWXA 1W8QA 1JVJA 1NRFA 3V39A 4OQIA 1MY8A 5FQIA 1H5XA 5CHMA 1K6RA 3BM6A 4WELA 4P87A 3PAGA 1N9BA 1CI9A 2HP5A 5FI6A 3WRZA 3B3XA 1LI0A 3I7JA 5FA7A 3C7UA 3NCKA 1W5DA 5EOEA 2Y2PA 3IWOA 3MXSA 5AQ7A 4BQMA 1U60A 4RX2A 1K4EA 3IH8A 4WEKA 4S2NA 3SS4A 3IXDA 2ZC7A 3N8RA 3HUNA 4EBPA 4KZ7A 4EBNA 2Y2MA 3OPHA 4XXRA 1Y54A 4ZBEA 4C75A 3IWIA 1GA0A 5CEBA 4EBLA 4P6BA 5HL1A 2OLVA 1ES4A 1PW1A 1ESUA 3WS2A 2J8YA 1BLCA 3GMWA 4PMAA 5J8XA 2Z2LB 3PAEA 5A90A 4JXVA 4KG2A 1ONGA 3WS4A 5HX9A 2G2WA 3G2ZA 5DF7A 1IKIA 1NZUA 4DKIA 1YMSA 2RCXA 2XEPA 2XH9A 1DY6A 4WMCD 4JXGA 5EUAA 2V2FF 4NETA 5GHXA 1N4OA 3G30A 1ZG4A 3V3SA 5CHUA 2WK0A 4IVIA 1I2WA 3NBLA 1HTZA 1WYBA 4XUZA 5EE8A 3CG5A 4FSFA 2XFSA 1G6AA 1KGEA 4PM9A 3IQAA 1ESIA 1E3UD 3VFHA 1L0DA 2EX2A 3IF6B 2WGIA 3DWKA 2ZQAA 3DW0A 4JXSA 4S2KA 1NY0A 4ZTKA 5FATA 4ZJ1A 4IEDA 4RA7A 1KE0A 4WBGA 4LV0A 1SDEA 1K38A 4HESA 1XA1A 4H8RA 5FAPA 5GLAA 1IYPA 3N8LA 4U3TA 4B4XA 5FQMA 2WZZA 3ZG5A 4DE2A 3LY4A 5EVID 2BLSA 2J9PA 1SHVA 2J9OA 3P98A 2ZQ7A 4N9KA 2H0TA 4Y0UA 2WZXA 3BLMA 4FH2A 3SH8A 2Q9MA 2WGVA 2DCFA 1Q2QA 5FSRA 4MBHA 5DF9A 2ZJ9A 4C3QA 5CECA 2QMIA 3HUOA 5A92A 4EUZA 3W4OA 1KDSA 1YLWA 5HFOA 3VSKA 4JF4A 2ZM8A 3ZNTA 5U47A 5E2FA 1E4DA 3RJUA 3HUMA 1XP4A 2Y2LA 1YLYA 3ZNYA 3HLWA 4HEFA 3Q7ZA 3IHAA 1K57C 1EWZA 5M1AA 1ZKJA 3VP2A 4ZDXA 3IXHA 2HDUA 1RCJA 4HBTA 4JF5A 4MLLA 3ZVTA 3TSGA 4E3LA 2HDSA 4QB8A 4D2OA 2VGKA 3IWQA 3MZEA 2G2UA 5CHJA 3UY6A 4F94A 5G18A
chains in the Genus database with same CATH superfamily
2Y2NA 1H8ZA 4KQDA 4QD4A 3IX4A 4WEJA 3FPWA 1Y4OA 1OTDA 4K0XA 2P9VB 4KENB 2IWBA 3BWLA 3F1PA 3LR5A 1O07A 3TJZC 3S1YA 3HREA 3PBQA 1OMEA 4S2MA 2B5RA 2XR0A 3T12B 4LCMA 3T4JA 4MCWA 3NHQA 3KSFA 1YKDA 3KSIA 4WM9A 3NECA 2JKGA 4II7A 5FI7A 1DP8A 4S2IA 4LGWA 2H0YA 3BECA 1DJCA 4YFMA 3HLGA 1T1AA 1J9MA 4WL9A 1YSPA 4BBTA 4OPRA 1GHIA 2OAQ1 2ZC6B 3N6IA 4R0QA 5FAOA 2VX8A 1IFQA 4IHQA 2XROA 4EWFA 1N9LA 1P0ZA 3K3CA 2LB5A 2QYBA 3QNBA 3SS3A 1OTBA 2XFTA 2J80A 2V8CA 2X01A 1LI9A 4G3WA 4LRZE 3Q7VB 3JPUA 2OLUA 5EVIB 4MBKA 1ZC2A 3T4LA 1PZPA 2G7UA 2XD5A 2Y91A 1LSVA 1WE4A 1C3BA 3VE3A 3HLEA 4ID4A 2O9BA 2VV7A 2PBYA 3BYDA 5FQJA 4R70A 2XF3A 3F1NA 4Y13A 2UV0E 4U0TA 2O0YA 1KDWA 3FKVA 3PTEA 4L9GA 4GDNA 2XD1A 5L10A 4NK3A 2JC7A 4GN2A 1PWCA 3LIBA 1L0EA 3QP1A 3E4QA 4K0WA 4GB7A 4XT2A 1XFNA 1EROA 2HP6A 2XQZA 1KE3A 4GD6A 3UB7A 2EXAA 4O01A 2JKTM 2KOIA 4HJ6A 2ZC4B 4PM7A 2ZL1B 2BTFP 4RX3A 3A3IA 3VE4A 4EQIA 1T19A 3VSLA 5KZHA 5G4YA 4Y0OA 4MEZA 1P9RA 2VV6A 1GA9A 2Y8HA 2I72A 3M6HA 3O88A 2QJ5A 5EFWA 5HDCA 2W0NA 2A24B 1I2SA 4Y15A 4UA7A 2QKPA 3G31A 3GSGA 4M3KA 4PAUA 2A49A 5EECA 4QY5A 2ZQDA 4IBRA 3MXRA 4GJ4A 5FASA 2XDMA 1MPLA 1DJBA 1PWDA 3MS6A 3SOIA 5F69A 1TS0A 3CAXA 2X71A 4NG2A 2FH5A 4E6XA 3LI9A 1NYMA 4R4RA 1PI4A 3VV4A 3T4TA 1BLPA 1BZAA 3HVFA 4P6ZM 2HPBA 1FIKA 1FSWA 3GVBA 3V50A 3UN7A 3BFFA 2GJ3A 2WAFA 3ITAA 3S7PA 2EX9A 1VETA 2FZ0A 3M2JA 2E8JA 4LFUA 3TRCA 2C6WB 4KQRA 1BULA 3S7NA 4L9FA 4OQHA 4OVDA 5F1GA 3MZDA 4O0PA 3QNCA 4KZ3A 4X1MA 3RTYA 5AJGA 2CC1A 4FH4A 1MKMA 5A93A 3GDIA 2BASA 2Y55A 2W1TB 3NDGA 2BG1A 1L2SA 1BSGA 3E2KA 4HP4A 2V9AA 3EEHA 4KZAA 4IJGA 4DMZA 1F2KA 2Y59A 1K54A 5DF8A 1MWTA 4BBVA 4K08A 5GLCA 4JKTA 3QP6A 3LUQA 1LSXA 4I5SA 1YMXA 3UNWA 1PZOA 4QY6A 4Q8IA 3AGFA 1SKFA 5DKLA 2EFXA 2ZMVA 3E2LA 4HH2A 4X53A 1PRQA 4OLGA 3C5AA 1UGUA 4S2NC 4B9OA 3KSHA 3P7NA 3C38A 5L2FA 4Y5FA 3OPRA 4ESPA 4N92A 4OPYA 3G2YA 4E3KA 2P04A 4QU3A 3E0YA 1PFLA 3DTIA 1NRFA 3H9WA 5CHMA 3PAGA 3WRZA 2J3WA 3B3XA 1LI0A 3NCKA 1OTEA 3DAVA 5DJTA 3MXSA 4JGPA 1LT0A 4S2NA 3IXDA 4HNBA 3L7HA 4EBPA 2Y2MA 3LR0A 3F1PB 2VGLS 4P6BA 1PW1A 1ESUA 5J7EA 5J8XA 2Z2LB 3PAEA 1ONGA 2G2WA 2WKRA 3G2ZA 1IKIA 1DY6A 3KX0X 5EUAA 5HDSA 3G30A 1TD5A 2VLGA 4IVIA 2GX5A 4XUZA 3CG5A 1G6AA 1KGEA 4FUWA 4LRYC 5AVEA 1ESIA 2PRFA 3VFHA 4EETB 4Y3IA 5FATA 1A0KA 4EXOA 1SDEA 4NXEA 1XA1A 4IUHA 3N8LA 2WZZA 3ZG5A 4DE2A 3LY4A 4G3KA 1SHVA 5F5YA 2H0TA 2WZXA 3BLMA 2ZMFA 4C3QA 4QWOA 1CF0A 4HJ3A 5HPIA 4HHDA 4Z1WA 3LR4A 1XP4A 4HEFA 3Q7ZA 3IHAA 2EWWA 3VP2A 4ZDXA 2HDUA 1RCJA 4MLLA 5TJJA 2HDSA 4F94A 3O86A 1KVMA 4BENA 1DJAA 1Z6FA 2Y2GA 3U2AA 1N9NA 5E2GA 1WYCA 3B33A 3UPNA 3CPTA 4NXFA 2CMNA 2PT7A 4OOMA 2WKEA 1CK3A 3CI6A 4DRTA 4B93A 1S4SA 2Y79A 3LGOA 1XGIA 1E25A 2EWVA 5GLDA 3LIEA 4XT2B 4OLDA 1IEMA 5EPHA 4CLCC 2ZMAA 3V3RA 1MXOA 3IF6A 1XPBA 5HAPA 4YINA 2ZM0A 4DF6A 4Y0TA 4ZAMA 4MN6A 2J3TD 1O7EA 4X69A 1ZTUA 3G32A 1XJ4A 3VP1A 1XFQA 4PPRA 5EM0A 2UWXA 2XK1A 2E8IA 3CUEA 3H82A 1OT6A 4HOIA 4Z9QA 3OC2A 3VOLA 1I5QA 4NEED 3JVUA 1PI5A 2DRWA 4EU0A 1FSYA 4WF0A 4FTXA 4CLCA 3K3DA 3BEBA 3G34A 1FCNA 5HL6A 5L09A 3G35A 1KGGA 4R3JA 1P97A 5FQ9A 3LCEA 4OP8A 2VJWA 2V1AA 5G4ZA 3VP4A 4DE0A 1XJ2A 4GS9B 4X25A 3VOZA 1EI5A 2INWA 4UEYA 3NC8A 1K25A 2ZQ9A 2PU2A 5JYOA 1K6SA 3MKFA 1FOFA 2VGJA 4A5RA 3UE6A 5IT5A 3ICYA 4CJNA 4LLOB 3C4PA 1VETB 5A8BA 2D02A 1VHMA 1GCEA 3UB5P 3HL9A 4OONA 2WYXA 1ES5A 3SS5A 4KZ8A 1T18A 2EX8A 5BOHA 3CZDA 2KDKA 4R23A 3GECA 2HDQA 3C7VA 1ERQA 4QPRA 3SH7A 3GRJA 4D60A 3RFBA 3BFDA 3T1QB 2JKRI 2KLIA 5HARA 3HLCA 1KE4A 1NXYA 4ME4A 3MBZA 3ULFA 1E3UA 4UQIS 1Q2PA 1M6KA 1W7FA 2PR5A 3PBTA 1D06A 2IWDA 3G6OA 4KQOA 1JWPA 1CJFA 5EOOA 1NYYA 4PKYG 5CGXA 5EVEA 1ACFA 3VMAA 4HBUA 2R9WA 2XA7M 1W63M 3CMZA 1PIOA 3ZCZA 4YOFA 1CQAA 2QZ6A 4HY8A 1FR6A 3FV7A 4NXGA 4YWZA 2W1RA 4IUKA 3R7WA 5DTKA 1IYQA 1YT4A 1LHYA 4PM5A 5F83A 2Y2HA 4LV2A 5HW3A 3NDEA 4RYEA 4E3IA 4KG5A 2NUPC 4DN0A 1M40A 3Q07A 3Q82A 3BY8A 3KYQA 4GDBA 3OBFA 4HIAA 2FFFB 4X55A 4MBFA 3Q81A 2IWCA 1J3WA 1V9ZA 1XKZA 2AVXA 3E4OA 3NY4A 3ZG8B 4ARZA 2VKSA 3A0VA 3IT9A 3E4PA 1Y28A 1YLZA 3ZG0A 4B88A 1EW0A 3TOIA 4GHIA 4S2PA 4HH3A 1UWPX 4UHUA 3BLSA 4BL3A 4NXBA 2H28A 4WN5A 1FQGA 3W8KA 1IYOA 4JGOA 1BLHA 3UB9A 3UB6A 1W79A 4O8GA 4OH0A 3NI9A 4U0XA 4Y7PA 3UDXA 1W63Q 3NIAA 1TEMA 3NOPC 3VP0A 3RXWA 3WS0A 2WGWA 2QHKA 5M18A 4OQ0A 1YLJA 1F5MA 5KSCA 1IELA 5AQAA 3MQ0A 3UE0A 5DVAA 1V9YA 3MKEA 4GKUA 3V39A 3CWFA 3EWKA 1K6RA 1G5UA 3BM6A 4MMNA 5FI6A 1N9BA 1X0OA 4WUJA 1G6OA 2Q0OA 5AQ7A 3DBAA 3IH8A 5AVFA 3TE8A 4KZ7A 4EBNA 3LIFA 4C75A 5HL1A 1GA0A 4EBLA 4WLAA 2JKRM 3WS2A 3CPTB 2J8YA 5FDSA 3GMWA 4BBUA 4HJ4A 1XJ6A 5A90A 4KG2A 5J3WA 5DF7A 1YMSA 2XEPA 3NOTC 5F6AA 4JXGA 5DFYA 2V2FF 1N4OA 5CHUA 1H0MA 1I2WA 3NBLA 3H7WA 1WYBA 2VK3A 4FSFA 2XFSA 1T1CA 2V0WA 1LL8A 4FOFA 1E3UD 1L0DA 2EX2A 3IF6B 4ZTKA 1NY0A 4IEDA 5FAPA 4I3IA 3UB8A 5GLAA 2BLSA 2J9OA 4N9KA 4Y0UA 3KYEA 4Y17A 5HSQA 2DCFA 1Q2QA 5FSRA 3QP4A 3LR3A 3FPVA 4MBHA 2YKFA 2GNXA 5FL3A 3C30A 2QMIA 3H82B 3B42A 1G28A 3W4OA 1KDSA 5HFOA 3VSKA 2QJ7A 1E4DA 3RJUA 2Y2LA 1YLYA 3NULA 3HLWA 3ZNYA 4CLCB 1K57C 1T1BA 1DP6A 5M1AA 1ZKJA 2PDRA 5F68A 3ZVTA 2B95A 4E3LA 4D2OA 2JN7A 2G2UA 4I3JA 4Q0JA 2R78A 4PKYA 3OZHA 3G4PA 2HJ9C 3LYXA 1MBLA 3N7WA 4X68A 4HI4A 3O3VA 2OSUA 1MKIA 2V20A 1ES2A 3HJKA 2GDNA 1K57A 3ZG7B 4KZ9A 4R3BA 1MWUA 4I3AA 1S67L 3JVVA 4I39A 4JPMA 5FQKA 1FCMA 3A3DA 4MDZA 3A0SA 4DDYA 5CRFA 3EQVA 4EW7A 1KGFA 3CHWP 2C5WB 3ZG9B 4PM6A 4EQ1A 3LY3A 4QHCA 3OCNA 1S1ZA 2X02A 3MMHA 3A3FA 1HZOA 1S4RA 5F1FA 4Q0HA 3LO7A 1FILA 5KMWA 5HPFA 4O7DA 4H6JA 4BL2A 1P9WA 1S1YA 1L0GA 5TBMA 5EV0A 3VOYA 1W8YA 2VV8A 5HDDA 3PBRA 3GQZA 2P74A 3S7QA 4L0LA 2PD8A 3MFXA 4N9LA 1CEGA 2NUTC 4GZBA 3DWZA 1QMEA 3BFEA 3R7WB 3BY9A 3WS1A 2PAVP 1XX2A 3NJAA 5KIZA 3UPOA 2KX6A 4HP9A 1TS7A 1TVFA 1Z09A 2XGNA 3T1SA 4ETXA 1QMFA 1RP5A 1OTIA 3PBSA 3DTMA 2FFYA 3MFDA 3HLDA 5HWWA 4LENA 1PWGA 4F3LA 2W27A 3S22A 5J4EA 3UDFA 3P09A 4OQGA 1JNUA 1S6RA 5TGFA 2V8FA 4R4SA 3FWLA 5D3OA 2B18A 2QPNA 4R6LA 4ARZB 5HD5A 4EEPA 3IX8A 5A91A 5I94A 3F1NB 5FDHA 3E98A 4BMWA 2GZAA 5HWTA 1N9OA 1SKOA 3PBOA 2W3EA 3UPPA 4KZ4A 4CQHA 3PR6A 4GHIB 2PU4A 2WAEA 1K0KA 2L1MA 3MZFA 3EEAA 4GOGA 2L4RA 5TR7A 2XSSA 3ZFZA 3W4QA 4OOLA 3RXXA 1CI8A 1PW8A 1GHMA 3UO9A 5CTMA 3Q1FA 3BW6A 2V1BA 5DTTA 3FG8A 4ZRRA 1MWRA 1PYYA 2WGWB 1SDNA 1GSVA 3TW8A 3WRTA 4QJGA 2PHYA 5HAIA 4MNRA 2Z6CA 2RL3A 1CEFA 4KQQA 1MWSA 2VA0A 3C2WA 1STZA 2W1TA 4R1GA 4FD8A 4EEUA 2MJ6A 1ERMA 1F9IA 5CGSA 1JTDA 3L9KA 4OP5A 1ZG6A 4X56A 4S2LA 5AQ9A 3PYPA 2P7JA 3SW1A 3M2KA 1ES3A 2D01A 2ZQCA 4LRXC 3FC7A 4DE3A 2EA9A 4RQ9A 2ZC3B 4P6ZS 1YSQA 4IVKA 2K7SA 4UAAA 4E6WA 3H7WB 1LL9A 2M1CA 3RH8B 5HWVA 5E2EA 3N8SA 4KZ6A 1S66L 3F1OA 5AQBA 3ITBA 4B4ZA 3PBNA 4ETZA 1IYSA 2ZBBA 5LBRA 3JYIA 4PHTA 1H3QA 1AWIA 1HVBA 2V0UA 4R3AA 3HBRA 4GNUA 4JLFA 2OV5A 1TDLA 3FZCA 2J7VA 3HJIA 1RGYA 1YAXA 2VGLM 4E3JA 4E3MA 1NLZA 5CTNA 1NRJA 2ZC5B 5K5BA 3OPLA 1NJ4A 5HD3A 1DRMA 3T1XA 4OQIA 3ZQ5A 4WELA 4P87A 1CI9A 2HP5A 3EGXC 5FA7A 1W5DA 2A2LA 1TS8A 2B02A 4BQMA 3IWOA 4RX2A 1K4EA 3N8RA 2Z6DA 3OPHA 2QWSA 4ZBEA 3IWIA 1NLYA 1BLCA 3UMDA 5HX9A 2RCXA 4NETA 5GHXA 4GW9A 3V3SA 1ZG4A 3S7OA 3PXPA 2O99A 1HTZA 5EE8A 4GLQA 4PM9A 5DKKA 4EUVA 3IBJA 3IBRA 4JXSA 2WGIA 3DWKA 4ZJ1A 1KE0A 4LV0A 2JKFA 1K38A 4HESA 4H8RA 4U3TA 3SZTA 5FQMA 5L07A 2XRNA 3P98A 2Q9MA 2M7UA 5DF9A 4BWIA 3T4OA 5CECA 5A92A 2PR6A 5C5KA 2OAP1 4EUZA 3EOIA 4JF4A 2ZM8A 4H6JB 1F98A 5IU1A 1XJ3A 2OWJA 4CLCD 3OOVA 1MZUA 5TBMB 3IXHA 4HBTA 4JF5A 4AFIA 4QB8A 2VGKA 3IWQA 5CHJA 3UY6A 3UMEA 3IS2A 2M7VA 2DNSA 2Y2JA 2Z2MB 5IHVA 3QP2A 4CPKA 3HLFA 2VZWA 3EGDC 4WZ5C 5CEDA 1SZVA 2O9AA 2PD7A 4IBXA 1D1JA 2EX6A 3MQQA 2K2NA 4MN5A 1XXMA 1TDGA 2EFUA 3W2ZA 1NZOA 2Y2QA 5GHZA 4PM8A 5FQQA 1KVLA 3CJMA 3QHYA 5CERA 4DJ3A 4KZBA 4ZJ2A 1TF1A 4OOYA 2H5SA 5TFQA 4K91A 4F3LB 4FCFA 5E2HA 3ZDJA 1K56A 3ZGAB 1H8YA 3O87A 1NWZA 1S0WA 3D4FA 4RVAA 4N1HA 4WZ5A 1AXBA 2DMWA 2ZM2A 1HLUP 5IS1A 3A3EA 4C6YA 4WYYA 4LV1A 4DE1A 3BQ8A 5F82A 1ODVA 2XLNA 5MC7A 4E3OA 1SKOB 4CLCE 4R38A 1D7EA 1K55C 5KSHA 3BFGA 2IA2A 4OKPA 1FR1A 2PBDP 3V67A 3GR2A 4GS9A 5DTSA 1ALQA 2ZOHA 5GLBA 3IF5A 3LI8A 1IKGA 2WKIA 5CX7A 1TS6A 4UA9A 2W3DA 1YLTA 2Y2OA 5HZHA 5JYPA 1K4FA 1LL5A 1VEUA 3IHBA 4Y2FA 3OLOA 2HV1A 5EVLA 3ISGA 1K55A 1K54C 4LCLA 1ONHA 2P08A 3EQUA 5DJUA 4JXWA 2P9VA 3D3OA 3V5MA 3LIDA 3MSHA 3AGEA 2J3TC 1JWVA 1GHPA 3C8CA 4ZJ3A 3BRMA 2WADA 3ZHHA 3A3JA 1BT5A 4P85A 3IXBA 3ZVWA 1JTGA 1ZHHB 2EXBA 2PYRA 4UQIM 4GD8A 2R9XA 2WUQA 1HD8A 2ZD8A 4BD0A 2OWHA 4P0MA 3IXGA 1FCOA 5EVIC 3CLOA 3BQAA 4JF6A 5FAQA 1L3LA 4N1XA 1BLSA 2O9CA 4WMCA 1JWZA 2A3UA 1OJGA 5I5LA 2JCHA 4S2JA 4WZ4A 2YKHA 2K31A 3UDIA 2HZ5A 4XUXA 4DXBA 3UE1A 3F1OB 5L8MA 3SH9A 1OJ5A 2LB9A 3A0RA 3OPPA 4E04A 1BTLA 3T50A 3Q7VA 1UWNX 3GTCA 5GL9A 2VEAA 5EVIA 3T1RA 1WA9A 3K2NA 4BD1A 3DTKA 1VB6A 1OT9A 2HDRA 1XGJA 4E3NA 3AGDA 4S2OA 4HQAA 3KYZA 2WKHA 3D72A 3C4OA 2PYPA 5G18A 1YPRA 2Y4AA 5E43A 3OCLA 1OTAA 4KG6A 4L9EA 1VQQA 4JGQA 1SCWA 4OPQA 5CXWA 1BUEA 4X6TA 1OPXA 4Q0IA 3LEQA 5CGWA 2ZQ8A 3UE3A 4BJPA 1DP9A 3WS5A 2Q9NA 1K56D 3S4XA 2JBFA 2XA7S 3PHYA 1XA7A 2HP9A 4YNRA 1RGZA 3HLBA 1YLPA 2JE5A 3LEZA 4UA6A 4GCZA 3QP5A 1MC0A 3FYZA 2Y2IA 5M19A 1GSWA 3M6BA 2ZL1A 3FKWA 3IH9A 5DFXA 4BLMA 1LLBA 3N4IA 5GHYA 3LICA 4M4XA 2ZLYA 4LV3A 3QP8A 2HF6A 3KO6A 5EM1A 1YM1A 1IOUA 1VM1A 2Y2KA 2WKPA 4KZ5A 2WKQA 2A24A 4OPZA 5FI2A 3TG9A 3W4PA 4KUKA 3GV9A 1L0FA 4DDSA 2V1ZA 4JBFA 3D9YA 3VFFA 3MJQA 3IF6C 3CITA 4EV4A 2H10A 4EERA 3P01A 4G3VA 1H8MA 3DTEA 4DXCA 1G68A 2OOLA 3T4SA 3VP3A 5FEFA 1YQSA 3BFCA 5HAQA 3WWXA 1W8QA 1JVJA 3MF0A 4LPZA 1MY8A 3CUEC 3LFVA 3MQOA 3T4KA 5FQIA 1H5XA 3U4LP 3I7JA 3IS2B 3C7UA 3KSGA 3IX3A 5EOEA 2Y2PA 1U60A 4WEKA 3MR0A 3SS4A 2ZC7A 4DJ2A 3HUNA 3HCYA 4XXRA 1Y54A 3MXQA 5CEBA 2OLVA 2ZOIA 1ES4A 1GSXA 4PMAA 4MN7A 4I38A 3T4QA 4JXVA 2W3FA 3WS4A 3O5YA 2L0WA 4X1LA 1NZUA 4DKIA 4WMCD 2XH9A 5FEGA 1BYWA 1LSWA 2WK0A 2HJEA 2ACGA 2W3GA 3IQAA 2ZQAA 3DW0A 4S2KA 3BJNA 3R4KA 4WBGA 4RA7A 2JHEA 1IYPA 4B4XA 5EVID 2J9PA 2ZQ7A 4JGRA 2W3HA 4EESA 4FH2A 3SH8A 2WGVA 1PNEA 2ZJ9A 3HUOA 1YLWA 2JKTI 1KOUA 3ZYTA 4KUOA 3ZNTA 5U47A 5E2FA 3LIAA 3HUMA 1EWZA 3B47A 2I9VA 3TSGA 3NOUC 3MZEA 4NKPA 2HGVA 1VEUB
chains in the Genus database with same CATH topology
2Y2NA 3O86A 1KVMA 4BENA 1DJAA 1Z6FA 1H8ZA 2DNSA 2Y2GA 2Y2JA 3OZHA 2Z2MB 3G4PA 4QD4A 4WEJA 5IHVA 4CPKA 3HLFA 4K0XA 2P9VB 4KENB 1MBLA 4WZ5C 3N7WA 2IWBA 5E2GA 1WYCA 5CEDA 3UPNA 4X68A 4IBXA 3O3VA 2OSUA 1MKIA 1O07A 2EX6A 2V20A 1ES2A 1XXMA 4OOMA 3S1YA 1TDGA 2WKEA 1CK3A 2EFUA 3HREA 2GDNA 1NZOA 3PBQA 4DRTA 2Y2QA 1OMEA 5GHZA 4PM8A 1K57A 5FQQA 1KVLA 3ZG7B 4S2MA 3CJMA 3QHYA 4KZ9A 5CERA 4KZBA 4R3BA 1MWUA 2B5RA 2XR0A 4ZJ2A 1XGIA 4OOYA 2H5SA 5TFQA 4LCMA 4K91A 4FCFA 1E25A 5E2HA 3ZDJA 5GLDA 1K56A 3ZGAB 1H8YA 3O87A 4OLDA 1IEMA 1S0WA 4WM9A 5EPHA 3D4FA 4JPMA 4RVAA 2ZMAA 3V3RA 1MXOA 5FI7A 5FQKA 3IF6A 4N1HA 1FCMA 1XPBA 4S2IA 5HAPA 2H0YA 3BECA 1DJCA 3A3DA 4WZ5A 4YFMA 4YINA 1AXBA 2ZM0A 3HLGA 4DF6A 4Y0TA 4DDYA 4ZAMA 5CRFA 3EQVA 2ZM2A 1KGFA 1J9MA 1O7EA 2C5WB 3A3EA 4WYYA 4X69A 4PM6A 4LV1A 3ZG9B 4C6YA 4DE1A 5F82A 3LY3A 2XLNA 4QHCA 3G32A 4E3OA 3VP1A 1K55C 5KSHA 3BFGA 4OPRA 3OCNA 1GHIA 3N6IA 2ZC6B 4R0QA 4PPRA 5FAOA 4OKPA 2X02A 1FR1A 2UWXA 2XK1A 2E8IA 3A3FA 1HZOA 5F1FA 3GR2A 4Z9QA 3LO7A 3OC2A 4EWFA 5KMWA 1I5QA 5DTSA 1PI5A 4O7DA 2DRWA 1ALQA 4BL2A 1FSYA 3QNBA 3SS3A 2XFTA 5GLBA 3IF5A 2X01A 1IKGA 2WKIA 1L0GA 1LI9A 3BEBA 4UA9A 3G34A 3Q7VB 3VOYA 1FCNA 1W8YA 1YLTA 2OLUA 3G35A 2Y2OA 5JYPA 1KGGA 3PBRA 1K4FA 5EVIB 3GQZA 2P74A 4MBKA 4L0LA 1ZC2A 1LL5A 3IHBA 4R3JA 4N9LA 5EVLA 1PZPA 2XD5A 2Y91A 5FQ9A 1WE4A 3LCEA 1C3BA 1CEGA 1K55A 3ISGA 4OP8A 1K54C 4LCLA 1ONHA 4GZBA 3VP4A 3EQUA 4DE0A 3HLEA 3DWZA 4JXWA 2P9VA 4ID4A 1QMEA 3V5MA 3BFEA 2PBYA 3VOZA 3AGEA 3WS1A 1EI5A 1XX2A 3BYDA 3NC8A 1JWVA 5FQJA 1GHPA 1K25A 4ZJ3A 2ZQ9A 3BRMA 3UPOA 2PU2A 2XF3A 5JYOA 2WADA 1K6SA 4U0TA 1TVFA 1KDWA 3ZHHA 3A3JA 1BT5A 2XGNA 3FKVA 3MKFA 1FOFA 2VGJA 3PTEA 4A5RA 4GDNA 1QMFA 4P85A 4CJNA 1RP5A 2XD1A 3IXBA 3ZVWA 3PBSA 3C4PA 4NK3A 1JTGA 2JC7A 3DTMA 2FFYA 4GN2A 1PWCA 3MFDA 3HLDA 4LENA 1PWGA 1GCEA 1L0EA 2EXBA 3S22A 3HL9A 4OONA 4GD8A 4K0WA 2R9XA 4GB7A 3UDFA 2WYXA 1ES5A 3SS5A 4KZ8A 2WUQA 3P09A 4OQGA 1HD8A 1S6RA 2ZD8A 4BD0A 1EROA 2HP6A 5TGFA 4R4SA 3FWLA 4P0MA 5D3OA 2XQZA 1KE3A 1FCOA 3IXGA 2EX8A 4GD6A 5BOHA 3CZDA 2QPNA 2EXAA 4R23A 5EVIC 5A91A 5I94A 2HDQA 4JF6A 3C7VA 5FDHA 2ZC4B 4PM7A 5FAQA 4RX3A 3A3IA 1ERQA 4N1XA 4EQIA 1BLSA 3PBOA 4WMCA 3VSLA 1JWZA 3SH7A 3UPPA 5KZHA 2A3UA 3GRJA 4KZ4A 2JCHA 3BFDA 4Y0OA 4S2JA 4MEZA 2PU4A 4WZ4A 2WAEA 1GA9A 3UDIA 2I72A 3MZFA 3M6HA 4XUXA 4DXBA 3O88A 5HARA 3HLCA 3UE1A 1KE4A 1NXYA 4GOGA 3MBZA 3SH9A 1E3UA 1I2SA 1Q2PA 1M6KA 3OPPA 1W7FA 4UA7A 3G31A 3PBTA 3GSGA 4M3KA 5TR7A 2IWDA 2A49A 3ZFZA 3W4QA 1BTLA 4KQOA 5EECA 1JWPA 4OOLA 4QY5A 5EOOA 3Q7VA 1NYYA 5CGXA 3RXXA 2ZQDA 3VMAA 3GTCA 5GL9A 1CI8A 1PW8A 1GHMA 5EVIA 4IBRA 3UO9A 4HBUA 2R9WA 3MXRA 5CTMA 4BD1A 5FASA 3Q1FA 2XDMA 2HDRA 3CMZA 5DTTA 1PIOA 1MPLA 3ZCZA 1XGJA 1MWRA 1PYYA 4E3NA 2QZ6A 1DJBA 1PWDA 3AGDA 2WGWB 3SOIA 1FR6A 1SDNA 3FV7A 2X71A 4S2OA 2WKHA 3WRTA 4E6XA 4QJGA 3C4OA 1NYMA 4R4RA 5DTKA 1PI4A 2Y4AA 5E43A 1IYQA 1YT4A 1BLPA 3OCLA 1BZAA 4KG6A 4MNRA 5HAIA 3HVFA 1VQQA 2HPBA 1SCWA 4OPQA 5CXWA 1BUEA 1LHYA 4X6TA 2RL3A 1FSWA 5F83A 1CEFA 4PM5A 4KQQA 1MWSA 2Y2HA 4LV2A 3GVBA 5CGWA 3V50A 2ZQ8A 3UE3A 5HW3A 3NDEA 4RYEA 4E3IA 4KG5A 3UN7A 4BJPA 3BFFA 3WS5A 1M40A 2WAFA 3ITAA 2Q9NA 2EX9A 3Q07A 4R1GA 3Q82A 4FD8A 3M2JA 1ERMA 4GDBA 1K56D 5CGSA 3S4XA 1JTDA 2JBFA 4OP5A 1ZG6A 4X56A 1XA7A 2HP9A 4S2LA 5AQ9A 2FFFB 2C6WB 4KQRA 3M2KA 4MBFA 3Q81A 4X55A 1RGZA 2IWCA 1BULA 3HLBA 1ES3A 1XKZA 1YLPA 4OQHA 2JE5A 3LEZA 4OVDA 5F1GA 4UA6A 2ZQCA 3MZDA 3FYZA 3QNCA 3NY4A 2Y2IA 3ZG8B 5M19A 3M6BA 4KZ3A 4DE3A 2ZC3B 2CC1A 3IT9A 3FKWA 4FH4A 5A93A 4IVKA 3IH9A 2Y55A 4BLMA 1LLBA 1YLZA 4UAAA 3N4IA 5GHYA 3ZG0A 4B88A 3TOIA 3NDGA 4E6WA 2ZLYA 2BG1A 4LV3A 4S2PA 1L2SA 1BSGA 3E2KA 1LL9A 1YM1A 4UHUA 3BLSA 4BL3A 4KZAA 5E2EA 3N8SA 4KZ6A 1VM1A 2Y2KA 4KZ5A 5AQBA 2Y59A 1FQGA 1K54A 3ITBA 3PBNA 5DF8A 4B4ZA 1MWTA 3W8KA 1IYOA 5GLCA 4OPZA 4JKTA 5FI2A 1BLHA 1IYSA 3TG9A 1YMXA 3JYIA 1W79A 3W4PA 4OH0A 3UNWA 1PZOA 3GV9A 3NI9A 4QY6A 4U0XA 4Y7PA 3UDXA 1HVBA 1L0FA 4Q8IA 3HBRA 3AGFA 1SKFA 4GNUA 1TDLA 2EFXA 3E2LA 4JLFA 2OV5A 4DDSA 3FZCA 4X53A 3NIAA 2J7VA 1TEMA 4OLGA 2V1ZA 3VP0A 3RXWA 3C5AA 4JBFA 1RGYA 4S2NC 3VFFA 3IF6C 4EV4A 3WS0A 2H10A 2WGWA 4E3JA 5L2FA 4E3MA 5M18A 4OQ0A 5CTNA 1YLJA 5KSCA 1IELA 3OPRA 5AQAA 4DXCA 3UE0A 1G68A 4N92A 3VP3A 4OPYA 5DVAA 3G2YA 1YQSA 4E3KA 3BFCA 2ZC5B 5HAQA 3MKEA 3OPLA 1NJ4A 4GKUA 4QU3A 3WWXA 1W8QA 1JVJA 1NRFA 3V39A 4OQIA 1MY8A 5FQIA 1H5XA 5CHMA 1K6RA 3BM6A 4WELA 4P87A 3PAGA 1N9BA 1CI9A 2HP5A 5FI6A 3WRZA 3B3XA 1LI0A 3I7JA 5FA7A 3C7UA 3NCKA 1W5DA 5EOEA 2Y2PA 3IWOA 3MXSA 5AQ7A 4BQMA 1U60A 4RX2A 1K4EA 3IH8A 4WEKA 4S2NA 3SS4A 3IXDA 2ZC7A 3N8RA 3HUNA 4EBPA 4KZ7A 4EBNA 2Y2MA 3OPHA 4XXRA 1Y54A 4ZBEA 4C75A 3IWIA 1GA0A 5CEBA 4EBLA 4P6BA 5HL1A 2OLVA 1ES4A 1PW1A 1ESUA 3WS2A 2J8YA 1BLCA 3GMWA 4PMAA 5J8XA 2Z2LB 3PAEA 5A90A 4JXVA 4KG2A 1ONGA 3WS4A 5HX9A 2G2WA 3G2ZA 5DF7A 1IKIA 1NZUA 4DKIA 1YMSA 2RCXA 2XEPA 2XH9A 1DY6A 4WMCD 4JXGA 5EUAA 2V2FF 4NETA 5GHXA 1N4OA 3G30A 1ZG4A 3V3SA 5CHUA 2WK0A 4IVIA 1I2WA 3NBLA 1HTZA 1WYBA 4XUZA 5EE8A 3CG5A 4FSFA 2XFSA 1G6AA 1KGEA 4PM9A 3IQAA 1ESIA 1E3UD 3VFHA 1L0DA 2EX2A 3IF6B 2WGIA 3DWKA 2ZQAA 3DW0A 4JXSA 4S2KA 1NY0A 4ZTKA 5FATA 4ZJ1A 4IEDA 4RA7A 1KE0A 4WBGA 4LV0A 1SDEA 1K38A 4HESA 1XA1A 4H8RA 5FAPA 5GLAA 1IYPA 3N8LA 4U3TA 4B4XA 5FQMA 2WZZA 3ZG5A 4DE2A 3LY4A 5EVID 2BLSA 2J9PA 1SHVA 2J9OA 3P98A 2ZQ7A 4N9KA 2H0TA 4Y0UA 2WZXA 3BLMA 4FH2A 3SH8A 2Q9MA 2WGVA 2DCFA 1Q2QA 5FSRA 4MBHA 5DF9A 2ZJ9A 4C3QA 5CECA 2QMIA 3HUOA 5A92A 4EUZA 3W4OA 1KDSA 1YLWA 5HFOA 3VSKA 4JF4A 2ZM8A 3ZNTA 5U47A 5E2FA 1E4DA 3RJUA 3HUMA 1XP4A 2Y2LA 1YLYA 3ZNYA 3HLWA 4HEFA 3Q7ZA 3IHAA 1K57C 1EWZA 5M1AA 1ZKJA 3VP2A 4ZDXA 3IXHA 2HDUA 1RCJA 4HBTA 4JF5A 4MLLA 3ZVTA 3TSGA 4E3LA 2HDSA 4QB8A 4D2OA 2VGKA 3IWQA 3MZEA 2G2UA 5CHJA 3UY6A 4F94A 5G18A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y2N A;  3O86 A;  1KVM A;  4BEN A;  1DJA A;  1Z6F A;  1H8Z A;  2DNS A;  2Y2G A;  2Y2J A;  3OZH A;  2Z2M B;  3G4P A;  4QD4 A;  4WEJ A;  5IHV A;  4CPK A;  3HLF A;  4K0X A;  2P9V B;  4KEN B;  1MBL A;  4WZ5 C;  3N7W A;  2IWB A;  5E2G A;  1WYC A;  5CED A;  3UPN A;  4X68 A;  4IBX A;  3O3V A;  2OSU A;  1MKI A;  1O07 A;  2EX6 A;  2V20 A;  1ES2 A;  1XXM A;  4OOM A;  3S1Y A;  1TDG A;  2WKE A;  1CK3 A;  2EFU A;  3HRE A;  2GDN A;  1NZO A;  3PBQ A;  4DRT A;  2Y2Q A;  1OME A;  5GHZ A;  4PM8 A;  1K57 A;  5FQQ A;  1KVL A;  3ZG7 B;  4S2M A;  3CJM A;  3QHY A;  4KZ9 A;  5CER A;  4KZB A;  4R3B A;  1MWU A;  2B5R A;  2XR0 A;  4ZJ2 A;  1XGI A;  4OOY A;  2H5S A;  5TFQ A;  4LCM A;  4K91 A;  4FCF A;  1E25 A;  5E2H A;  3ZDJ A;  5GLD A;  1K56 A;  3ZGA B;  1H8Y A;  3O87 A;  4OLD A;  1IEM A;  1S0W A;  4WM9 A;  5EPH A;  3D4F A;  4JPM A;  4RVA A;  2ZMA A;  3V3R A;  1MXO A;  5FI7 A;  5FQK A;  3IF6 A;  4N1H A;  1FCM A;  1XPB A;  4S2I A;  5HAP A;  2H0Y A;  3BEC A;  1DJC A;  3A3D A;  4WZ5 A;  4YFM A;  4YIN A;  1AXB A;  2ZM0 A;  3HLG A;  4DF6 A;  4Y0T A;  4DDY A;  4ZAM A;  5CRF A;  3EQV A;  2ZM2 A;  1KGF A;  1J9M A;  1O7E A;  2C5W B;  3A3E A;  4WYY A;  4X69 A;  4PM6 A;  4LV1 A;  3ZG9 B;  4C6Y A;  4DE1 A;  5F82 A;  3LY3 A;  2XLN A;  4QHC A;  3G32 A;  4E3O A;  3VP1 A;  1K55 C;  5KSH A;  3BFG A;  4OPR A;  3OCN A;  1GHI A;  3N6I A;  2ZC6 B;  4R0Q A;  4PPR A;  5FAO A;  4OKP A;  2X02 A;  1FR1 A;  2UWX A;  2XK1 A;  2E8I A;  3A3F A;  1HZO A;  5F1F A;  3GR2 A;  4Z9Q A;  3LO7 A;  3OC2 A;  4EWF A;  5KMW A;  1I5Q A;  5DTS A;  1PI5 A;  4O7D A;  2DRW A;  1ALQ A;  4BL2 A;  1FSY A;  3QNB A;  3SS3 A;  2XFT A;  5GLB A;  3IF5 A;  2X01 A;  1IKG A;  2WKI A;  1L0G A;  1LI9 A;  3BEB A;  4UA9 A;  3G34 A;  3Q7V B;  3VOY A;  1FCN A;  1W8Y A;  1YLT A;  2OLU A;  3G35 A;  2Y2O A;  5JYP A;  1KGG A;  3PBR A;  1K4F A;  5EVI B;  3GQZ A;  2P74 A;  4MBK A;  4L0L A;  1ZC2 A;  1LL5 A;  3IHB A;  4R3J A;  4N9L A;  5EVL A;  1PZP A;  2XD5 A;  2Y91 A;  5FQ9 A;  1WE4 A;  3LCE A;  1C3B A;  1CEG A;  1K55 A;  3ISG A;  4OP8 A;  1K54 C;  4LCL A;  1ONH A;  4GZB A;  3VP4 A;  3EQU A;  4DE0 A;  3HLE A;  3DWZ A;  4JXW A;  2P9V A;  4ID4 A;  1QME A;  3V5M A;  3BFE A;  2PBY A;  3VOZ A;  3AGE A;  3WS1 A;  1EI5 A;  1XX2 A;  3BYD A;  3NC8 A;  1JWV A;  5FQJ A;  1GHP A;  1K25 A;  4ZJ3 A;  2ZQ9 A;  3BRM A;  3UPO A;  2PU2 A;  2XF3 A;  5JYO A;  2WAD A;  1K6S A;  4U0T A;  1TVF A;  1KDW A;  3ZHH A;  3A3J A;  1BT5 A;  2XGN A;  3FKV A;  3MKF A;  1FOF A;  2VGJ A;  3PTE A;  4A5R A;  4GDN A;  1QMF A;  4P85 A;  4CJN A;  1RP5 A;  2XD1 A;  3IXB A;  3ZVW A;  3PBS A;  3C4P A;  4NK3 A;  1JTG A;  2JC7 A;  3DTM A;  2FFY A;  4GN2 A;  1PWC A;  3MFD A;  3HLD A;  4LEN A;  1PWG A;  1GCE A;  1L0E A;  2EXB A;  3S22 A;  3HL9 A;  4OON A;  4GD8 A;  4K0W A;  2R9X A;  4GB7 A;  3UDF A;  2WYX A;  1ES5 A;  3SS5 A;  4KZ8 A;  2WUQ A;  3P09 A;  4OQG A;  1HD8 A;  1S6R A;  2ZD8 A;  4BD0 A;  1ERO A;  2HP6 A;  5TGF A;  4R4S A;  3FWL A;  4P0M A;  5D3O A;  2XQZ A;  1KE3 A;  1FCO A;  3IXG A;  2EX8 A;  4GD6 A;  5BOH A;  3CZD A;  2QPN A;  2EXA A;  4R23 A;  5EVI C;  5A91 A;  5I94 A;  2HDQ A;  4JF6 A;  3C7V A;  5FDH A;  2ZC4 B;  4PM7 A;  5FAQ A;  4RX3 A;  3A3I A;  1ERQ A;  4N1X A;  4EQI A;  1BLS A;  3PBO A;  4WMC A;  3VSL A;  1JWZ A;  3SH7 A;  3UPP A;  5KZH A;  2A3U A;  3GRJ A;  4KZ4 A;  2JCH A;  3BFD A;  4Y0O A;  4S2J A;  4MEZ A;  2PU4 A;  4WZ4 A;  2WAE A;  1GA9 A;  3UDI A;  2I72 A;  3MZF A;  3M6H A;  4XUX A;  4DXB A;  3O88 A;  5HAR A;  3HLC A;  3UE1 A;  1KE4 A;  1NXY A;  4GOG A;  3MBZ A;  3SH9 A;  1E3U A;  1I2S A;  1Q2P A;  1M6K A;  3OPP A;  1W7F A;  4UA7 A;  3G31 A;  3PBT A;  3GSG A;  4M3K A;  5TR7 A;  2IWD A;  2A49 A;  3ZFZ A;  3W4Q A;  1BTL A;  4KQO A;  5EEC A;  1JWP A;  4OOL A;  4QY5 A;  5EOO A;  3Q7V A;  1NYY A;  5CGX A;  3RXX A;  2ZQD A;  3VMA A;  3GTC A;  5GL9 A;  1CI8 A;  1PW8 A;  1GHM A;  5EVI A;  4IBR A;  3UO9 A;  4HBU A;  2R9W A;  3MXR A;  5CTM A;  4BD1 A;  5FAS A;  3Q1F A;  2XDM A;  2HDR A;  3CMZ A;  5DTT A;  1PIO A;  1MPL A;  3ZCZ A;  1XGJ A;  1MWR A;  1PYY A;  4E3N A;  2QZ6 A;  1DJB A;  1PWD A;  3AGD A;  2WGW B;  3SOI A;  1FR6 A;  1SDN A;  3FV7 A;  2X71 A;  4S2O A;  2WKH A;  3WRT A;  4E6X A;  4QJG A;  3C4O A;  1NYM A;  4R4R A;  5DTK A;  1PI4 A;  2Y4A A;  5E43 A;  1IYQ A;  1YT4 A;  1BLP A;  3OCL A;  1BZA A;  4KG6 A;  4MNR A;  5HAI A;  3HVF A;  1VQQ A;  2HPB A;  1SCW A;  4OPQ A;  5CXW A;  1BUE A;  1LHY A;  4X6T A;  2RL3 A;  1FSW A;  5F83 A;  1CEF A;  4PM5 A;  4KQQ A;  1MWS A;  2Y2H A;  4LV2 A;  3GVB A;  5CGW A;  3V50 A;  2ZQ8 A;  3UE3 A;  5HW3 A;  3NDE A;  4RYE A;  4E3I A;  4KG5 A;  3UN7 A;  4BJP A;  3BFF A;  3WS5 A;  1M40 A;  2WAF A;  3ITA A;  2Q9N A;  2EX9 A;  3Q07 A;  4R1G A;  3Q82 A;  4FD8 A;  3M2J A;  1ERM A;  4GDB A;  1K56 D;  5CGS A;  3S4X A;  1JTD A;  2JBF A;  4OP5 A;  1ZG6 A;  4X56 A;  1XA7 A;  2HP9 A;  4S2L A;  5AQ9 A;  2FFF B;  2C6W B;  4KQR A;  3M2K A;  4MBF A;  3Q81 A;  4X55 A;  1RGZ A;  2IWC A;  1BUL A;  3HLB A;  1ES3 A;  1XKZ A;  1YLP A;  4OQH A;  2JE5 A;  3LEZ A;  4OVD A;  5F1G A;  4UA6 A;  2ZQC A;  3MZD A;  3FYZ A;  3QNC A;  3NY4 A;  2Y2I A;  3ZG8 B;  5M19 A;  3M6B A;  4KZ3 A;  4DE3 A;  2ZC3 B;  2CC1 A;  3IT9 A;  3FKW A;  4FH4 A;  5A93 A;  4IVK A;  3IH9 A;  2Y55 A;  4BLM A;  1LLB A;  1YLZ A;  4UAA A;  3N4I A;  5GHY A;  3ZG0 A;  4B88 A;  3TOI A;  3NDG A;  4E6W A;  2ZLY A;  2BG1 A;  4LV3 A;  4S2P A;  1L2S A;  1BSG A;  3E2K A;  1LL9 A;  1YM1 A;  4UHU A;  3BLS A;  4BL3 A;  4KZA A;  5E2E A;  3N8S A;  4KZ6 A;  1VM1 A;  2Y2K A;  4KZ5 A;  5AQB A;  2Y59 A;  1FQG A;  1K54 A;  3ITB A;  3PBN A;  5DF8 A;  4B4Z A;  1MWT A;  3W8K A;  1IYO A;  5GLC A;  4OPZ A;  4JKT A;  5FI2 A;  1BLH A;  1IYS A;  3TG9 A;  1YMX A;  3JYI A;  1W79 A;  3W4P A;  4OH0 A;  3UNW A;  1PZO A;  3GV9 A;  3NI9 A;  4QY6 A;  4U0X A;  4Y7P A;  3UDX A;  1HVB A;  1L0F A;  4Q8I A;  3HBR A;  3AGF A;  1SKF A;  4GNU A;  1TDL A;  2EFX A;  3E2L A;  4JLF A;  2OV5 A;  4DDS A;  3FZC A;  4X53 A;  3NIA A;  2J7V A;  1TEM A;  4OLG A;  2V1Z A;  3VP0 A;  3RXW A;  3C5A A;  4JBF A;  1RGY A;  4S2N C;  3VFF A;  3IF6 C;  4EV4 A;  3WS0 A;  2H10 A;  2WGW A;  4E3J A;  5L2F A;  4E3M A;  5M18 A;  4OQ0 A;  5CTN A;  1YLJ A;  5KSC A;  1IEL A;  3OPR A;  5AQA A;  4DXC A;  3UE0 A;  1G68 A;  4N92 A;  3VP3 A;  4OPY A;  5DVA A;  3G2Y A;  1YQS A;  4E3K A;  3BFC A;  2ZC5 B;  5HAQ A;  3MKE A;  3OPL A;  1NJ4 A;  4GKU A;  4QU3 A;  3WWX A;  1W8Q A;  1JVJ A;  1NRF A;  3V39 A;  4OQI A;  1MY8 A;  5FQI A;  1H5X A;  5CHM A;  1K6R A;  3BM6 A;  4WEL A;  4P87 A;  3PAG A;  1N9B A;  1CI9 A;  2HP5 A;  5FI6 A;  3WRZ A;  3B3X A;  1LI0 A;  3I7J A;  5FA7 A;  3C7U A;  3NCK A;  1W5D A;  5EOE A;  2Y2P A;  3IWO A;  3MXS A;  5AQ7 A;  4BQM A;  1U60 A;  4RX2 A;  1K4E A;  3IH8 A;  4WEK A;  4S2N A;  3SS4 A;  3IXD A;  2ZC7 A;  3N8R A;  3HUN A;  4EBP A;  4KZ7 A;  4EBN A;  2Y2M A;  3OPH A;  4XXR A;  1Y54 A;  4ZBE A;  4C75 A;  3IWI A;  1GA0 A;  5CEB A;  4EBL A;  4P6B A;  5HL1 A;  2OLV A;  1ES4 A;  1PW1 A;  1ESU A;  3WS2 A;  2J8Y A;  1BLC A;  3GMW A;  4PMA A;  5J8X A;  2Z2L B;  3PAE A;  5A90 A;  4JXV A;  4KG2 A;  1ONG A;  3WS4 A;  5HX9 A;  2G2W A;  3G2Z A;  5DF7 A;  1IKI A;  1NZU A;  4DKI A;  1YMS A;  2RCX A;  2XEP A;  2XH9 A;  1DY6 A;  4WMC D;  4JXG A;  5EUA A;  2V2F F;  4NET A;  5GHX A;  1N4O A;  3G30 A;  1ZG4 A;  3V3S A;  5CHU A;  2WK0 A;  4IVI A;  1I2W A;  3NBL A;  1HTZ A;  1WYB A;  4XUZ A;  5EE8 A;  3CG5 A;  4FSF A;  2XFS A;  1G6A A;  1KGE A;  4PM9 A;  3IQA A;  1ESI A;  1E3U D;  3VFH A;  1L0D A;  2EX2 A;  3IF6 B;  2WGI A;  3DWK A;  2ZQA A;  3DW0 A;  4JXS A;  4S2K A;  1NY0 A;  4ZTK A;  5FAT A;  4ZJ1 A;  4IED A;  4RA7 A;  1KE0 A;  4WBG A;  4LV0 A;  1SDE A;  1K38 A;  4HES A;  1XA1 A;  4H8R A;  5FAP A;  5GLA A;  1IYP A;  3N8L A;  4U3T A;  4B4X A;  5FQM A;  2WZZ A;  3ZG5 A;  4DE2 A;  3LY4 A;  5EVI D;  2BLS A;  2J9P A;  1SHV A;  2J9O A;  3P98 A;  2ZQ7 A;  4N9K A;  2H0T A;  4Y0U A;  2WZX A;  3BLM A;  4FH2 A;  3SH8 A;  2Q9M A;  2WGV A;  2DCF A;  1Q2Q A;  5FSR A;  4MBH A;  5DF9 A;  2ZJ9 A;  4C3Q A;  5CEC A;  2QMI A;  3HUO A;  5A92 A;  4EUZ A;  3W4O A;  1KDS A;  1YLW A;  5HFO A;  3VSK A;  4JF4 A;  2ZM8 A;  3ZNT A;  5U47 A;  5E2F A;  1E4D A;  3RJU A;  3HUM A;  1XP4 A;  2Y2L A;  1YLY A;  3ZNY A;  3HLW A;  4HEF A;  3Q7Z A;  3IHA A;  1K57 C;  1EWZ A;  5M1A A;  1ZKJ A;  3VP2 A;  4ZDX A;  3IXH A;  2HDU A;  1RCJ A;  4HBT A;  4JF5 A;  4MLL A;  3ZVT A;  3TSG A;  4E3L A;  2HDS A;  4QB8 A;  4D2O A;  2VGK A;  3IWQ A;  3MZE A;  2G2U A;  5CHJ A;  3UY6 A;  4F94 A;  5G18 A; 
#chains in the Genus database with same CATH topology
 2Y2N A;  1H8Z A;  4KQD A;  4QD4 A;  3IX4 A;  4WEJ A;  3FPW A;  1Y4O A;  1OTD A;  4K0X A;  2P9V B;  4KEN B;  2IWB A;  3BWL A;  3F1P A;  3LR5 A;  1O07 A;  3TJZ C;  3S1Y A;  3HRE A;  3PBQ A;  1OME A;  4S2M A;  2B5R A;  2XR0 A;  3T12 B;  4LCM A;  3T4J A;  4MCW A;  3NHQ A;  3KSF A;  1YKD A;  3KSI A;  4WM9 A;  3NEC A;  2JKG A;  4II7 A;  5FI7 A;  1DP8 A;  4S2I A;  4LGW A;  2H0Y A;  3BEC A;  1DJC A;  4YFM A;  3HLG A;  1T1A A;  1J9M A;  4WL9 A;  1YSP A;  4BBT A;  4OPR A;  1GHI A;  2OAQ 1;  2ZC6 B;  3N6I A;  4R0Q A;  5FAO A;  2VX8 A;  1IFQ A;  4IHQ A;  2XRO A;  4EWF A;  1N9L A;  1P0Z A;  3K3C A;  2LB5 A;  2QYB A;  3QNB A;  3SS3 A;  1OTB A;  2XFT A;  2J80 A;  2V8C A;  2X01 A;  1LI9 A;  4G3W A;  4LRZ E;  3Q7V B;  3JPU A;  2OLU A;  5EVI B;  4MBK A;  1ZC2 A;  3T4L A;  1PZP A;  2G7U A;  2XD5 A;  2Y91 A;  1LSV A;  1WE4 A;  1C3B A;  3VE3 A;  3HLE A;  4ID4 A;  2O9B A;  2VV7 A;  2PBY A;  3BYD A;  5FQJ A;  4R70 A;  2XF3 A;  3F1N A;  4Y13 A;  2UV0 E;  4U0T A;  2O0Y A;  1KDW A;  3FKV A;  3PTE A;  4L9G A;  4GDN A;  2XD1 A;  5L10 A;  4NK3 A;  2JC7 A;  4GN2 A;  1PWC A;  3LIB A;  1L0E A;  3QP1 A;  3E4Q A;  4K0W A;  4GB7 A;  4XT2 A;  1XFN A;  1ERO A;  2HP6 A;  2XQZ A;  1KE3 A;  4GD6 A;  3UB7 A;  2EXA A;  4O01 A;  2JKT M;  2KOI A;  4HJ6 A;  2ZC4 B;  4PM7 A;  2ZL1 B;  2BTF P;  4RX3 A;  3A3I A;  3VE4 A;  4EQI A;  1T19 A;  3VSL A;  5KZH A;  5G4Y A;  4Y0O A;  4MEZ A;  1P9R A;  2VV6 A;  1GA9 A;  2Y8H A;  2I72 A;  3M6H A;  3O88 A;  2QJ5 A;  5EFW A;  5HDC A;  2W0N A;  2A24 B;  1I2S A;  4Y15 A;  4UA7 A;  2QKP A;  3G31 A;  3GSG A;  4M3K A;  4PAU A;  2A49 A;  5EEC A;  4QY5 A;  2ZQD A;  4IBR A;  3MXR A;  4GJ4 A;  5FAS A;  2XDM A;  1MPL A;  1DJB A;  1PWD A;  3MS6 A;  3SOI A;  5F69 A;  1TS0 A;  3CAX A;  2X71 A;  4NG2 A;  2FH5 A;  4E6X A;  3LI9 A;  1NYM A;  4R4R A;  1PI4 A;  3VV4 A;  3T4T A;  1BLP A;  1BZA A;  3HVF A;  4P6Z M;  2HPB A;  1FIK A;  1FSW A;  3GVB A;  3V50 A;  3UN7 A;  3BFF A;  2GJ3 A;  2WAF A;  3ITA A;  3S7P A;  2EX9 A;  1VET A;  2FZ0 A;  3M2J A;  2E8J A;  4LFU A;  3TRC A;  2C6W B;  4KQR A;  1BUL A;  3S7N A;  4L9F A;  4OQH A;  4OVD A;  5F1G A;  3MZD A;  4O0P A;  3QNC A;  4KZ3 A;  4X1M A;  3RTY A;  5AJG A;  2CC1 A;  4FH4 A;  1MKM A;  5A93 A;  3GDI A;  2BAS A;  2Y55 A;  2W1T B;  3NDG A;  2BG1 A;  1L2S A;  1BSG A;  3E2K A;  4HP4 A;  2V9A A;  3EEH A;  4KZA A;  4IJG A;  4DMZ A;  1F2K A;  2Y59 A;  1K54 A;  5DF8 A;  1MWT A;  4BBV A;  4K08 A;  5GLC A;  4JKT A;  3QP6 A;  3LUQ A;  1LSX A;  4I5S A;  1YMX A;  3UNW A;  1PZO A;  4QY6 A;  4Q8I A;  3AGF A;  1SKF A;  5DKL A;  2EFX A;  2ZMV A;  3E2L A;  4HH2 A;  4X53 A;  1PRQ A;  4OLG A;  3C5A A;  1UGU A;  4S2N C;  4B9O A;  3KSH A;  3P7N A;  3C38 A;  5L2F A;  4Y5F A;  3OPR A;  4ESP A;  4N92 A;  4OPY A;  3G2Y A;  4E3K A;  2P04 A;  4QU3 A;  3E0Y A;  1PFL A;  3DTI A;  1NRF A;  3H9W A;  5CHM A;  3PAG A;  3WRZ A;  2J3W A;  3B3X A;  1LI0 A;  3NCK A;  1OTE A;  3DAV A;  5DJT A;  3MXS A;  4JGP A;  1LT0 A;  4S2N A;  3IXD A;  4HNB A;  3L7H A;  4EBP A;  2Y2M A;  3LR0 A;  3F1P B;  2VGL S;  4P6B A;  1PW1 A;  1ESU A;  5J7E A;  5J8X A;  2Z2L B;  3PAE A;  1ONG A;  2G2W A;  2WKR A;  3G2Z A;  1IKI A;  1DY6 A;  3KX0 X;  5EUA A;  5HDS A;  3G30 A;  1TD5 A;  2VLG A;  4IVI A;  2GX5 A;  4XUZ A;  3CG5 A;  1G6A A;  1KGE A;  4FUW A;  4LRY C;  5AVE A;  1ESI A;  2PRF A;  3VFH A;  4EET B;  4Y3I A;  5FAT A;  1A0K A;  4EXO A;  1SDE A;  4NXE A;  1XA1 A;  4IUH A;  3N8L A;  2WZZ A;  3ZG5 A;  4DE2 A;  3LY4 A;  4G3K A;  1SHV A;  5F5Y A;  2H0T A;  2WZX A;  3BLM A;  2ZMF A;  4C3Q A;  4QWO A;  1CF0 A;  4HJ3 A;  5HPI A;  4HHD A;  4Z1W A;  3LR4 A;  1XP4 A;  4HEF A;  3Q7Z A;  3IHA A;  2EWW A;  3VP2 A;  4ZDX A;  2HDU A;  1RCJ A;  4MLL A;  5TJJ A;  2HDS A;  4F94 A;  3O86 A;  1KVM A;  4BEN A;  1DJA A;  1Z6F A;  2Y2G A;  3U2A A;  1N9N A;  5E2G A;  1WYC A;  3B33 A;  3UPN A;  3CPT A;  4NXF A;  2CMN A;  2PT7 A;  4OOM A;  2WKE A;  1CK3 A;  3CI6 A;  4DRT A;  4B93 A;  1S4S A;  2Y79 A;  3LGO A;  1XGI A;  1E25 A;  2EWV A;  5GLD A;  3LIE A;  4XT2 B;  4OLD A;  1IEM A;  5EPH A;  4CLC C;  2ZMA A;  3V3R A;  1MXO A;  3IF6 A;  1XPB A;  5HAP A;  4YIN A;  2ZM0 A;  4DF6 A;  4Y0T A;  4ZAM A;  4MN6 A;  2J3T D;  1O7E A;  4X69 A;  1ZTU A;  3G32 A;  1XJ4 A;  3VP1 A;  1XFQ A;  4PPR A;  5EM0 A;  2UWX A;  2XK1 A;  2E8I A;  3CUE A;  3H82 A;  1OT6 A;  4HOI A;  4Z9Q A;  3OC2 A;  3VOL A;  1I5Q A;  4NEE D;  3JVU A;  1PI5 A;  2DRW A;  4EU0 A;  1FSY A;  4WF0 A;  4FTX A;  4CLC A;  3K3D A;  3BEB A;  3G34 A;  1FCN A;  5HL6 A;  5L09 A;  3G35 A;  1KGG A;  4R3J A;  1P97 A;  5FQ9 A;  3LCE A;  4OP8 A;  2VJW A;  2V1A A;  5G4Z A;  3VP4 A;  4DE0 A;  1XJ2 A;  4GS9 B;  4X25 A;  3VOZ A;  1EI5 A;  2INW A;  4UEY A;  3NC8 A;  1K25 A;  2ZQ9 A;  2PU2 A;  5JYO A;  1K6S A;  3MKF A;  1FOF A;  2VGJ A;  4A5R A;  3UE6 A;  5IT5 A;  3ICY A;  4CJN A;  4LLO B;  3C4P A;  1VET B;  5A8B A;  2D02 A;  1VHM A;  1GCE A;  3UB5 P;  3HL9 A;  4OON A;  2WYX A;  1ES5 A;  3SS5 A;  4KZ8 A;  1T18 A;  2EX8 A;  5BOH A;  3CZD A;  2KDK A;  4R23 A;  3GEC A;  2HDQ A;  3C7V A;  1ERQ A;  4QPR A;  3SH7 A;  3GRJ A;  4D60 A;  3RFB A;  3BFD A;  3T1Q B;  2JKR I;  2KLI A;  5HAR A;  3HLC A;  1KE4 A;  1NXY A;  4ME4 A;  3MBZ A;  3ULF A;  1E3U A;  4UQI S;  1Q2P A;  1M6K A;  1W7F A;  2PR5 A;  3PBT A;  1D06 A;  2IWD A;  3G6O A;  4KQO A;  1JWP A;  1CJF A;  5EOO A;  1NYY A;  4PKY G;  5CGX A;  5EVE A;  1ACF A;  3VMA A;  4HBU A;  2R9W A;  2XA7 M;  1W63 M;  3CMZ A;  1PIO A;  3ZCZ A;  4YOF A;  1CQA A;  2QZ6 A;  4HY8 A;  1FR6 A;  3FV7 A;  4NXG A;  4YWZ A;  2W1R A;  4IUK A;  3R7W A;  5DTK A;  1IYQ A;  1YT4 A;  1LHY A;  4PM5 A;  5F83 A;  2Y2H A;  4LV2 A;  5HW3 A;  3NDE A;  4RYE A;  4E3I A;  4KG5 A;  2NUP C;  4DN0 A;  1M40 A;  3Q07 A;  3Q82 A;  3BY8 A;  3KYQ A;  4GDB A;  3OBF A;  4HIA A;  2FFF B;  4X55 A;  4MBF A;  3Q81 A;  2IWC A;  1J3W A;  1V9Z A;  1XKZ A;  2AVX A;  3E4O A;  3NY4 A;  3ZG8 B;  4ARZ A;  2VKS A;  3A0V A;  3IT9 A;  3E4P A;  1Y28 A;  1YLZ A;  3ZG0 A;  4B88 A;  1EW0 A;  3TOI A;  4GHI A;  4S2P A;  4HH3 A;  1UWP X;  4UHU A;  3BLS A;  4BL3 A;  4NXB A;  2H28 A;  4WN5 A;  1FQG A;  3W8K A;  1IYO A;  4JGO A;  1BLH A;  3UB9 A;  3UB6 A;  1W79 A;  4O8G A;  4OH0 A;  3NI9 A;  4U0X A;  4Y7P A;  3UDX A;  1W63 Q;  3NIA A;  1TEM A;  3NOP C;  3VP0 A;  3RXW A;  3WS0 A;  2WGW A;  2QHK A;  5M18 A;  4OQ0 A;  1YLJ A;  1F5M A;  5KSC A;  1IEL A;  5AQA A;  3MQ0 A;  3UE0 A;  5DVA A;  1V9Y A;  3MKE A;  4GKU A;  3V39 A;  3CWF A;  3EWK A;  1K6R A;  1G5U A;  3BM6 A;  4MMN A;  5FI6 A;  1N9B A;  1X0O A;  4WUJ A;  1G6O A;  2Q0O A;  5AQ7 A;  3DBA A;  3IH8 A;  5AVF A;  3TE8 A;  4KZ7 A;  4EBN A;  3LIF A;  4C75 A;  5HL1 A;  1GA0 A;  4EBL A;  4WLA A;  2JKR M;  3WS2 A;  3CPT B;  2J8Y A;  5FDS A;  3GMW A;  4BBU A;  4HJ4 A;  1XJ6 A;  5A90 A;  4KG2 A;  5J3W A;  5DF7 A;  1YMS A;  2XEP A;  3NOT C;  5F6A A;  4JXG A;  5DFY A;  2V2F F;  1N4O A;  5CHU A;  1H0M A;  1I2W A;  3NBL A;  3H7W A;  1WYB A;  2VK3 A;  4FSF A;  2XFS A;  1T1C A;  2V0W A;  1LL8 A;  4FOF A;  1E3U D;  1L0D A;  2EX2 A;  3IF6 B;  4ZTK A;  1NY0 A;  4IED A;  5FAP A;  4I3I A;  3UB8 A;  5GLA A;  2BLS A;  2J9O A;  4N9K A;  4Y0U A;  3KYE A;  4Y17 A;  5HSQ A;  2DCF A;  1Q2Q A;  5FSR A;  3QP4 A;  3LR3 A;  3FPV A;  4MBH A;  2YKF A;  2GNX A;  5FL3 A;  3C30 A;  2QMI A;  3H82 B;  3B42 A;  1G28 A;  3W4O A;  1KDS A;  5HFO A;  3VSK A;  2QJ7 A;  1E4D A;  3RJU A;  2Y2L A;  1YLY A;  3NUL A;  3HLW A;  3ZNY A;  4CLC B;  1K57 C;  1T1B A;  1DP6 A;  5M1A A;  1ZKJ A;  2PDR A;  5F68 A;  3ZVT A;  2B95 A;  4E3L A;  4D2O A;  2JN7 A;  2G2U A;  4I3J A;  4Q0J A;  2R78 A;  4PKY A;  3OZH A;  3G4P A;  2HJ9 C;  3LYX A;  1MBL A;  3N7W A;  4X68 A;  4HI4 A;  3O3V A;  2OSU A;  1MKI A;  2V20 A;  1ES2 A;  3HJK A;  2GDN A;  1K57 A;  3ZG7 B;  4KZ9 A;  4R3B A;  1MWU A;  4I3A A;  1S67 L;  3JVV A;  4I39 A;  4JPM A;  5FQK A;  1FCM A;  3A3D A;  4MDZ A;  3A0S A;  4DDY A;  5CRF A;  3EQV A;  4EW7 A;  1KGF A;  3CHW P;  2C5W B;  3ZG9 B;  4PM6 A;  4EQ1 A;  3LY3 A;  4QHC A;  3OCN A;  1S1Z A;  2X02 A;  3MMH A;  3A3F A;  1HZO A;  1S4R A;  5F1F A;  4Q0H A;  3LO7 A;  1FIL A;  5KMW A;  5HPF A;  4O7D A;  4H6J A;  4BL2 A;  1P9W A;  1S1Y A;  1L0G A;  5TBM A;  5EV0 A;  3VOY A;  1W8Y A;  2VV8 A;  5HDD A;  3PBR A;  3GQZ A;  2P74 A;  3S7Q A;  4L0L A;  2PD8 A;  3MFX A;  4N9L A;  1CEG A;  2NUT C;  4GZB A;  3DWZ A;  1QME A;  3BFE A;  3R7W B;  3BY9 A;  3WS1 A;  2PAV P;  1XX2 A;  3NJA A;  5KIZ A;  3UPO A;  2KX6 A;  4HP9 A;  1TS7 A;  1TVF A;  1Z09 A;  2XGN A;  3T1S A;  4ETX A;  1QMF A;  1RP5 A;  1OTI A;  3PBS A;  3DTM A;  2FFY A;  3MFD A;  3HLD A;  5HWW A;  4LEN A;  1PWG A;  4F3L A;  2W27 A;  3S22 A;  5J4E A;  3UDF A;  3P09 A;  4OQG A;  1JNU A;  1S6R A;  5TGF A;  2V8F A;  4R4S A;  3FWL A;  5D3O A;  2B18 A;  2QPN A;  4R6L A;  4ARZ B;  5HD5 A;  4EEP A;  3IX8 A;  5A91 A;  5I94 A;  3F1N B;  5FDH A;  3E98 A;  4BMW A;  2GZA A;  5HWT A;  1N9O A;  1SKO A;  3PBO A;  2W3E A;  3UPP A;  4KZ4 A;  4CQH A;  3PR6 A;  4GHI B;  2PU4 A;  2WAE A;  1K0K A;  2L1M A;  3MZF A;  3EEA A;  4GOG A;  2L4R A;  5TR7 A;  2XSS A;  3ZFZ A;  3W4Q A;  4OOL A;  3RXX A;  1CI8 A;  1PW8 A;  1GHM A;  3UO9 A;  5CTM A;  3Q1F A;  3BW6 A;  2V1B A;  5DTT A;  3FG8 A;  4ZRR A;  1MWR A;  1PYY A;  2WGW B;  1SDN A;  1GSV A;  3TW8 A;  3WRT A;  4QJG A;  2PHY A;  5HAI A;  4MNR A;  2Z6C A;  2RL3 A;  1CEF A;  4KQQ A;  1MWS A;  2VA0 A;  3C2W A;  1STZ A;  2W1T A;  4R1G A;  4FD8 A;  4EEU A;  2MJ6 A;  1ERM A;  1F9I A;  5CGS A;  1JTD A;  3L9K A;  4OP5 A;  1ZG6 A;  4X56 A;  4S2L A;  5AQ9 A;  3PYP A;  2P7J A;  3SW1 A;  3M2K A;  1ES3 A;  2D01 A;  2ZQC A;  4LRX C;  3FC7 A;  4DE3 A;  2EA9 A;  4RQ9 A;  2ZC3 B;  4P6Z S;  1YSQ A;  4IVK A;  2K7S A;  4UAA A;  4E6W A;  3H7W B;  1LL9 A;  2M1C A;  3RH8 B;  5HWV A;  5E2E A;  3N8S A;  4KZ6 A;  1S66 L;  3F1O A;  5AQB A;  3ITB A;  4B4Z A;  3PBN A;  4ETZ A;  1IYS A;  2ZBB A;  5LBR A;  3JYI A;  4PHT A;  1H3Q A;  1AWI A;  1HVB A;  2V0U A;  4R3A A;  3HBR A;  4GNU A;  4JLF A;  2OV5 A;  1TDL A;  3FZC A;  2J7V A;  3HJI A;  1RGY A;  1YAX A;  2VGL M;  4E3J A;  4E3M A;  1NLZ A;  5CTN A;  1NRJ A;  2ZC5 B;  5K5B A;  3OPL A;  1NJ4 A;  5HD3 A;  1DRM A;  3T1X A;  4OQI A;  3ZQ5 A;  4WEL A;  4P87 A;  1CI9 A;  2HP5 A;  3EGX C;  5FA7 A;  1W5D A;  2A2L A;  1TS8 A;  2B02 A;  4BQM A;  3IWO A;  4RX2 A;  1K4E A;  3N8R A;  2Z6D A;  3OPH A;  2QWS A;  4ZBE A;  3IWI A;  1NLY A;  1BLC A;  3UMD A;  5HX9 A;  2RCX A;  4NET A;  5GHX A;  4GW9 A;  3V3S A;  1ZG4 A;  3S7O A;  3PXP A;  2O99 A;  1HTZ A;  5EE8 A;  4GLQ A;  4PM9 A;  5DKK A;  4EUV A;  3IBJ A;  3IBR A;  4JXS A;  2WGI A;  3DWK A;  4ZJ1 A;  1KE0 A;  4LV0 A;  2JKF A;  1K38 A;  4HES A;  4H8R A;  4U3T A;  3SZT A;  5FQM A;  5L07 A;  2XRN A;  3P98 A;  2Q9M A;  2M7U A;  5DF9 A;  4BWI A;  3T4O A;  5CEC A;  5A92 A;  2PR6 A;  5C5K A;  2OAP 1;  4EUZ A;  3EOI A;  4JF4 A;  2ZM8 A;  4H6J B;  1F98 A;  5IU1 A;  1XJ3 A;  2OWJ A;  4CLC D;  3OOV A;  1MZU A;  5TBM B;  3IXH A;  4HBT A;  4JF5 A;  4AFI A;  4QB8 A;  2VGK A;  3IWQ A;  5CHJ A;  3UY6 A;  3UME A;  3IS2 A;  2M7V A;  2DNS A;  2Y2J A;  2Z2M B;  5IHV A;  3QP2 A;  4CPK A;  3HLF A;  2VZW A;  3EGD C;  4WZ5 C;  5CED A;  1SZV A;  2O9A A;  2PD7 A;  4IBX A;  1D1J A;  2EX6 A;  3MQQ A;  2K2N A;  4MN5 A;  1XXM A;  1TDG A;  2EFU A;  3W2Z A;  1NZO A;  2Y2Q A;  5GHZ A;  4PM8 A;  5FQQ A;  1KVL A;  3CJM A;  3QHY A;  5CER A;  4DJ3 A;  4KZB A;  4ZJ2 A;  1TF1 A;  4OOY A;  2H5S A;  5TFQ A;  4K91 A;  4F3L B;  4FCF A;  5E2H A;  3ZDJ A;  1K56 A;  3ZGA B;  1H8Y A;  3O87 A;  1NWZ A;  1S0W A;  3D4F A;  4RVA A;  4N1H A;  4WZ5 A;  1AXB A;  2DMW A;  2ZM2 A;  1HLU P;  5IS1 A;  3A3E A;  4C6Y A;  4WYY A;  4LV1 A;  4DE1 A;  3BQ8 A;  5F82 A;  1ODV A;  2XLN A;  5MC7 A;  4E3O A;  1SKO B;  4CLC E;  4R38 A;  1D7E A;  1K55 C;  5KSH A;  3BFG A;  2IA2 A;  4OKP A;  1FR1 A;  2PBD P;  3V67 A;  3GR2 A;  4GS9 A;  5DTS A;  1ALQ A;  2ZOH A;  5GLB A;  3IF5 A;  3LI8 A;  1IKG A;  2WKI A;  5CX7 A;  1TS6 A;  4UA9 A;  2W3D A;  1YLT A;  2Y2O A;  5HZH A;  5JYP A;  1K4F A;  1LL5 A;  1VEU A;  3IHB A;  4Y2F A;  3OLO A;  2HV1 A;  5EVL A;  3ISG A;  1K55 A;  1K54 C;  4LCL A;  1ONH A;  2P08 A;  3EQU A;  5DJU A;  4JXW A;  2P9V A;  3D3O A;  3V5M A;  3LID A;  3MSH A;  3AGE A;  2J3T C;  1JWV A;  1GHP A;  3C8C A;  4ZJ3 A;  3BRM A;  2WAD A;  3ZHH A;  3A3J A;  1BT5 A;  4P85 A;  3IXB A;  3ZVW A;  1JTG A;  1ZHH B;  2EXB A;  2PYR A;  4UQI M;  4GD8 A;  2R9X A;  2WUQ A;  1HD8 A;  2ZD8 A;  4BD0 A;  2OWH A;  4P0M A;  3IXG A;  1FCO A;  5EVI C;  3CLO A;  3BQA A;  4JF6 A;  5FAQ A;  1L3L A;  4N1X A;  1BLS A;  2O9C A;  4WMC A;  1JWZ A;  2A3U A;  1OJG A;  5I5L A;  2JCH A;  4S2J A;  4WZ4 A;  2YKH A;  2K31 A;  3UDI A;  2HZ5 A;  4XUX A;  4DXB A;  3UE1 A;  3F1O B;  5L8M A;  3SH9 A;  1OJ5 A;  2LB9 A;  3A0R A;  3OPP A;  4E04 A;  1BTL A;  3T50 A;  3Q7V A;  1UWN X;  3GTC A;  5GL9 A;  2VEA A;  5EVI A;  3T1R A;  1WA9 A;  3K2N A;  4BD1 A;  3DTK A;  1VB6 A;  1OT9 A;  2HDR A;  1XGJ A;  4E3N A;  3AGD A;  4S2O A;  4HQA A;  3KYZ A;  2WKH A;  3D72 A;  3C4O A;  2PYP A;  5G18 A;  1YPR A;  2Y4A A;  5E43 A;  3OCL A;  1OTA A;  4KG6 A;  4L9E A;  1VQQ A;  4JGQ A;  1SCW A;  4OPQ A;  5CXW A;  1BUE A;  4X6T A;  1OPX A;  4Q0I A;  3LEQ A;  5CGW A;  2ZQ8 A;  3UE3 A;  4BJP A;  1DP9 A;  3WS5 A;  2Q9N A;  1K56 D;  3S4X A;  2JBF A;  2XA7 S;  3PHY A;  1XA7 A;  2HP9 A;  4YNR A;  1RGZ A;  3HLB A;  1YLP A;  2JE5 A;  3LEZ A;  4UA6 A;  4GCZ A;  3QP5 A;  1MC0 A;  3FYZ A;  2Y2I A;  5M19 A;  1GSW A;  3M6B A;  2ZL1 A;  3FKW A;  3IH9 A;  5DFX A;  4BLM A;  1LLB A;  3N4I A;  5GHY A;  3LIC A;  4M4X A;  2ZLY A;  4LV3 A;  3QP8 A;  2HF6 A;  3KO6 A;  5EM1 A;  1YM1 A;  1IOU A;  1VM1 A;  2Y2K A;  2WKP A;  4KZ5 A;  2WKQ A;  2A24 A;  4OPZ A;  5FI2 A;  3TG9 A;  3W4P A;  4KUK A;  3GV9 A;  1L0F A;  4DDS A;  2V1Z A;  4JBF A;  3D9Y A;  3VFF A;  3MJQ A;  3IF6 C;  3CIT A;  4EV4 A;  2H10 A;  4EER A;  3P01 A;  4G3V A;  1H8M A;  3DTE A;  4DXC A;  1G68 A;  2OOL A;  3T4S A;  3VP3 A;  5FEF A;  1YQS A;  3BFC A;  5HAQ A;  3WWX A;  1W8Q A;  1JVJ A;  3MF0 A;  4LPZ A;  1MY8 A;  3CUE C;  3LFV A;  3MQO A;  3T4K A;  5FQI A;  1H5X A;  3U4L P;  3I7J A;  3IS2 B;  3C7U A;  3KSG A;  3IX3 A;  5EOE A;  2Y2P A;  1U60 A;  4WEK A;  3MR0 A;  3SS4 A;  2ZC7 A;  4DJ2 A;  3HUN A;  3HCY A;  4XXR A;  1Y54 A;  3MXQ A;  5CEB A;  2OLV A;  2ZOI A;  1ES4 A;  1GSX A;  4PMA A;  4MN7 A;  4I38 A;  3T4Q A;  4JXV A;  2W3F A;  3WS4 A;  3O5Y A;  2L0W A;  4X1L A;  1NZU A;  4DKI A;  4WMC D;  2XH9 A;  5FEG A;  1BYW A;  1LSW A;  2WK0 A;  2HJE A;  2ACG A;  2W3G A;  3IQA A;  2ZQA A;  3DW0 A;  4S2K A;  3BJN A;  3R4K A;  4WBG A;  4RA7 A;  2JHE A;  1IYP A;  4B4X A;  5EVI D;  2J9P A;  2ZQ7 A;  4JGR A;  2W3H A;  4EES A;  4FH2 A;  3SH8 A;  2WGV A;  1PNE A;  2ZJ9 A;  3HUO A;  1YLW A;  2JKT I;  1KOU A;  3ZYT A;  4KUO A;  3ZNT A;  5U47 A;  5E2F A;  3LIA A;  3HUM A;  1EWZ A;  3B47 A;  2I9V A;  3TSG A;  3NOU C;  3MZE A;  4NKP A;  2HGV A;  1VEU B; 
#chains in the Genus database with same CATH homology
 2Y2N A;  3O86 A;  1KVM A;  4BEN A;  1DJA A;  1Z6F A;  1H8Z A;  2DNS A;  2Y2G A;  2Y2J A;  3OZH A;  2Z2M B;  3G4P A;  4QD4 A;  4WEJ A;  5IHV A;  4CPK A;  3HLF A;  4K0X A;  2P9V B;  4KEN B;  1MBL A;  4WZ5 C;  3N7W A;  2IWB A;  5E2G A;  1WYC A;  5CED A;  3UPN A;  4X68 A;  4IBX A;  3O3V A;  2OSU A;  1MKI A;  1O07 A;  2EX6 A;  2V20 A;  1ES2 A;  1XXM A;  4OOM A;  3S1Y A;  1TDG A;  2WKE A;  1CK3 A;  2EFU A;  3HRE A;  2GDN A;  1NZO A;  3PBQ A;  4DRT A;  2Y2Q A;  1OME A;  5GHZ A;  4PM8 A;  1K57 A;  5FQQ A;  1KVL A;  3ZG7 B;  4S2M A;  3CJM A;  3QHY A;  4KZ9 A;  5CER A;  4KZB A;  4R3B A;  1MWU A;  2B5R A;  2XR0 A;  4ZJ2 A;  1XGI A;  4OOY A;  2H5S A;  5TFQ A;  4LCM A;  4K91 A;  4FCF A;  1E25 A;  5E2H A;  3ZDJ A;  5GLD A;  1K56 A;  3ZGA B;  1H8Y A;  3O87 A;  4OLD A;  1IEM A;  1S0W A;  4WM9 A;  5EPH A;  3D4F A;  4JPM A;  4RVA A;  2ZMA A;  3V3R A;  1MXO A;  5FI7 A;  5FQK A;  3IF6 A;  4N1H A;  1FCM A;  1XPB A;  4S2I A;  5HAP A;  2H0Y A;  3BEC A;  1DJC A;  3A3D A;  4WZ5 A;  4YFM A;  4YIN A;  1AXB A;  2ZM0 A;  3HLG A;  4DF6 A;  4Y0T A;  4DDY A;  4ZAM A;  5CRF A;  3EQV A;  2ZM2 A;  1KGF A;  1J9M A;  1O7E A;  2C5W B;  3A3E A;  4WYY A;  4X69 A;  4PM6 A;  4LV1 A;  3ZG9 B;  4C6Y A;  4DE1 A;  5F82 A;  3LY3 A;  2XLN A;  4QHC A;  3G32 A;  4E3O A;  3VP1 A;  1K55 C;  5KSH A;  3BFG A;  4OPR A;  3OCN A;  1GHI A;  3N6I A;  2ZC6 B;  4R0Q A;  4PPR A;  5FAO A;  4OKP A;  2X02 A;  1FR1 A;  2UWX A;  2XK1 A;  2E8I A;  3A3F A;  1HZO A;  5F1F A;  3GR2 A;  4Z9Q A;  3LO7 A;  3OC2 A;  4EWF A;  5KMW A;  1I5Q A;  5DTS A;  1PI5 A;  4O7D A;  2DRW A;  1ALQ A;  4BL2 A;  1FSY A;  3QNB A;  3SS3 A;  2XFT A;  5GLB A;  3IF5 A;  2X01 A;  1IKG A;  2WKI A;  1L0G A;  1LI9 A;  3BEB A;  4UA9 A;  3G34 A;  3Q7V B;  3VOY A;  1FCN A;  1W8Y A;  1YLT A;  2OLU A;  3G35 A;  2Y2O A;  5JYP A;  1KGG A;  3PBR A;  1K4F A;  5EVI B;  3GQZ A;  2P74 A;  4MBK A;  4L0L A;  1ZC2 A;  1LL5 A;  3IHB A;  4R3J A;  4N9L A;  5EVL A;  1PZP A;  2XD5 A;  2Y91 A;  5FQ9 A;  1WE4 A;  3LCE A;  1C3B A;  1CEG A;  1K55 A;  3ISG A;  4OP8 A;  1K54 C;  4LCL A;  1ONH A;  4GZB A;  3VP4 A;  3EQU A;  4DE0 A;  3HLE A;  3DWZ A;  4JXW A;  2P9V A;  4ID4 A;  1QME A;  3V5M A;  3BFE A;  2PBY A;  3VOZ A;  3AGE A;  3WS1 A;  1EI5 A;  1XX2 A;  3BYD A;  3NC8 A;  1JWV A;  5FQJ A;  1GHP A;  1K25 A;  4ZJ3 A;  2ZQ9 A;  3BRM A;  3UPO A;  2PU2 A;  2XF3 A;  5JYO A;  2WAD A;  1K6S A;  4U0T A;  1TVF A;  1KDW A;  3ZHH A;  3A3J A;  1BT5 A;  2XGN A;  3FKV A;  3MKF A;  1FOF A;  2VGJ A;  3PTE A;  4A5R A;  4GDN A;  1QMF A;  4P85 A;  4CJN A;  1RP5 A;  2XD1 A;  3IXB A;  3ZVW A;  3PBS A;  3C4P A;  4NK3 A;  1JTG A;  2JC7 A;  3DTM A;  2FFY A;  4GN2 A;  1PWC A;  3MFD A;  3HLD A;  4LEN A;  1PWG A;  1GCE A;  1L0E A;  2EXB A;  3S22 A;  3HL9 A;  4OON A;  4GD8 A;  4K0W A;  2R9X A;  4GB7 A;  3UDF A;  2WYX A;  1ES5 A;  3SS5 A;  4KZ8 A;  2WUQ A;  3P09 A;  4OQG A;  1HD8 A;  1S6R A;  2ZD8 A;  4BD0 A;  1ERO A;  2HP6 A;  5TGF A;  4R4S A;  3FWL A;  4P0M A;  5D3O A;  2XQZ A;  1KE3 A;  1FCO A;  3IXG A;  2EX8 A;  4GD6 A;  5BOH A;  3CZD A;  2QPN A;  2EXA A;  4R23 A;  5EVI C;  5A91 A;  5I94 A;  2HDQ A;  4JF6 A;  3C7V A;  5FDH A;  2ZC4 B;  4PM7 A;  5FAQ A;  4RX3 A;  3A3I A;  1ERQ A;  4N1X A;  4EQI A;  1BLS A;  3PBO A;  4WMC A;  3VSL A;  1JWZ A;  3SH7 A;  3UPP A;  5KZH A;  2A3U A;  3GRJ A;  4KZ4 A;  2JCH A;  3BFD A;  4Y0O A;  4S2J A;  4MEZ A;  2PU4 A;  4WZ4 A;  2WAE A;  1GA9 A;  3UDI A;  2I72 A;  3MZF A;  3M6H A;  4XUX A;  4DXB A;  3O88 A;  5HAR A;  3HLC A;  3UE1 A;  1KE4 A;  1NXY A;  4GOG A;  3MBZ A;  3SH9 A;  1E3U A;  1I2S A;  1Q2P A;  1M6K A;  3OPP A;  1W7F A;  4UA7 A;  3G31 A;  3PBT A;  3GSG A;  4M3K A;  5TR7 A;  2IWD A;  2A49 A;  3ZFZ A;  3W4Q A;  1BTL A;  4KQO A;  5EEC A;  1JWP A;  4OOL A;  4QY5 A;  5EOO A;  3Q7V A;  1NYY A;  5CGX A;  3RXX A;  2ZQD A;  3VMA A;  3GTC A;  5GL9 A;  1CI8 A;  1PW8 A;  1GHM A;  5EVI A;  4IBR A;  3UO9 A;  4HBU A;  2R9W A;  3MXR A;  5CTM A;  4BD1 A;  5FAS A;  3Q1F A;  2XDM A;  2HDR A;  3CMZ A;  5DTT A;  1PIO A;  1MPL A;  3ZCZ A;  1XGJ A;  1MWR A;  1PYY A;  4E3N A;  2QZ6 A;  1DJB A;  1PWD A;  3AGD A;  2WGW B;  3SOI A;  1FR6 A;  1SDN A;  3FV7 A;  2X71 A;  4S2O A;  2WKH A;  3WRT A;  4E6X A;  4QJG A;  3C4O A;  1NYM A;  4R4R A;  5DTK A;  1PI4 A;  2Y4A A;  5E43 A;  1IYQ A;  1YT4 A;  1BLP A;  3OCL A;  1BZA A;  4KG6 A;  4MNR A;  5HAI A;  3HVF A;  1VQQ A;  2HPB A;  1SCW A;  4OPQ A;  5CXW A;  1BUE A;  1LHY A;  4X6T A;  2RL3 A;  1FSW A;  5F83 A;  1CEF A;  4PM5 A;  4KQQ A;  1MWS A;  2Y2H A;  4LV2 A;  3GVB A;  5CGW A;  3V50 A;  2ZQ8 A;  3UE3 A;  5HW3 A;  3NDE A;  4RYE A;  4E3I A;  4KG5 A;  3UN7 A;  4BJP A;  3BFF A;  3WS5 A;  1M40 A;  2WAF A;  3ITA A;  2Q9N A;  2EX9 A;  3Q07 A;  4R1G A;  3Q82 A;  4FD8 A;  3M2J A;  1ERM A;  4GDB A;  1K56 D;  5CGS A;  3S4X A;  1JTD A;  2JBF A;  4OP5 A;  1ZG6 A;  4X56 A;  1XA7 A;  2HP9 A;  4S2L A;  5AQ9 A;  2FFF B;  2C6W B;  4KQR A;  3M2K A;  4MBF A;  3Q81 A;  4X55 A;  1RGZ A;  2IWC A;  1BUL A;  3HLB A;  1ES3 A;  1XKZ A;  1YLP A;  4OQH A;  2JE5 A;  3LEZ A;  4OVD A;  5F1G A;  4UA6 A;  2ZQC A;  3MZD A;  3FYZ A;  3QNC A;  3NY4 A;  2Y2I A;  3ZG8 B;  5M19 A;  3M6B A;  4KZ3 A;  4DE3 A;  2ZC3 B;  2CC1 A;  3IT9 A;  3FKW A;  4FH4 A;  5A93 A;  4IVK A;  3IH9 A;  2Y55 A;  4BLM A;  1LLB A;  1YLZ A;  4UAA A;  3N4I A;  5GHY A;  3ZG0 A;  4B88 A;  3TOI A;  3NDG A;  4E6W A;  2ZLY A;  2BG1 A;  4LV3 A;  4S2P A;  1L2S A;  1BSG A;  3E2K A;  1LL9 A;  1YM1 A;  4UHU A;  3BLS A;  4BL3 A;  4KZA A;  5E2E A;  3N8S A;  4KZ6 A;  1VM1 A;  2Y2K A;  4KZ5 A;  5AQB A;  2Y59 A;  1FQG A;  1K54 A;  3ITB A;  3PBN A;  5DF8 A;  4B4Z A;  1MWT A;  3W8K A;  1IYO A;  5GLC A;  4OPZ A;  4JKT A;  5FI2 A;  1BLH A;  1IYS A;  3TG9 A;  1YMX A;  3JYI A;  1W79 A;  3W4P A;  4OH0 A;  3UNW A;  1PZO A;  3GV9 A;  3NI9 A;  4QY6 A;  4U0X A;  4Y7P A;  3UDX A;  1HVB A;  1L0F A;  4Q8I A;  3HBR A;  3AGF A;  1SKF A;  4GNU A;  1TDL A;  2EFX A;  3E2L A;  4JLF A;  2OV5 A;  4DDS A;  3FZC A;  4X53 A;  3NIA A;  2J7V A;  1TEM A;  4OLG A;  2V1Z A;  3VP0 A;  3RXW A;  3C5A A;  4JBF A;  1RGY A;  4S2N C;  3VFF A;  3IF6 C;  4EV4 A;  3WS0 A;  2H10 A;  2WGW A;  4E3J A;  5L2F A;  4E3M A;  5M18 A;  4OQ0 A;  5CTN A;  1YLJ A;  5KSC A;  1IEL A;  3OPR A;  5AQA A;  4DXC A;  3UE0 A;  1G68 A;  4N92 A;  3VP3 A;  4OPY A;  5DVA A;  3G2Y A;  1YQS A;  4E3K A;  3BFC A;  2ZC5 B;  5HAQ A;  3MKE A;  3OPL A;  1NJ4 A;  4GKU A;  4QU3 A;  3WWX A;  1W8Q A;  1JVJ A;  1NRF A;  3V39 A;  4OQI A;  1MY8 A;  5FQI A;  1H5X A;  5CHM A;  1K6R A;  3BM6 A;  4WEL A;  4P87 A;  3PAG A;  1N9B A;  1CI9 A;  2HP5 A;  5FI6 A;  3WRZ A;  3B3X A;  1LI0 A;  3I7J A;  5FA7 A;  3C7U A;  3NCK A;  1W5D A;  5EOE A;  2Y2P A;  3IWO A;  3MXS A;  5AQ7 A;  4BQM A;  1U60 A;  4RX2 A;  1K4E A;  3IH8 A;  4WEK A;  4S2N A;  3SS4 A;  3IXD A;  2ZC7 A;  3N8R A;  3HUN A;  4EBP A;  4KZ7 A;  4EBN A;  2Y2M A;  3OPH A;  4XXR A;  1Y54 A;  4ZBE A;  4C75 A;  3IWI A;  1GA0 A;  5CEB A;  4EBL A;  4P6B A;  5HL1 A;  2OLV A;  1ES4 A;  1PW1 A;  1ESU A;  3WS2 A;  2J8Y A;  1BLC A;  3GMW A;  4PMA A;  5J8X A;  2Z2L B;  3PAE A;  5A90 A;  4JXV A;  4KG2 A;  1ONG A;  3WS4 A;  5HX9 A;  2G2W A;  3G2Z A;  5DF7 A;  1IKI A;  1NZU A;  4DKI A;  1YMS A;  2RCX A;  2XEP A;  2XH9 A;  1DY6 A;  4WMC D;  4JXG A;  5EUA A;  2V2F F;  4NET A;  5GHX A;  1N4O A;  3G30 A;  1ZG4 A;  3V3S A;  5CHU A;  2WK0 A;  4IVI A;  1I2W A;  3NBL A;  1HTZ A;  1WYB A;  4XUZ A;  5EE8 A;  3CG5 A;  4FSF A;  2XFS A;  1G6A A;  1KGE A;  4PM9 A;  3IQA A;  1ESI A;  1E3U D;  3VFH A;  1L0D A;  2EX2 A;  3IF6 B;  2WGI A;  3DWK A;  2ZQA A;  3DW0 A;  4JXS A;  4S2K A;  1NY0 A;  4ZTK A;  5FAT A;  4ZJ1 A;  4IED A;  4RA7 A;  1KE0 A;  4WBG A;  4LV0 A;  1SDE A;  1K38 A;  4HES A;  1XA1 A;  4H8R A;  5FAP A;  5GLA A;  1IYP A;  3N8L A;  4U3T A;  4B4X A;  5FQM A;  2WZZ A;  3ZG5 A;  4DE2 A;  3LY4 A;  5EVI D;  2BLS A;  2J9P A;  1SHV A;  2J9O A;  3P98 A;  2ZQ7 A;  4N9K A;  2H0T A;  4Y0U A;  2WZX A;  3BLM A;  4FH2 A;  3SH8 A;  2Q9M A;  2WGV A;  2DCF A;  1Q2Q A;  5FSR A;  4MBH A;  5DF9 A;  2ZJ9 A;  4C3Q A;  5CEC A;  2QMI A;  3HUO A;  5A92 A;  4EUZ A;  3W4O A;  1KDS A;  1YLW A;  5HFO A;  3VSK A;  4JF4 A;  2ZM8 A;  3ZNT A;  5U47 A;  5E2F A;  1E4D A;  3RJU A;  3HUM A;  1XP4 A;  2Y2L A;  1YLY A;  3ZNY A;  3HLW A;  4HEF A;  3Q7Z A;  3IHA A;  1K57 C;  1EWZ A;  5M1A A;  1ZKJ A;  3VP2 A;  4ZDX A;  3IXH A;  2HDU A;  1RCJ A;  4HBT A;  4JF5 A;  4MLL A;  3ZVT A;  3TSG A;  4E3L A;  2HDS A;  4QB8 A;  4D2O A;  2VGK A;  3IWQ A;  3MZE A;  2G2U A;  5CHJ A;  3UY6 A;  4F94 A;  5G18 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...