5A8BA

Structure of a parallel dimer of the aureochrome 1a lov domain from phaeodactylum tricornutum
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
132
structure length
132
Chain Sequence
FSFIKALQTAQQNFVVTDPSLPDNPIVYASQGFLNLTGYSLDQILGRNCRFLQGPETDPKAVERIRKAIEQGNDMSVCLLNYRVDGTTFWNQFFIAALRDAGGNVTNFVGVQCKVSDQYAATVTKQQEEEEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Unknown function
molecule keywords PTAUREO1A LOV2 DOMAIN
publication title Structure of a Native-Like Aureochrome 1A Lov Domain Dimer from Phaeodactylum Tricornutum.
pubmed doi rcsb
source organism Phaeodactylum tricornutum
total genus 41
structure length 132
sequence length 132
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5a8bA00
4HJ6A 1LSWA 2WKPA 4NXBA 3ZQ5A 4LRZE 2A24A 3F1PA 3IS2A 4BBVA 2QWSA 2YKFA 4EEPA 4EW7A 4HNBA 1XFNA 3SW1A 3KX0X 5IS1A 2KX6A 2OWJA 2VLGA 4EERA 1XJ3A 1OTAA 3F1OA 1OTEA 4WN5A 3C2WA 1N9OA 5F69A 4PKYA 3F1NB 1GSXA 3MQQA 5J3WA 3ULFA 4HP4A 2GJ3A 4H6JB 3EEHA 2PR6A 1OTIA 2YKHA 1P0ZA 1LT0A 1TS7A 4LLOB 5HD3A 3FG8A 4XT2A 4HY8A 1X0OA 3MFXA 3NOTC 5HD5A 4GS9A 2PD8A 2A24B 4I39A 3F1PB 5G4ZA 3IS2B 3LUQA 1D06A 4B9OA 4BBUA 4HOIA 4YWZA 5TBMB 4LRXC 4LPZA 3P7NA 3UMEA 2M1CA 3MJQA 4MN5A 1EW0A 3ICYA 3LICA 4GHIB 2VV7A 2JHEA 3HJKA 3H9WA 2K7SA 5AVFA 1TS6A 2VV8A 3RH8B 3A0SA 2PR5A 4I3JA 1T1CA 1OTDA 2HV1A 2QKPA 4JGQA 4HQAA 3E4PA 3NJAA 3K3CA 4HHDA 3NOUC 2L1MA 4NXEA 1Y28A 1V9YA 4L9GA 4DJ2A 3H82B 3D72A 1OT6A 4XT2B 3PYPA 1WA9A 4KUOA 4R70A 5J4EA 3MQOA 2JN7A 1LSVA 1XJ4A 1T1BA 2L0WA 3A0VA 1T1AA 4I38A 4KQDA 5HDDA 3UB6A 5HWWA 1DP6A 2INWA 3BY8A 2VV6A 4HP9A 2W0NA 1TS0A 3LIDA 1S67L 1XFQA 1G28A 5J7EA 4KUKA 5A8BA 3OLOA 4M4XA 4I5SA 1XJ6A 4PKYG 3IBRA 4EETB 4WF0A 4MN6A 5I5LA 2ZOHA 3EWKA 3H7WA 5HZHA 2PD7A 4NXFA 2ZOIA 1DP8A 1P97A 4F3LA 2V1BA 3BY9A 1UWNX 4GW9A 5IU1A 1OJ5A 1S1ZA 3PHYA 5DJTA 1LL8A 2EA9A 5F5YA 3E4QA 1LSXA 4GCZA 1VB6A 5F68A 1T19A 3UMDA 2R78A 5HDCA 3F1OB 1TS8A 1GSWA 2H28A 4WL9A 3A0RA 2PYRA 2WKRA 2V0UA 1N9LA 2QJ7A 3H7WB 4I3AA 4JGRA 1DP9A 4R6LA 4HIAA 4BBTA 1DRMA 4LRYC 1MZUA 3CLOA 1UWPX 3LIAA 3UB7A 1S4RA 2PYPA 4HH3A 4RQ9A 3UB9A 5HSQA 4GS9B 1GSVA 4EXOA 4HJ4A 2BASA 4H6JA 2B02A 3LIFA 1S1YA 4I3IA 1KOUA 3CWFA 5EFWA 5HDSA 2D01A 4NXGA 1OJGA 3LIEA 4EQ1A 1BYWA 1T18A 4E04A 2I9VA 3GDIA 4HJ3A 2CMNA 4JGPA 1NWZA 5TBMA 2W27A 3VE3A 1V9ZA 4HH2A 3UB8A 4EESA 3RTYA 4GHIA 2Z6DA 2V9AA 3FC7A 1D7EA 3NOPC 5DKKA 2QJ5A 2V0WA 2KDKA 3LYXA 1UGUA 4HI4A 3VOLA 2P7JA 3HJIA 5DJUA 2QHKA 3E4OA 1S66L 3T50A 5F6AA 4WUJA 4DJ3A 4L9EA 2WKQA 1OTBA 2V1AA 3H82A 4K08A 1XJ2A 5HWTA 3CAXA 1S4SA 3G6OA 1JNUA 3MXQA 2L4RA 4L9FA 5KIZA 3GECA 3B33A 5G4YA 1ODVA 5DKLA 2Z6CA 5HWVA 2VEAA 3MR0A 4WLAA 2D02A 1F9IA 3K3DA 4JGOA 2OWHA 2ZBBA 2J80A 1F98A 1N9NA 4EEUA 1OT9A 2PHYA 3LI8A 4F3LB 2PDRA 3UE6A 3F1NA 4R3AA 4R38A 2OOLA 3LI9A 3NHQA 3LIBA 5AVEA 3C8CA 3VE4A 3BWLA
chains in the Genus database with same CATH superfamily
1M40A 4S2KA 2J3TC 2O9AA 1LSWA 2WKPA 3T4TA 3QP5A 2FZ0A 3IS2A 1K6RA 4G3WA 4Y7PA 1KDSA 3IWIA 2JBFA 5JYPA 2ZC5B 4KENB 4WZ5C 3GQZA 1NLZA 5IS1A 1ALQA 4FCFA 2QZ6A 1ES3A 1XJ3A 2B18A 2IA2A 1OTAA 2P74A 4KG6A 3IF6C 3M2KA 2LB5A 2JKTM 1VQQA 3V3SA 5L2FA 5F69A 1KDWA 1W7FA 2OLVA 4H8RA 2P9VB 5AJGA 5D3OA 3ULFA 4HP4A 3HUMA 1N4OA 2PR6A 1K56D 1FSWA 3VFHA 4UA6A 3V67A 1LT0A 1NLYA 4LLOB 4JF6A 3FG8A 4GNUA 1ZG4A 4X1MA 3RXXA 1X0OA 3ZG8B 1ERMA 4GD8A 4ARZB 3NOTC 4GS9A 4X68A 1MKMA 4PM6A 2C6WB 2A24B 3F1PB 4OPQA 2V20A 1Z09A 4OONA 2PT7A 3HLEA 4QPRA 2HDUA 4A5RA 3VP2A 3P7NA 1MPLA 1DJBA 1YAXA 4Y3IA 3SH8A 3UMEA 2M1CA 3NIAA 4OQIA 4LENA 4ZJ3A 3ICYA 2VV7A 2WGWB 3E2LA 1TS6A 4E6XA 4G3KA 3TE8A 1T1CA 3BQAA 3C30A 4I3JA 2HV1A 2QKPA 4CLCD 1YLYA 4JGQA 4HQAA 3SS4A 3E4PA 4HHDA 4ID4A 4KQRA 4LV0A 4MN7A 1V9YA 4L9GA 5E2GA 1MY8A 1ONHA 1YLJA 3BW6A 3TJZC 1AXBA 4WBGA 2GNXA 3UPNA 3V5MA 3WS2A 4EUVA 2VX8A 5G18A 3PBTA 2WK0A 3MQOA 4KZ9A 4PPRA 2HPBA 4ZJ1A 3AGEA 2XA7S 4I38A 4KZ4A 3S7PA 2I72A 2ZQDA 4WMCD 1Y4OA 4E3LA 3HUOA 3S7OA 1TDLA 3C5AA 3OLOA 2NUPC 3LR5A 1XJ6A 4PKYG 4D2OA 1E25A 3N8LA 3EWKA 2Q9MA 4CLCC 2PD7A 1GCEA 5DF8A 1BLHA 5HX9A 3U2AA 2E8JA 2VJWA 2V8FA 3HUNA 5DTKA 5AQBA 3ZNTA 1JTGA 4GW9A 4Z1WA 1S1ZA 4GDNA 5F1FA 2P08A 3WS1A 1LL8A 2EA9A 3O86A 2RCXA 3FKVA 3UE0A 5J8XA 2W1RA 3ZCZA 4B93A 5F68A 4UHUA 5KMWA 2R78A 4IEDA 3BLSA 3Q07A 5EPHA 1TS8A 4UQIS 4MLLA 2ZQ7A 4X55A 1L0GA 1PYYA 3MXRA 3RJUA 4MDZA 1ESUA 2IWCA 3DWKA 5HARA 1STZA 3H7WB 3Q7VB 4I3AA 1HZOA 5AQAA 4R6LA 4DE3A 3VFFA 4ZRRA 4LRYC 1YLTA 2R9XA 4BD0A 4DDYA 3DTMA 2Y8HA 3LIAA 2XQZA 3MBZA 3SZTA 5HSQA 2WAEA 2IWBA 3QP6A 4KG2A 3KYQA 3OC2A 4EXOA 4HJ4A 1E3UA 2BASA 4FOFA 5DFXA 5CHMA 5E2HA 3EEAA 4XXRA 2B02A 1SCWA 4QHCA 4CPKA 5EFWA 4QU3A 1IKGA 1PW1A 1S6RA 3C4OA 3MFDA 3GRJA 1BYWA 5FQKA 2WKEA 1K55C 2K31A 3LO7A 4OQGA 3LR4A 2CMNA 2W3FA 2K2NA 5DVAA 3EOIA 2M7UA 1RGYA 5F83A 2EFXA 2ZL1B 5TR7A 3MKFA 3M2JA 1GHIA 1K6SA 3RTYA 3W4QA 3CPTB 4YOFA 3MQ0A 1N9BA 3LEQA 3HCYA 4CLCE 2Z6DA 3VP1A 2VGKA 3T4QA 4JF5A 3NOPC 3N8RA 2V0WA 3LYXA 3VOLA 3TG9A 3CG5A 3D3OA 2P7JA 2HP9A 3HJIA 3GSGA 4QJGA 2HDRA 5F6AA 3M6BA 5HL1A 5CEBA 4RYEA 4OOMA 2WKQA 4UA9A 3PXPA 3B47A 3QHYA 4U0XA 3E98A 1ONGA 3LR0A 4N9KA 1S4SA 3DWZA 1JNUA 1W63M 3GECA 4Q0IA 1YQSA 1W79A 1ODVA 4ME4A 1NRJA 4S2PA 2VEAA 1VETB 4WLAA 2XR0A 1F9IA 1Q2QA 5EM0A 5FAOA 1OMEA 3CUEC 3K3DA 4JGOA 2EX2A 5EVEA 2FFYA 2ZBBA 5CGWA 4LGWA 3IX3A 1F98A 5EVIC 1ERQA 2J8YA 3UDIA 4R1GA 5HAQA 2UV0E 2HDSA 3F1NA 1XGJA 2VZWA 5CECA 1G68A 1VEUA 3VE4A 1XA7A 2JKFA 3BWLA 2ZMFA 3Q82A 4JKTA 3W8KA 3T4KA 1GHMA 2VGLS 1AWIA 3ZQ5A 4LRZE 2Y2MA 4K0XA 3K2NA 2Y2HA 4E3IA 2QMIA 2EXAA 2Y2IA 4C75A 4X25A 2WKIA 1DJCA 3BLMA 3SW1A 2KX6A 3N8SA 3WRTA 2OWJA 3U4LP 1E3UD 3T12B 5GL9A 1K54A 4II7A 3PAGA 4LV3A 4JXSA 3MQQA 4EQIA 2J7VA 5GHXA 2NUTC 4OPRA 2Y91A 4BJPA 3B3XA 5FQIA 2GDNA 3FYZA 1FSYA 5EVIB 3FKWA 1KVLA 3MFXA 3SS5A 4PHTA 3IQAA 2A2LA 2PD8A 5KSCA 4I39A 4NEED 4EBPA 1D06A 1U60A 4BBUA 1D1JA 4LPZA 4RX2A 3UO9A 3DW0A 5FI6A 5FEGA 4MN5A 2O9CA 4JXWA 5FI2A 3H9WA 5AVFA 2ZMAA 2HGVA 1LL9A 1K25A 3G31A 1F5MA 2VK3A 2Y2OA 3IH9A 1YT4A 4RX3A 3MSHA 3MZDA 1EROA 2W3EA 2AVXA 2L1MA 5EUAA 2PAVP 3HLBA 1NZUA 2PRFA 1WYCA 5FQQA 4Y0UA 3H82B 4XT2B 1DJAA 1WA9A 1YSPA 4QD4A 2ZM2A 2C5WB 4IBXA 4OKPA 2JN7A 4RVAA 4FUWA 1T1BA 2L0WA 4K0WA 4DDSA 3HBRA 2XEPA 1T1AA 1GA0A 4KQDA 2OV5A 3VSLA 3UB6A 5TFQA 2XSSA 1SZVA 3BY8A 3DTKA 2VV6A 5IHVA 3R7WB 3BM6A 2W0NA 1TVFA 4GJ4A 2XD5A 3T1SA 3ZHHA 4FD8A 4KZBA 1ZG6A 2EFUA 1KGEA 2HP5A 3SH9A 4I5SA 2X02A 3IBRA 2Q0OA 2JKTI 3JPUA 5I5LA 4OPZA 1MKIA 1PZOA 1SKFA 4IUKA 3FV7A 5L10A 2ZOIA 1DP8A 3ISGA 2W1TB 1YLWA 5L09A 1CK3A 1I2SA 2Q9NA 4OQ0A 4WEJA 2Y2QA 3V3RA 3E4QA 5F82A 4DE0A 1CF0A 3G34A 1RP5A 4S2NC 1LHYA 4S2OA 3UDXA 3FPWA 1T19A 3UMDA 3GR2A 2O9BA 4EU0A 4B4XA 3A3FA 1GSWA 3VOYA 4WL9A 1L0DA 3ZVTA 1LI0A 5GLAA 2ZC3B 1ZC2A 3EGXC 2H0YA 4Y0OA 1N9LA 2QJ7A 2HJ9C 3G32A 1DP9A 3S1YA 4BBTA 1DRMA 5FI7A 4KG5A 4OOYA 3V39A 3WS5A 5DF7A 4RA7A 3IF6B 2PYPA 5TGFA 3M6HA 1K4EA 5FDHA 3O88A 4HESA 4E3NA 1MBLA 4PM8A 1NYMA 1MWTA 2VKSA 4PMAA 2J9PA 3UPPA 2XDMA 3JYIA 5HDSA 2D01A 3LIEA 3T1QB 1FQGA 1IEMA 4EQ1A 1I5QA 1SKOA 3UB5P 2I9VA 3GDIA 4X56A 1XA1A 2WUQA 2WGVA 4K91A 1FR1A 3LY3A 1PRQA 4FTXA 4CQHA 2W27A 3MMHA 2WZZA 5FQ9A 2BTFP 2WADA 4KZ8A 3QNBA 5HFOA 2XK1A 1JWVA 3S7NA 3FC7A 1D7EA 3OOVA 1JVJA 2ZM0A 4HI4A 5FQJA 2BLSA 5DTSA 4QWOA 3E4OA 1S66L 3OBFA 2PU2A 1OTBA 1G6AA 3H82A 4ZJ2A 2EX9A 3GTCA 2Y2JA 3PTEA 5HWTA 1KGFA 4GZBA 5TJJA 3G2ZA 1KE0A 2J3WA 4E3OA 3VMAA 2R9WA 2EXBA 4N1HA 3C4PA 5HWVA 5U47A 1YPRA 1WYBA 2H0TA 5M18A 4Z9QA 3NDGA 3ZG5A 4AFIA 1Y54A 1G5UA 5M1AA 2GZAA 4DE2A 2J80A 1N9NA 3IHBA 4ESPA 4P6BA 1OT9A 3KYEA 2PHYA 2VGJA 5CHJA 1NRFA 5GLBA 3KSHA 3LI8A 3UN7A 1HVBA 4F3LB 2PDRA 4R3JA 1BLCA 1GHPA 4WYYA 2P9VA 4O01A 3NDEA 4LV2A 5A90A 5FATA 4X1LA 3HLDA 3NHQA 3OPLA 3LIBA 5M19A 1RCJA 2V2FF 4KZ7A 1E4DA 4DE1A 4CLCB 4PM9A 3PR6A 4JPMA 4R23A 2WGIA 1BLPA 1MXOA 4ARZA 4EWFA 4GN2A 3D9YA 2A24A 3T1RA 2O0YA 3F1PA 3TW8A 4BBVA 4ZAMA 4EEPA 4BL3A 4HNBA 1K38A 3IHAA 4LCLA 4R4SA 5AQ9A 2IWDA 5HPIA 1HTZA 5HL6A 3KX0X 2VLGA 4PM7A 2A49A 3UE3A 3PBSA 2OAQ1 4U3TA 1OTEA 2WGWA 5IT5A 1H8MA 4MMNA 1XP4A 3BFGA 3UDFA 1TDGA 4R3BA 1GSXA 1WE4A 1XX2A 5HAIA 2GJ3A 4H6JB 3EEHA 4KQOA 4S2MA 2XD1A 3P01A 1K0KA 1OTIA 3GVBA 1TS7A 1H3QA 3T4SA 4MBFA 4X69A 5HD3A 5JYOA 4HY8A 4DMZA 2Y59A 4Y5FA 5HD5A 1K57A 4N9LA 5K5BA 5EV0A 4OP5A 5G4ZA 3IS2B 4HEFA 2CC1A 4OVDA 3LUQA 4MBHA 3W4OA 3ZG7B 5TBMB 4OQHA 4XUXA 5FASA 3ITAA 3OPHA 1J3WA 3MJQA 3O5YA 5CXWA 3Q7ZA 4PM5A 3LICA 1P9RA 2ZJ9A 2JHEA 2K7SA 4WZ4A 2W3DA 3RH8B 3A0SA 1TD5A 1YMXA 1OTDA 4FSFA 3O3VA 5F1GA 5CGXA 1CQAA 4FH2A 4LCMA 1ES5A 2M7VA 3NJAA 1FIKA 3NOUC 2B5RA 5HPFA 1JWPA 4NXEA 2PU4A 1YM1A 3E2KA 1W8QA 2Y2LA 3NY4A 1ZTUA 4DJ2A 2WAFA 1YLPA 3ZGAB 4EUZA 3D72A 3HVFA 3PYPA 3ZDJA 4KUOA 1M6KA 1PWDA 4OH0A 3HREA 1BSGA 3ZFZA 3O87A 3A3IA 4F94A 4U0TA 5CEDA 4LFUA 5DF9A 3BRMA 2MJ6A 1SDNA 5GHYA 5HDDA 5FDSA 4MCWA 2O99A 4GKUA 1FCMA 1DP6A 3KSFA 5CX7A 4X6TA 3LIDA 5EOOA 1S67L 1XFQA 1SDEA 4DXBA 1KVMA 3IXDA 2QYBA 1CEFA 3N4IA 4M4XA 2X71A 3QP4A 4ZBEA 3EGDC 4EETB 3OPPA 2KOIA 3PAEA 4B4ZA 3VP4A 2Y55A 3H7WA 3Q7VA 2H10A 5HZHA 3GV9A 4PAUA 1VM1A 2OAP1 1BT5A 1S0WA 2WYXA 4R4RA 4MBKA 1DY6A 1F2KA 1TF1A 1CEGA 4F3LA 1FR6A 3CJMA 3V50A 3WWXA 3JVVA 3C7UA 2HJEA 3PBQA 4LV1A 2H5SA 5IU1A 4HBTA 1OJ5A 3N7WA 4JXVA 3BYDA 1L3LA 4CLCA 1LLBA 5F5YA 3A3DA 3QP1A 1IYPA 1LSXA 4GCZA 1VB6A 2QPNA 3F1OB 3LR3A 4C6YA 2H28A 3KSIA 4E3KA 1K4FA 2Y2KA 2ZL1A 1PNEA 3MZEA 3D4FA 4QY5A 3FZCA 3CPTA 4N1XA 1MZUA 1PWCA 3EQVA 3CLOA 4UAAA 3LEZA 3EQUA 1TEMA 3UB7A 3IWOA 1S4RA 3MS6A 2Y4AA 4HH3A 4RQ9A 4NK3A 1LL5A 1MWSA 3I7JA 2KLIA 1GSVA 4BD1A 4H6JA 4OP8A 1ACFA 3LFVA 5GLCA 3LIFA 5A91A 1KOUA 2W3HA 2ZQCA 4Q0JA 3CWFA 5GHZA 3BFCA 4NXGA 5EM1A 2ZQ9A 4S2LA 1P9WA 4YFMA 4KZ5A 1T18A 1Q2PA 1FOFA 3W4PA 4HJ3A 3P09A 1PI4A 3KSGA 3IH8A 3NCKA 3IXHA 3CI6A 3LCEA 3QNCA 3IX8A 4GD6A 5TBMA 3SH7A 5EECA 1VETA 4S2IA 3VE3A 2XFSA 1V9ZA 4HH2A 4IVKA 3Q81A 3UB8A 1KE4A 3HLCA 2ZM8A 5AQ7A 4MNRA 1K55A 3ZG9B 1K57C 3NBLA 5FSRA 3DTIA 4P85A 1GA9A 2X01A 2PBDP 5DKKA 2KDKA 1UGUA 5C5KA 2JC7A 2QHKA 3T50A 3WRZA 1W5DA 4IBRA 3S22A 4DJ3A 2B95A 2ACGA 1J9MA 2V1AA 4Y2FA 4QB8A 1MWUA 1XJ2A 4GDBA 3CAXA 1NXYA 5EVLA 4UA7A 3AGFA 3UE1A 4C3QA 1NYYA 4E6WA 2L4RA 4L9FA 2ZC6B 3PBRA 4OLGA 2UWXA 5G4YA 3BFEA 4Y17A 3B42A 5EE8A 3MR0A 1H8YA 1CI8A 3NULA 4L0LA 3OZHA 3PBOA 4X53A 1IKIA 3VV4A 2XA7M 4O8GA 4JF4A 3DTEA 3T4OA 3UE6A 2JCHA 5CTNA 3BJNA 1IYOA 4R38A 5E2EA 1VHMA 4OLDA 5L07A 2OOLA 3LI9A 1HLUP 5AVEA 2XLNA 3LY4A 4R0QA 3C8CA 3CUEA 5A93A 3KO6A 4GOGA 4ZTKA 5EVIA 3NI9A 4HJ6A 3HLWA 2P04A 4NETA 1YKDA 1K54C 4NXBA 4S2JA 4BMWA 2QWSA 2YKFA 4EW7A 1I2WA 4DKIA 4O0PA 3SOIA 1EI5A 4BLMA 1XFNA 4HBUA 4G3VA 4IJGA 3IX4A 3IF5A 4EERA 5CGSA 4OOLA 5CTMA 2JKRM 1FCNA 2OSUA 3UPOA 1O7EA 5DTTA 5FQMA 3F1OA 3IT9A 4WN5A 2JKRI 3C2WA 1N9OA 3TRCA 1MWRA 2G2WA 3AGDA 4PKYA 3F1NB 4N92A 1CJFA 5J3WA 3CITA 4OPYA 2DNSA 4GB7A 2DCFA 3C38A 5LBRA 4YNRA 3W2ZA 2YKHA 1CI9A 1P0ZA 1PZPA 1VEUB 4UQIM 3FWLA 2XFTA 2XROA 2XF3A 4XT2A 3L9KA 3E0YA 4FH4A 4E3JA 3OCNA 3UY6A 1XXMA 4DF6A 3RFBA 4KZ3A 3NECA 1RGZA 2BG1A 2ZC4B 1YLZA 5E43A 1YSQA 3N6IA 5CRFA 4B9OA 4HOIA 4ETZA 4YWZA 3NC8A 4LRXC 2HDQA 3ZYTA 3BQ8A 2G7UA 4EBNA 1EW0A 3BECA 1C3BA 3ZG0A 3R7WA 4GHIB 1NZOA 3HJKA 2VV8A 2PR5A 3QP8A 4P0MA 3MF0A 3K3CA 2WKHA 2Z2MB 3T4LA 1YMSA 1Y28A 4ZDXA 1L0FA 1L2SA 2XH9A 3MZFA 1ES2A 2JE5A 3MXSA 2EX6A 1BTLA 1OT6A 5GLDA 1FILA 2HZ5A 3BFFA 3IXBA 1PIOA 1W8YA 4R70A 3WS4A 5J4EA 3VP3A 2W1TA 1LSVA 2EWWA 1XJ4A 4B88A 4WELA 2EX8A 5FL3A 4DRTA 1XGIA 4KQQA 3A0VA 4EV4A 1LI9A 3TOIA 3L7HA 1ES4A 5HWWA 3DAVA 1O07A 2INWA 2ZC7A 2LB9A 4HP9A 2XGNA 2RL3A 1TS0A 1XKZA 1G28A 3HLGA 1G6OA 3DBAA 4IVIA 5J7EA 4KUKA 5A8BA 4KZAA 5EVID 3A3EA 4XUZA 2Z2LB 5KSHA 1JWZA 2ZMVA 3HL9A 3LGOA 4WF0A 3VOZA 4MN6A 3SS3A 2ZOHA 3WS0A 3G4PA 4WZ5A 3UNWA 3VP0A 4YINA 3BFDA 4NXFA 4Y0TA 3P98A 4BL2A 3IXGA 1P97A 3IF6A 1PI5A 4E3MA 2V1BA 3BY9A 3G30A 1IYSA 5I94A 4O7DA 1UWNX 2V8CA 3PHYA 5DJTA 3HLFA 4UEYA 3MKEA 2E8IA 4NG2A 1QMEA 4MEZA 4P6ZM 3VSKA 1H5XA 5HDCA 3S4XA 1ESIA 3G35A 2ZD8A 4IUHA 2Y2NA 1BZAA 4BQMA 2EWVA 1W63Q 3A0RA 3T4JA 2PYRA 2VGLM 2WKRA 2V0UA 3IWQA 4GLQA 4JGRA 1QMFA 1HD8A 4S2NA 1FCOA 4Y15A 4HIAA 3T1XA 5CERA 1L0EA 1UWPX 1H0MA 3ZNYA 2ZLYA 3UB9A 1PW8A 4GS9B 4WM9A 3OCLA 4P6ZS 1ZHHB 4ETXA 1SHVA 1PWGA 2J9OA 5BOHA 1S1YA 4I3IA 2Y2GA 2FFFB 1XPBA 1IOUA 1OJGA 5CHUA 2VA0A 1PFLA 3JVUA 4E04A 1A0KA 3CZDA 5EOEA 1K56A 4JGPA 1NWZA 5FA7A 4CJNA 2W3GA 1NJ4A 3OPRA 3CHWP 4P87A 5FAPA 4EESA 4GHIA 1NY0A 3TSGA 4BENA 1Z6FA 2V9AA 3CMZA 3RXWA 3ZVWA 2QJ5A 3QP2A 1BLSA 2DMWA 5HAPA 3ITBA 2J3TD 1JTDA 3A3JA 5DJUA 5FEFA 5HW3A 3GMWA 4WUJA 1MC0A 4QY6A 2GX5A 2Y79A 4L9EA 1BUEA 2HF6A 3PBNA 5KZHA 5L8MA 5FAQA 4K08A 3KYZA 4Q8IA 1ZKJA 2WZXA 4DXCA 2XRNA 1SKOB 1H8ZA 2ZQ8A 3C7VA 3G6OA 3MXQA 4JXGA 3FPVA 2Y2PA 5KIZA 1KE3A 1IELA 3B33A 5DKLA 2Z6CA 2PBYA 1IFQA 2V1ZA 5DFYA 4IHQA 2JKGA 2D02A 3BEBA 3R4KA 5A92A 2OWHA 1IYQA 4Q0HA 4BWIA 2HP6A 3IBJA 4EEUA 4M3KA 1EWZA 1OPXA 3S7QA 2A3UA 1BULA 1KGGA 4WEKA 3G2YA 2OLUA 2FH5A 4R3AA 4Y13A 5MC7A 2G2UA 4DN0A 4WMCA 4EBLA 2DRWA 5E2FA 4D60A 4JBFA 4JLFA 4NKPA 4KZ6A 3Q1FA 2ZQAA
chains in the Genus database with same CATH topology
4HJ6A 2J3TC 2P04A 3T4KA 2O9AA 4ARZA 1LSWA 1YKDA 2WKPA 3T4TA 2VGLS 4NXBA 3ZQ5A 4BMWA 4LRZE 2A24A 2FZ0A 2O0YA 3F1PA 3IS2A 3TW8A 4BBVA 3K2NA 4G3WA 2QWSA 2YKFA 4EEPA 4EW7A 4HNBA 4O0PA 1XFNA 5HPIA 4G3VA 4IJGA 5HL6A 3SW1A 3KX0X 1NLZA 5IS1A 2KX6A 2OWJA 2VLGA 4EERA 4OOLA 1XJ3A 2JKRM 3UE3A 2B18A 3PBSA 2IA2A 1OTAA 2OAQ1 3F1OA 1OTEA 5IT5A 1H8MA 4II7A 4MMNA 2LB5A 2JKTM 4WN5A 2JKRI 3C2WA 1N9OA 3TRCA 5F69A 4PKYA 5AJGA 3F1NB 1GSXA 3MQQA 5J3WA 3CITA 3ULFA 4HP4A 2GJ3A 2NUTC 4H6JB 3EEHA 4KQOA 2PR6A 3C38A 5LBRA 3P01A 4YNRA 1OTIA 3V67A 2YKHA 1P0ZA 4UQIM 3W2ZA 4BJPA 1LT0A 1TS7A 1NLYA 1H3QA 4LLOB 3T4SA 2XROA 5HD3A 3FG8A 4XT2A 3E0YA 4HY8A 1X0OA 3MFXA 4PHTA 4DMZA 3OCNA 4ARZB 4Y5FA 2A2LA 3NOTC 5HD5A 4GS9A 1MKMA 5K5BA 2PD8A 2A24B 4I39A 3F1PB 4NEED 3IS2B 5G4ZA 3RFBA 1YSQA 1D06A 2PT7A 3LUQA 4QPRA 4B9OA 4BBUA 4HOIA 4ETZA 4YWZA 5TBMB 4LRXC 4LPZA 3ZYTA 3BQ8A 3P7NA 1YAXA 4Y3IA 2G7UA 3UMEA 2M1CA 3MJQA 3O5YA 4MN5A 1EW0A 3ICYA 3LICA 2O9CA 3R7WA 4GHIB 1P9RA 2VV7A 2JHEA 3HJKA 3H9WA 2K7SA 5AVFA 1TS6A 2W3DA 2HGVA 2VV8A 3A0SA 1TD5A 2PR5A 3RH8B 4G3KA 3TE8A 3BQAA 1T1CA 3C30A 4I3JA 1F5MA 1OTDA 2HV1A 2QKPA 4FSFA 4CLCD 4JGQA 4HQAA 3MF0A 2M7VA 3E4PA 3NJAA 3K3CA 2W3EA 4HHDA 3T4LA 3NOUC 2L1MA 5HPFA 4MN7A 4NXEA 1Y28A 1V9YA 4L9GA 3BW6A 1ZTUA 3TJZC 4DJ2A 3H82B 3D72A 1OT6A 4XT2B 3PYPA 1YSPA 1WA9A 4KUOA 2GNXA 4R70A 4EUVA 2VX8A 5J4EA 3PBTA 3MQOA 2JN7A 2W1TA 1LSVA 2EWWA 1XJ4A 4WELA 5FL3A 1T1BA 2L0WA 3A0VA 5DF9A 2MJ6A 2XA7S 1T1AA 4I38A 3S7PA 4KQDA 5HDDA 4MCWA 3UB6A 2O99A 5HWWA 2XSSA 1DP6A 2INWA 2LB9A 3BY8A 3KSFA 2VV6A 5CX7A 4HP9A 3R7WB 2W0NA 1TS0A 3LIDA 4GJ4A 1S67L 1XFQA 3S7OA 1G28A 1G6OA 3DBAA 5J7EA 4KUKA 5A8BA 2QYBA 3OLOA 4M4XA 2NUPC 4I5SA 3LR5A 5KSHA 1XJ6A 4PKYG 3EGDC 3IBRA 2ZMVA 4EETB 4WF0A 2KOIA 2JKTI 4MN6A 5I5LA 2ZOHA 3EWKA 3H7WA 5HZHA 4CLCC 4PAUA 4IUKA 2OAP1 2PD7A 4NXFA 2ZOIA 3U2AA 1DP8A 1TF1A 1P97A 2VJWA 4F3LA 2V1BA 3BY9A 3JVVA 2HJEA 3PBQA 2W1TB 1UWNX 4GW9A 5IU1A 1OJ5A 4Z1WA 1S1ZA 3PHYA 5DJTA 4WEJA 2P08A 4UEYA 1LL8A 2EA9A 4CLCA 5F5YA 3E4QA 1LSXA 4P6ZM 4GCZA 1VB6A 2W1RA 4B93A 5F68A 3FPWA 1T19A 3UMDA 2R78A 5HDCA 3F1OB 3LR3A 2O9BA 4EU0A 4IUHA 1TS8A 1GSWA 2H28A 3KSIA 4UQIS 2EWVA 1W63Q 4WL9A 3A0RA 3T4JA 2PYRA 4MDZA 2VGLM 2WKRA 3EGXC 2V0UA 1N9LA 2QJ7A 4GLQA 1STZA 3H7WB 4I3AA 4JGRA 2HJ9C 1DP9A 4R6LA 4HIAA 4BBTA 1DRMA 4ZRRA 4LRYC 1MZUA 3EQVA 3CLOA 2Y8HA 3EQUA 1UWPX 3LIAA 3UB7A 1S4RA 2PYPA 4HH3A 4RQ9A 3UB9A 5HSQA 2KLIA 4GS9B 1GSVA 3KYQA 3OC2A 4EXOA 3OCLA 4HJ4A 4P6ZS 2BASA 4FOFA 5DFXA 4H6JA 1ZHHB 4ETXA 3EEAA 2B02A 3LFVA 3LIFA 1S1YA 2VKSA 4I3IA 1KOUA 2W3HA 4Q0JA 3CWFA 5EFWA 5HDSA 2D01A 1IOUA 4NXGA 1OJGA 2VA0A 3LIEA 1P9WA 4EQ1A 1BYWA 3JVUA 1T18A 2K31A 4E04A 2I9VA 3GDIA 3LR4A 4HJ3A 2CMNA 3KSGA 2W3FA 2K2NA 3EOIA 4JGPA 3CI6A 2M7UA 1NWZA 2W3GA 5TBMA 4CQHA 2W27A 3VE3A 3MMHA 1V9ZA 4HH2A 3UB8A 4EESA 3RTYA 4YOFA 3MQ0A 4GHIA 3HCYA 4CLCE 2Z6DA 2V9AA 3S7NA 3FC7A 3T4QA 1D7EA 3NOPC 3OOVA 5DKKA 2QJ5A 2V0WA 2KDKA 3LYXA 1UGUA 4HI4A 3D3OA 3VOLA 5C5KA 2DMWA 2P7JA 2J3TD 3HJIA 5DJUA 2QHKA 3E4OA 1S66L 3OBFA 5F6AA 3T50A 4WUJA 1MC0A 4DJ3A 2GX5A 2Y79A 4L9EA 4OOMA 2WKQA 1OTBA 2HF6A 2V1AA 3H82A 3PBNA 3PXPA 3B47A 5L8MA 4Y2FA 4K08A 3E98A 1XJ2A 5HWTA 3CAXA 3KYZA 3LR0A 5TJJA 2XRNA 1S4SA 2J3WA 3G6OA 1JNUA 3MXQA 2L4RA 1W63M 3FPVA 4L9FA 5KIZA 3PBRA 3GECA 4Q0IA 3B33A 5G4YA 1ODVA 4ME4A 5DKLA 1NRJA 2Z6CA 5HWVA 2VEAA 1IFQA 3B42A 3MR0A 4WLAA 5DFYA 4IHQA 2D02A 1F9IA 3R4KA 4AFIA 3K3DA 3CUEC 2OWHA 4JGOA 4Q0HA 2ZBBA 4L0LA 4BWIA 2GZAA 2J80A 1F98A 1N9NA 3IBJA 3PBOA 4EEUA 1OPXA 3VV4A 2XA7M 3S7QA 4O8GA 1OT9A 2PHYA 3KSHA 3LI8A 4WEKA 4F3LB 2PDRA 3T4OA 3UE6A 3F1NA 2FH5A 4R3AA 3BJNA 4O01A 4R38A 1VHMA 5MC7A 2OOLA 3LI9A 2VZWA 4DN0A 3NHQA 3LIBA 5AVEA 3C8CA 3CUEA 3VE4A 3BWLA 3KO6A 4NKPA 4CLCB 2ZMFA 3PR6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HJ6 A;  1LSW A;  2WKP A;  4NXB A;  3ZQ5 A;  4LRZ E;  2A24 A;  3F1P A;  3IS2 A;  4BBV A;  2QWS A;  2YKF A;  4EEP A;  4EW7 A;  4HNB A;  1XFN A;  3SW1 A;  3KX0 X;  5IS1 A;  2KX6 A;  2OWJ A;  2VLG A;  4EER A;  1XJ3 A;  1OTA A;  3F1O A;  1OTE A;  4WN5 A;  3C2W A;  1N9O A;  5F69 A;  4PKY A;  3F1N B;  1GSX A;  3MQQ A;  5J3W A;  3ULF A;  4HP4 A;  2GJ3 A;  4H6J B;  3EEH A;  2PR6 A;  1OTI A;  2YKH A;  1P0Z A;  1LT0 A;  1TS7 A;  4LLO B;  5HD3 A;  3FG8 A;  4XT2 A;  4HY8 A;  1X0O A;  3MFX A;  3NOT C;  5HD5 A;  4GS9 A;  2PD8 A;  2A24 B;  4I39 A;  3F1P B;  5G4Z A;  3IS2 B;  3LUQ A;  1D06 A;  4B9O A;  4BBU A;  4HOI A;  4YWZ A;  5TBM B;  4LRX C;  4LPZ A;  3P7N A;  3UME A;  2M1C A;  3MJQ A;  4MN5 A;  1EW0 A;  3ICY A;  3LIC A;  4GHI B;  2VV7 A;  2JHE A;  3HJK A;  3H9W A;  2K7S A;  5AVF A;  1TS6 A;  2VV8 A;  3RH8 B;  3A0S A;  2PR5 A;  4I3J A;  1T1C A;  1OTD A;  2HV1 A;  2QKP A;  4JGQ A;  4HQA A;  3E4P A;  3NJA A;  3K3C A;  4HHD A;  3NOU C;  2L1M A;  4NXE A;  1Y28 A;  1V9Y A;  4L9G A;  4DJ2 A;  3H82 B;  3D72 A;  1OT6 A;  4XT2 B;  3PYP A;  1WA9 A;  4KUO A;  4R70 A;  5J4E A;  3MQO A;  2JN7 A;  1LSV A;  1XJ4 A;  1T1B A;  2L0W A;  3A0V A;  1T1A A;  4I38 A;  4KQD A;  5HDD A;  3UB6 A;  5HWW A;  1DP6 A;  2INW A;  3BY8 A;  2VV6 A;  4HP9 A;  2W0N A;  1TS0 A;  3LID A;  1S67 L;  1XFQ A;  1G28 A;  5J7E A;  4KUK A;  5A8B A;  3OLO A;  4M4X A;  4I5S A;  1XJ6 A;  4PKY G;  3IBR A;  4EET B;  4WF0 A;  4MN6 A;  5I5L A;  2ZOH A;  3EWK A;  3H7W A;  5HZH A;  2PD7 A;  4NXF A;  2ZOI A;  1DP8 A;  1P97 A;  4F3L A;  2V1B A;  3BY9 A;  1UWN X;  4GW9 A;  5IU1 A;  1OJ5 A;  1S1Z A;  3PHY A;  5DJT A;  1LL8 A;  2EA9 A;  5F5Y A;  3E4Q A;  1LSX A;  4GCZ A;  1VB6 A;  5F68 A;  1T19 A;  3UMD A;  2R78 A;  5HDC A;  3F1O B;  1TS8 A;  1GSW A;  2H28 A;  4WL9 A;  3A0R A;  2PYR A;  2WKR A;  2V0U A;  1N9L A;  2QJ7 A;  3H7W B;  4I3A A;  4JGR A;  1DP9 A;  4R6L A;  4HIA A;  4BBT A;  1DRM A;  4LRY C;  1MZU A;  3CLO A;  1UWP X;  3LIA A;  3UB7 A;  1S4R A;  2PYP A;  4HH3 A;  4RQ9 A;  3UB9 A;  5HSQ A;  4GS9 B;  1GSV A;  4EXO A;  4HJ4 A;  2BAS A;  4H6J A;  2B02 A;  3LIF A;  1S1Y A;  4I3I A;  1KOU A;  3CWF A;  5EFW A;  5HDS A;  2D01 A;  4NXG A;  1OJG A;  3LIE A;  4EQ1 A;  1BYW A;  1T18 A;  4E04 A;  2I9V A;  3GDI A;  4HJ3 A;  2CMN A;  4JGP A;  1NWZ A;  5TBM A;  2W27 A;  3VE3 A;  1V9Z A;  4HH2 A;  3UB8 A;  4EES A;  3RTY A;  4GHI A;  2Z6D A;  2V9A A;  3FC7 A;  1D7E A;  3NOP C;  5DKK A;  2QJ5 A;  2V0W A;  2KDK A;  3LYX A;  1UGU A;  4HI4 A;  3VOL A;  2P7J A;  3HJI A;  5DJU A;  2QHK A;  3E4O A;  1S66 L;  3T50 A;  5F6A A;  4WUJ A;  4DJ3 A;  4L9E A;  2WKQ A;  1OTB A;  2V1A A;  3H82 A;  4K08 A;  1XJ2 A;  5HWT A;  3CAX A;  1S4S A;  3G6O A;  1JNU A;  3MXQ A;  2L4R A;  4L9F A;  5KIZ A;  3GEC A;  3B33 A;  5G4Y A;  1ODV A;  5DKL A;  2Z6C A;  5HWV A;  2VEA A;  3MR0 A;  4WLA A;  2D02 A;  1F9I A;  3K3D A;  4JGO A;  2OWH A;  2ZBB A;  2J80 A;  1F98 A;  1N9N A;  4EEU A;  1OT9 A;  2PHY A;  3LI8 A;  4F3L B;  2PDR A;  3UE6 A;  3F1N A;  4R3A A;  4R38 A;  2OOL A;  3LI9 A;  3NHQ A;  3LIB A;  5AVE A;  3C8C A;  3VE4 A;  3BWL A; 
#chains in the Genus database with same CATH topology
 1M40 A;  4S2K A;  2J3T C;  2O9A A;  1LSW A;  2WKP A;  3T4T A;  3QP5 A;  2FZ0 A;  3IS2 A;  1K6R A;  4G3W A;  4Y7P A;  1KDS A;  3IWI A;  2JBF A;  5JYP A;  2ZC5 B;  4KEN B;  4WZ5 C;  3GQZ A;  1NLZ A;  5IS1 A;  1ALQ A;  4FCF A;  2QZ6 A;  1ES3 A;  1XJ3 A;  2B18 A;  2IA2 A;  1OTA A;  2P74 A;  4KG6 A;  3IF6 C;  3M2K A;  2LB5 A;  2JKT M;  1VQQ A;  3V3S A;  5L2F A;  5F69 A;  1KDW A;  1W7F A;  2OLV A;  4H8R A;  2P9V B;  5AJG A;  5D3O A;  3ULF A;  4HP4 A;  3HUM A;  1N4O A;  2PR6 A;  1K56 D;  1FSW A;  3VFH A;  4UA6 A;  3V67 A;  1LT0 A;  1NLY A;  4LLO B;  4JF6 A;  3FG8 A;  4GNU A;  1ZG4 A;  4X1M A;  3RXX A;  1X0O A;  3ZG8 B;  1ERM A;  4GD8 A;  4ARZ B;  3NOT C;  4GS9 A;  4X68 A;  1MKM A;  4PM6 A;  2C6W B;  2A24 B;  3F1P B;  4OPQ A;  2V20 A;  1Z09 A;  4OON A;  2PT7 A;  3HLE A;  4QPR A;  2HDU A;  4A5R A;  3VP2 A;  3P7N A;  1MPL A;  1DJB A;  1YAX A;  4Y3I A;  3SH8 A;  3UME A;  2M1C A;  3NIA A;  4OQI A;  4LEN A;  4ZJ3 A;  3ICY A;  2VV7 A;  2WGW B;  3E2L A;  1TS6 A;  4E6X A;  4G3K A;  3TE8 A;  1T1C A;  3BQA A;  3C30 A;  4I3J A;  2HV1 A;  2QKP A;  4CLC D;  1YLY A;  4JGQ A;  4HQA A;  3SS4 A;  3E4P A;  4HHD A;  4ID4 A;  4KQR A;  4LV0 A;  4MN7 A;  1V9Y A;  4L9G A;  5E2G A;  1MY8 A;  1ONH A;  1YLJ A;  3BW6 A;  3TJZ C;  1AXB A;  4WBG A;  2GNX A;  3UPN A;  3V5M A;  3WS2 A;  4EUV A;  2VX8 A;  5G18 A;  3PBT A;  2WK0 A;  3MQO A;  4KZ9 A;  4PPR A;  2HPB A;  4ZJ1 A;  3AGE A;  2XA7 S;  4I38 A;  4KZ4 A;  3S7P A;  2I72 A;  2ZQD A;  4WMC D;  1Y4O A;  4E3L A;  3HUO A;  3S7O A;  1TDL A;  3C5A A;  3OLO A;  2NUP C;  3LR5 A;  1XJ6 A;  4PKY G;  4D2O A;  1E25 A;  3N8L A;  3EWK A;  2Q9M A;  4CLC C;  2PD7 A;  1GCE A;  5DF8 A;  1BLH A;  5HX9 A;  3U2A A;  2E8J A;  2VJW A;  2V8F A;  3HUN A;  5DTK A;  5AQB A;  3ZNT A;  1JTG A;  4GW9 A;  4Z1W A;  1S1Z A;  4GDN A;  5F1F A;  2P08 A;  3WS1 A;  1LL8 A;  2EA9 A;  3O86 A;  2RCX A;  3FKV A;  3UE0 A;  5J8X A;  2W1R A;  3ZCZ A;  4B93 A;  5F68 A;  4UHU A;  5KMW A;  2R78 A;  4IED A;  3BLS A;  3Q07 A;  5EPH A;  1TS8 A;  4UQI S;  4MLL A;  2ZQ7 A;  4X55 A;  1L0G A;  1PYY A;  3MXR A;  3RJU A;  4MDZ A;  1ESU A;  2IWC A;  3DWK A;  5HAR A;  1STZ A;  3H7W B;  3Q7V B;  4I3A A;  1HZO A;  5AQA A;  4R6L A;  4DE3 A;  3VFF A;  4ZRR A;  4LRY C;  1YLT A;  2R9X A;  4BD0 A;  4DDY A;  3DTM A;  2Y8H A;  3LIA A;  2XQZ A;  3MBZ A;  3SZT A;  5HSQ A;  2WAE A;  2IWB A;  3QP6 A;  4KG2 A;  3KYQ A;  3OC2 A;  4EXO A;  4HJ4 A;  1E3U A;  2BAS A;  4FOF A;  5DFX A;  5CHM A;  5E2H A;  3EEA A;  4XXR A;  2B02 A;  1SCW A;  4QHC A;  4CPK A;  5EFW A;  4QU3 A;  1IKG A;  1PW1 A;  1S6R A;  3C4O A;  3MFD A;  3GRJ A;  1BYW A;  5FQK A;  2WKE A;  1K55 C;  2K31 A;  3LO7 A;  4OQG A;  3LR4 A;  2CMN A;  2W3F A;  2K2N A;  5DVA A;  3EOI A;  2M7U A;  1RGY A;  5F83 A;  2EFX A;  2ZL1 B;  5TR7 A;  3MKF A;  3M2J A;  1GHI A;  1K6S A;  3RTY A;  3W4Q A;  3CPT B;  4YOF A;  3MQ0 A;  1N9B A;  3LEQ A;  3HCY A;  4CLC E;  2Z6D A;  3VP1 A;  2VGK A;  3T4Q A;  4JF5 A;  3NOP C;  3N8R A;  2V0W A;  3LYX A;  3VOL A;  3TG9 A;  3CG5 A;  3D3O A;  2P7J A;  2HP9 A;  3HJI A;  3GSG A;  4QJG A;  2HDR A;  5F6A A;  3M6B A;  5HL1 A;  5CEB A;  4RYE A;  4OOM A;  2WKQ A;  4UA9 A;  3PXP A;  3B47 A;  3QHY A;  4U0X A;  3E98 A;  1ONG A;  3LR0 A;  4N9K A;  1S4S A;  3DWZ A;  1JNU A;  1W63 M;  3GEC A;  4Q0I A;  1YQS A;  1W79 A;  1ODV A;  4ME4 A;  1NRJ A;  4S2P A;  2VEA A;  1VET B;  4WLA A;  2XR0 A;  1F9I A;  1Q2Q A;  5EM0 A;  5FAO A;  1OME A;  3CUE C;  3K3D A;  4JGO A;  2EX2 A;  5EVE A;  2FFY A;  2ZBB A;  5CGW A;  4LGW A;  3IX3 A;  1F98 A;  5EVI C;  1ERQ A;  2J8Y A;  3UDI A;  4R1G A;  5HAQ A;  2UV0 E;  2HDS A;  3F1N A;  1XGJ A;  2VZW A;  5CEC A;  1G68 A;  1VEU A;  3VE4 A;  1XA7 A;  2JKF A;  3BWL A;  2ZMF A;  3Q82 A;  4JKT A;  3W8K A;  3T4K A;  1GHM A;  2VGL S;  1AWI A;  3ZQ5 A;  4LRZ E;  2Y2M A;  4K0X A;  3K2N A;  2Y2H A;  4E3I A;  2QMI A;  2EXA A;  2Y2I A;  4C75 A;  4X25 A;  2WKI A;  1DJC A;  3BLM A;  3SW1 A;  2KX6 A;  3N8S A;  3WRT A;  2OWJ A;  3U4L P;  1E3U D;  3T12 B;  5GL9 A;  1K54 A;  4II7 A;  3PAG A;  4LV3 A;  4JXS A;  3MQQ A;  4EQI A;  2J7V A;  5GHX A;  2NUT C;  4OPR A;  2Y91 A;  4BJP A;  3B3X A;  5FQI A;  2GDN A;  3FYZ A;  1FSY A;  5EVI B;  3FKW A;  1KVL A;  3MFX A;  3SS5 A;  4PHT A;  3IQA A;  2A2L A;  2PD8 A;  5KSC A;  4I39 A;  4NEE D;  4EBP A;  1D06 A;  1U60 A;  4BBU A;  1D1J A;  4LPZ A;  4RX2 A;  3UO9 A;  3DW0 A;  5FI6 A;  5FEG A;  4MN5 A;  2O9C A;  4JXW A;  5FI2 A;  3H9W A;  5AVF A;  2ZMA A;  2HGV A;  1LL9 A;  1K25 A;  3G31 A;  1F5M A;  2VK3 A;  2Y2O A;  3IH9 A;  1YT4 A;  4RX3 A;  3MSH A;  3MZD A;  1ERO A;  2W3E A;  2AVX A;  2L1M A;  5EUA A;  2PAV P;  3HLB A;  1NZU A;  2PRF A;  1WYC A;  5FQQ A;  4Y0U A;  3H82 B;  4XT2 B;  1DJA A;  1WA9 A;  1YSP A;  4QD4 A;  2ZM2 A;  2C5W B;  4IBX A;  4OKP A;  2JN7 A;  4RVA A;  4FUW A;  1T1B A;  2L0W A;  4K0W A;  4DDS A;  3HBR A;  2XEP A;  1T1A A;  1GA0 A;  4KQD A;  2OV5 A;  3VSL A;  3UB6 A;  5TFQ A;  2XSS A;  1SZV A;  3BY8 A;  3DTK A;  2VV6 A;  5IHV A;  3R7W B;  3BM6 A;  2W0N A;  1TVF A;  4GJ4 A;  2XD5 A;  3T1S A;  3ZHH A;  4FD8 A;  4KZB A;  1ZG6 A;  2EFU A;  1KGE A;  2HP5 A;  3SH9 A;  4I5S A;  2X02 A;  3IBR A;  2Q0O A;  2JKT I;  3JPU A;  5I5L A;  4OPZ A;  1MKI A;  1PZO A;  1SKF A;  4IUK A;  3FV7 A;  5L10 A;  2ZOI A;  1DP8 A;  3ISG A;  2W1T B;  1YLW A;  5L09 A;  1CK3 A;  1I2S A;  2Q9N A;  4OQ0 A;  4WEJ A;  2Y2Q A;  3V3R A;  3E4Q A;  5F82 A;  4DE0 A;  1CF0 A;  3G34 A;  1RP5 A;  4S2N C;  1LHY A;  4S2O A;  3UDX A;  3FPW A;  1T19 A;  3UMD A;  3GR2 A;  2O9B A;  4EU0 A;  4B4X A;  3A3F A;  1GSW A;  3VOY A;  4WL9 A;  1L0D A;  3ZVT A;  1LI0 A;  5GLA A;  2ZC3 B;  1ZC2 A;  3EGX C;  2H0Y A;  4Y0O A;  1N9L A;  2QJ7 A;  2HJ9 C;  3G32 A;  1DP9 A;  3S1Y A;  4BBT A;  1DRM A;  5FI7 A;  4KG5 A;  4OOY A;  3V39 A;  3WS5 A;  5DF7 A;  4RA7 A;  3IF6 B;  2PYP A;  5TGF A;  3M6H A;  1K4E A;  5FDH A;  3O88 A;  4HES A;  4E3N A;  1MBL A;  4PM8 A;  1NYM A;  1MWT A;  2VKS A;  4PMA A;  2J9P A;  3UPP A;  2XDM A;  3JYI A;  5HDS A;  2D01 A;  3LIE A;  3T1Q B;  1FQG A;  1IEM A;  4EQ1 A;  1I5Q A;  1SKO A;  3UB5 P;  2I9V A;  3GDI A;  4X56 A;  1XA1 A;  2WUQ A;  2WGV A;  4K91 A;  1FR1 A;  3LY3 A;  1PRQ A;  4FTX A;  4CQH A;  2W27 A;  3MMH A;  2WZZ A;  5FQ9 A;  2BTF P;  2WAD A;  4KZ8 A;  3QNB A;  5HFO A;  2XK1 A;  1JWV A;  3S7N A;  3FC7 A;  1D7E A;  3OOV A;  1JVJ A;  2ZM0 A;  4HI4 A;  5FQJ A;  2BLS A;  5DTS A;  4QWO A;  3E4O A;  1S66 L;  3OBF A;  2PU2 A;  1OTB A;  1G6A A;  3H82 A;  4ZJ2 A;  2EX9 A;  3GTC A;  2Y2J A;  3PTE A;  5HWT A;  1KGF A;  4GZB A;  5TJJ A;  3G2Z A;  1KE0 A;  2J3W A;  4E3O A;  3VMA A;  2R9W A;  2EXB A;  4N1H A;  3C4P A;  5HWV A;  5U47 A;  1YPR A;  1WYB A;  2H0T A;  5M18 A;  4Z9Q A;  3NDG A;  3ZG5 A;  4AFI A;  1Y54 A;  1G5U A;  5M1A A;  2GZA A;  4DE2 A;  2J80 A;  1N9N A;  3IHB A;  4ESP A;  4P6B A;  1OT9 A;  3KYE A;  2PHY A;  2VGJ A;  5CHJ A;  1NRF A;  5GLB A;  3KSH A;  3LI8 A;  3UN7 A;  1HVB A;  4F3L B;  2PDR A;  4R3J A;  1BLC A;  1GHP A;  4WYY A;  2P9V A;  4O01 A;  3NDE A;  4LV2 A;  5A90 A;  5FAT A;  4X1L A;  3HLD A;  3NHQ A;  3OPL A;  3LIB A;  5M19 A;  1RCJ A;  2V2F F;  4KZ7 A;  1E4D A;  4DE1 A;  4CLC B;  4PM9 A;  3PR6 A;  4JPM A;  4R23 A;  2WGI A;  1BLP A;  1MXO A;  4ARZ A;  4EWF A;  4GN2 A;  3D9Y A;  2A24 A;  3T1R A;  2O0Y A;  3F1P A;  3TW8 A;  4BBV A;  4ZAM A;  4EEP A;  4BL3 A;  4HNB A;  1K38 A;  3IHA A;  4LCL A;  4R4S A;  5AQ9 A;  2IWD A;  5HPI A;  1HTZ A;  5HL6 A;  3KX0 X;  2VLG A;  4PM7 A;  2A49 A;  3UE3 A;  3PBS A;  2OAQ 1;  4U3T A;  1OTE A;  2WGW A;  5IT5 A;  1H8M A;  4MMN A;  1XP4 A;  3BFG A;  3UDF A;  1TDG A;  4R3B A;  1GSX A;  1WE4 A;  1XX2 A;  5HAI A;  2GJ3 A;  4H6J B;  3EEH A;  4KQO A;  4S2M A;  2XD1 A;  3P01 A;  1K0K A;  1OTI A;  3GVB A;  1TS7 A;  1H3Q A;  3T4S A;  4MBF A;  4X69 A;  5HD3 A;  5JYO A;  4HY8 A;  4DMZ A;  2Y59 A;  4Y5F A;  5HD5 A;  1K57 A;  4N9L A;  5K5B A;  5EV0 A;  4OP5 A;  5G4Z A;  3IS2 B;  4HEF A;  2CC1 A;  4OVD A;  3LUQ A;  4MBH A;  3W4O A;  3ZG7 B;  5TBM B;  4OQH A;  4XUX A;  5FAS A;  3ITA A;  3OPH A;  1J3W A;  3MJQ A;  3O5Y A;  5CXW A;  3Q7Z A;  4PM5 A;  3LIC A;  1P9R A;  2ZJ9 A;  2JHE A;  2K7S A;  4WZ4 A;  2W3D A;  3RH8 B;  3A0S A;  1TD5 A;  1YMX A;  1OTD A;  4FSF A;  3O3V A;  5F1G A;  5CGX A;  1CQA A;  4FH2 A;  4LCM A;  1ES5 A;  2M7V A;  3NJA A;  1FIK A;  3NOU C;  2B5R A;  5HPF A;  1JWP A;  4NXE A;  2PU4 A;  1YM1 A;  3E2K A;  1W8Q A;  2Y2L A;  3NY4 A;  1ZTU A;  4DJ2 A;  2WAF A;  1YLP A;  3ZGA B;  4EUZ A;  3D72 A;  3HVF A;  3PYP A;  3ZDJ A;  4KUO A;  1M6K A;  1PWD A;  4OH0 A;  3HRE A;  1BSG A;  3ZFZ A;  3O87 A;  3A3I A;  4F94 A;  4U0T A;  5CED A;  4LFU A;  5DF9 A;  3BRM A;  2MJ6 A;  1SDN A;  5GHY A;  5HDD A;  5FDS A;  4MCW A;  2O99 A;  4GKU A;  1FCM A;  1DP6 A;  3KSF A;  5CX7 A;  4X6T A;  3LID A;  5EOO A;  1S67 L;  1XFQ A;  1SDE A;  4DXB A;  1KVM A;  3IXD A;  2QYB A;  1CEF A;  3N4I A;  4M4X A;  2X71 A;  3QP4 A;  4ZBE A;  3EGD C;  4EET B;  3OPP A;  2KOI A;  3PAE A;  4B4Z A;  3VP4 A;  2Y55 A;  3H7W A;  3Q7V A;  2H10 A;  5HZH A;  3GV9 A;  4PAU A;  1VM1 A;  2OAP 1;  1BT5 A;  1S0W A;  2WYX A;  4R4R A;  4MBK A;  1DY6 A;  1F2K A;  1TF1 A;  1CEG A;  4F3L A;  1FR6 A;  3CJM A;  3V50 A;  3WWX A;  3JVV A;  3C7U A;  2HJE A;  3PBQ A;  4LV1 A;  2H5S A;  5IU1 A;  4HBT A;  1OJ5 A;  3N7W A;  4JXV A;  3BYD A;  1L3L A;  4CLC A;  1LLB A;  5F5Y A;  3A3D A;  3QP1 A;  1IYP A;  1LSX A;  4GCZ A;  1VB6 A;  2QPN A;  3F1O B;  3LR3 A;  4C6Y A;  2H28 A;  3KSI A;  4E3K A;  1K4F A;  2Y2K A;  2ZL1 A;  1PNE A;  3MZE A;  3D4F A;  4QY5 A;  3FZC A;  3CPT A;  4N1X A;  1MZU A;  1PWC A;  3EQV A;  3CLO A;  4UAA A;  3LEZ A;  3EQU A;  1TEM A;  3UB7 A;  3IWO A;  1S4R A;  3MS6 A;  2Y4A A;  4HH3 A;  4RQ9 A;  4NK3 A;  1LL5 A;  1MWS A;  3I7J A;  2KLI A;  1GSV A;  4BD1 A;  4H6J A;  4OP8 A;  1ACF A;  3LFV A;  5GLC A;  3LIF A;  5A91 A;  1KOU A;  2W3H A;  2ZQC A;  4Q0J A;  3CWF A;  5GHZ A;  3BFC A;  4NXG A;  5EM1 A;  2ZQ9 A;  4S2L A;  1P9W A;  4YFM A;  4KZ5 A;  1T18 A;  1Q2P A;  1FOF A;  3W4P A;  4HJ3 A;  3P09 A;  1PI4 A;  3KSG A;  3IH8 A;  3NCK A;  3IXH A;  3CI6 A;  3LCE A;  3QNC A;  3IX8 A;  4GD6 A;  5TBM A;  3SH7 A;  5EEC A;  1VET A;  4S2I A;  3VE3 A;  2XFS A;  1V9Z A;  4HH2 A;  4IVK A;  3Q81 A;  3UB8 A;  1KE4 A;  3HLC A;  2ZM8 A;  5AQ7 A;  4MNR A;  1K55 A;  3ZG9 B;  1K57 C;  3NBL A;  5FSR A;  3DTI A;  4P85 A;  1GA9 A;  2X01 A;  2PBD P;  5DKK A;  2KDK A;  1UGU A;  5C5K A;  2JC7 A;  2QHK A;  3T50 A;  3WRZ A;  1W5D A;  4IBR A;  3S22 A;  4DJ3 A;  2B95 A;  2ACG A;  1J9M A;  2V1A A;  4Y2F A;  4QB8 A;  1MWU A;  1XJ2 A;  4GDB A;  3CAX A;  1NXY A;  5EVL A;  4UA7 A;  3AGF A;  3UE1 A;  4C3Q A;  1NYY A;  4E6W A;  2L4R A;  4L9F A;  2ZC6 B;  3PBR A;  4OLG A;  2UWX A;  5G4Y A;  3BFE A;  4Y17 A;  3B42 A;  5EE8 A;  3MR0 A;  1H8Y A;  1CI8 A;  3NUL A;  4L0L A;  3OZH A;  3PBO A;  4X53 A;  1IKI A;  3VV4 A;  2XA7 M;  4O8G A;  4JF4 A;  3DTE A;  3T4O A;  3UE6 A;  2JCH A;  5CTN A;  3BJN A;  1IYO A;  4R38 A;  5E2E A;  1VHM A;  4OLD A;  5L07 A;  2OOL A;  3LI9 A;  1HLU P;  5AVE A;  2XLN A;  3LY4 A;  4R0Q A;  3C8C A;  3CUE A;  5A93 A;  3KO6 A;  4GOG A;  4ZTK A;  5EVI A;  3NI9 A;  4HJ6 A;  3HLW A;  2P04 A;  4NET A;  1YKD A;  1K54 C;  4NXB A;  4S2J A;  4BMW A;  2QWS A;  2YKF A;  4EW7 A;  1I2W A;  4DKI A;  4O0P A;  3SOI A;  1EI5 A;  4BLM A;  1XFN A;  4HBU A;  4G3V A;  4IJG A;  3IX4 A;  3IF5 A;  4EER A;  5CGS A;  4OOL A;  5CTM A;  2JKR M;  1FCN A;  2OSU A;  3UPO A;  1O7E A;  5DTT A;  5FQM A;  3F1O A;  3IT9 A;  4WN5 A;  2JKR I;  3C2W A;  1N9O A;  3TRC A;  1MWR A;  2G2W A;  3AGD A;  4PKY A;  3F1N B;  4N92 A;  1CJF A;  5J3W A;  3CIT A;  4OPY A;  2DNS A;  4GB7 A;  2DCF A;  3C38 A;  5LBR A;  4YNR A;  3W2Z A;  2YKH A;  1CI9 A;  1P0Z A;  1PZP A;  1VEU B;  4UQI M;  3FWL A;  2XFT A;  2XRO A;  2XF3 A;  4XT2 A;  3L9K A;  3E0Y A;  4FH4 A;  4E3J A;  3OCN A;  3UY6 A;  1XXM A;  4DF6 A;  3RFB A;  4KZ3 A;  3NEC A;  1RGZ A;  2BG1 A;  2ZC4 B;  1YLZ A;  5E43 A;  1YSQ A;  3N6I A;  5CRF A;  4B9O A;  4HOI A;  4ETZ A;  4YWZ A;  3NC8 A;  4LRX C;  2HDQ A;  3ZYT A;  3BQ8 A;  2G7U A;  4EBN A;  1EW0 A;  3BEC A;  1C3B A;  3ZG0 A;  3R7W A;  4GHI B;  1NZO A;  3HJK A;  2VV8 A;  2PR5 A;  3QP8 A;  4P0M A;  3MF0 A;  3K3C A;  2WKH A;  2Z2M B;  3T4L A;  1YMS A;  1Y28 A;  4ZDX A;  1L0F A;  1L2S A;  2XH9 A;  3MZF A;  1ES2 A;  2JE5 A;  3MXS A;  2EX6 A;  1BTL A;  1OT6 A;  5GLD A;  1FIL A;  2HZ5 A;  3BFF A;  3IXB A;  1PIO A;  1W8Y A;  4R70 A;  3WS4 A;  5J4E A;  3VP3 A;  2W1T A;  1LSV A;  2EWW A;  1XJ4 A;  4B88 A;  4WEL A;  2EX8 A;  5FL3 A;  4DRT A;  1XGI A;  4KQQ A;  3A0V A;  4EV4 A;  1LI9 A;  3TOI A;  3L7H A;  1ES4 A;  5HWW A;  3DAV A;  1O07 A;  2INW A;  2ZC7 A;  2LB9 A;  4HP9 A;  2XGN A;  2RL3 A;  1TS0 A;  1XKZ A;  1G28 A;  3HLG A;  1G6O A;  3DBA A;  4IVI A;  5J7E A;  4KUK A;  5A8B A;  4KZA A;  5EVI D;  3A3E A;  4XUZ A;  2Z2L B;  5KSH A;  1JWZ A;  2ZMV A;  3HL9 A;  3LGO A;  4WF0 A;  3VOZ A;  4MN6 A;  3SS3 A;  2ZOH A;  3WS0 A;  3G4P A;  4WZ5 A;  3UNW A;  3VP0 A;  4YIN A;  3BFD A;  4NXF A;  4Y0T A;  3P98 A;  4BL2 A;  3IXG A;  1P97 A;  3IF6 A;  1PI5 A;  4E3M A;  2V1B A;  3BY9 A;  3G30 A;  1IYS A;  5I94 A;  4O7D A;  1UWN X;  2V8C A;  3PHY A;  5DJT A;  3HLF A;  4UEY A;  3MKE A;  2E8I A;  4NG2 A;  1QME A;  4MEZ A;  4P6Z M;  3VSK A;  1H5X A;  5HDC A;  3S4X A;  1ESI A;  3G35 A;  2ZD8 A;  4IUH A;  2Y2N A;  1BZA A;  4BQM A;  2EWV A;  1W63 Q;  3A0R A;  3T4J A;  2PYR A;  2VGL M;  2WKR A;  2V0U A;  3IWQ A;  4GLQ A;  4JGR A;  1QMF A;  1HD8 A;  4S2N A;  1FCO A;  4Y15 A;  4HIA A;  3T1X A;  5CER A;  1L0E A;  1UWP X;  1H0M A;  3ZNY A;  2ZLY A;  3UB9 A;  1PW8 A;  4GS9 B;  4WM9 A;  3OCL A;  4P6Z S;  1ZHH B;  4ETX A;  1SHV A;  1PWG A;  2J9O A;  5BOH A;  1S1Y A;  4I3I A;  2Y2G A;  2FFF B;  1XPB A;  1IOU A;  1OJG A;  5CHU A;  2VA0 A;  1PFL A;  3JVU A;  4E04 A;  1A0K A;  3CZD A;  5EOE A;  1K56 A;  4JGP A;  1NWZ A;  5FA7 A;  4CJN A;  2W3G A;  1NJ4 A;  3OPR A;  3CHW P;  4P87 A;  5FAP A;  4EES A;  4GHI A;  1NY0 A;  3TSG A;  4BEN A;  1Z6F A;  2V9A A;  3CMZ A;  3RXW A;  3ZVW A;  2QJ5 A;  3QP2 A;  1BLS A;  2DMW A;  5HAP A;  3ITB A;  2J3T D;  1JTD A;  3A3J A;  5DJU A;  5FEF A;  5HW3 A;  3GMW A;  4WUJ A;  1MC0 A;  4QY6 A;  2GX5 A;  2Y79 A;  4L9E A;  1BUE A;  2HF6 A;  3PBN A;  5KZH A;  5L8M A;  5FAQ A;  4K08 A;  3KYZ A;  4Q8I A;  1ZKJ A;  2WZX A;  4DXC A;  2XRN A;  1SKO B;  1H8Z A;  2ZQ8 A;  3C7V A;  3G6O A;  3MXQ A;  4JXG A;  3FPV A;  2Y2P A;  5KIZ A;  1KE3 A;  1IEL A;  3B33 A;  5DKL A;  2Z6C A;  2PBY A;  1IFQ A;  2V1Z A;  5DFY A;  4IHQ A;  2JKG A;  2D02 A;  3BEB A;  3R4K A;  5A92 A;  2OWH A;  1IYQ A;  4Q0H A;  4BWI A;  2HP6 A;  3IBJ A;  4EEU A;  4M3K A;  1EWZ A;  1OPX A;  3S7Q A;  2A3U A;  1BUL A;  1KGG A;  4WEK A;  3G2Y A;  2OLU A;  2FH5 A;  4R3A A;  4Y13 A;  5MC7 A;  2G2U A;  4DN0 A;  4WMC A;  4EBL A;  2DRW A;  5E2F A;  4D60 A;  4JBF A;  4JLF A;  4NKP A;  4KZ6 A;  3Q1F A;  2ZQA A; 
#chains in the Genus database with same CATH homology
 4HJ6 A;  2J3T C;  2P04 A;  3T4K A;  2O9A A;  4ARZ A;  1LSW A;  1YKD A;  2WKP A;  3T4T A;  2VGL S;  4NXB A;  3ZQ5 A;  4BMW A;  4LRZ E;  2A24 A;  2FZ0 A;  2O0Y A;  3F1P A;  3IS2 A;  3TW8 A;  4BBV A;  3K2N A;  4G3W A;  2QWS A;  2YKF A;  4EEP A;  4EW7 A;  4HNB A;  4O0P A;  1XFN A;  5HPI A;  4G3V A;  4IJG A;  5HL6 A;  3SW1 A;  3KX0 X;  1NLZ A;  5IS1 A;  2KX6 A;  2OWJ A;  2VLG A;  4EER A;  4OOL A;  1XJ3 A;  2JKR M;  3UE3 A;  2B18 A;  3PBS A;  2IA2 A;  1OTA A;  2OAQ 1;  3F1O A;  1OTE A;  5IT5 A;  1H8M A;  4II7 A;  4MMN A;  2LB5 A;  2JKT M;  4WN5 A;  2JKR I;  3C2W A;  1N9O A;  3TRC A;  5F69 A;  4PKY A;  5AJG A;  3F1N B;  1GSX A;  3MQQ A;  5J3W A;  3CIT A;  3ULF A;  4HP4 A;  2GJ3 A;  2NUT C;  4H6J B;  3EEH A;  4KQO A;  2PR6 A;  3C38 A;  5LBR A;  3P01 A;  4YNR A;  1OTI A;  3V67 A;  2YKH A;  1P0Z A;  4UQI M;  3W2Z A;  4BJP A;  1LT0 A;  1TS7 A;  1NLY A;  1H3Q A;  4LLO B;  3T4S A;  2XRO A;  5HD3 A;  3FG8 A;  4XT2 A;  3E0Y A;  4HY8 A;  1X0O A;  3MFX A;  4PHT A;  4DMZ A;  3OCN A;  4ARZ B;  4Y5F A;  2A2L A;  3NOT C;  5HD5 A;  4GS9 A;  1MKM A;  5K5B A;  2PD8 A;  2A24 B;  4I39 A;  3F1P B;  4NEE D;  3IS2 B;  5G4Z A;  3RFB A;  1YSQ A;  1D06 A;  2PT7 A;  3LUQ A;  4QPR A;  4B9O A;  4BBU A;  4HOI A;  4ETZ A;  4YWZ A;  5TBM B;  4LRX C;  4LPZ A;  3ZYT A;  3BQ8 A;  3P7N A;  1YAX A;  4Y3I A;  2G7U A;  3UME A;  2M1C A;  3MJQ A;  3O5Y A;  4MN5 A;  1EW0 A;  3ICY A;  3LIC A;  2O9C A;  3R7W A;  4GHI B;  1P9R A;  2VV7 A;  2JHE A;  3HJK A;  3H9W A;  2K7S A;  5AVF A;  1TS6 A;  2W3D A;  2HGV A;  2VV8 A;  3A0S A;  1TD5 A;  2PR5 A;  3RH8 B;  4G3K A;  3TE8 A;  3BQA A;  1T1C A;  3C30 A;  4I3J A;  1F5M A;  1OTD A;  2HV1 A;  2QKP A;  4FSF A;  4CLC D;  4JGQ A;  4HQA A;  3MF0 A;  2M7V A;  3E4P A;  3NJA A;  3K3C A;  2W3E A;  4HHD A;  3T4L A;  3NOU C;  2L1M A;  5HPF A;  4MN7 A;  4NXE A;  1Y28 A;  1V9Y A;  4L9G A;  3BW6 A;  1ZTU A;  3TJZ C;  4DJ2 A;  3H82 B;  3D72 A;  1OT6 A;  4XT2 B;  3PYP A;  1YSP A;  1WA9 A;  4KUO A;  2GNX A;  4R70 A;  4EUV A;  2VX8 A;  5J4E A;  3PBT A;  3MQO A;  2JN7 A;  2W1T A;  1LSV A;  2EWW A;  1XJ4 A;  4WEL A;  5FL3 A;  1T1B A;  2L0W A;  3A0V A;  5DF9 A;  2MJ6 A;  2XA7 S;  1T1A A;  4I38 A;  3S7P A;  4KQD A;  5HDD A;  4MCW A;  3UB6 A;  2O99 A;  5HWW A;  2XSS A;  1DP6 A;  2INW A;  2LB9 A;  3BY8 A;  3KSF A;  2VV6 A;  5CX7 A;  4HP9 A;  3R7W B;  2W0N A;  1TS0 A;  3LID A;  4GJ4 A;  1S67 L;  1XFQ A;  3S7O A;  1G28 A;  1G6O A;  3DBA A;  5J7E A;  4KUK A;  5A8B A;  2QYB A;  3OLO A;  4M4X A;  2NUP C;  4I5S A;  3LR5 A;  5KSH A;  1XJ6 A;  4PKY G;  3EGD C;  3IBR A;  2ZMV A;  4EET B;  4WF0 A;  2KOI A;  2JKT I;  4MN6 A;  5I5L A;  2ZOH A;  3EWK A;  3H7W A;  5HZH A;  4CLC C;  4PAU A;  4IUK A;  2OAP 1;  2PD7 A;  4NXF A;  2ZOI A;  3U2A A;  1DP8 A;  1TF1 A;  1P97 A;  2VJW A;  4F3L A;  2V1B A;  3BY9 A;  3JVV A;  2HJE A;  3PBQ A;  2W1T B;  1UWN X;  4GW9 A;  5IU1 A;  1OJ5 A;  4Z1W A;  1S1Z A;  3PHY A;  5DJT A;  4WEJ A;  2P08 A;  4UEY A;  1LL8 A;  2EA9 A;  4CLC A;  5F5Y A;  3E4Q A;  1LSX A;  4P6Z M;  4GCZ A;  1VB6 A;  2W1R A;  4B93 A;  5F68 A;  3FPW A;  1T19 A;  3UMD A;  2R78 A;  5HDC A;  3F1O B;  3LR3 A;  2O9B A;  4EU0 A;  4IUH A;  1TS8 A;  1GSW A;  2H28 A;  3KSI A;  4UQI S;  2EWV A;  1W63 Q;  4WL9 A;  3A0R A;  3T4J A;  2PYR A;  4MDZ A;  2VGL M;  2WKR A;  3EGX C;  2V0U A;  1N9L A;  2QJ7 A;  4GLQ A;  1STZ A;  3H7W B;  4I3A A;  4JGR A;  2HJ9 C;  1DP9 A;  4R6L A;  4HIA A;  4BBT A;  1DRM A;  4ZRR A;  4LRY C;  1MZU A;  3EQV A;  3CLO A;  2Y8H A;  3EQU A;  1UWP X;  3LIA A;  3UB7 A;  1S4R A;  2PYP A;  4HH3 A;  4RQ9 A;  3UB9 A;  5HSQ A;  2KLI A;  4GS9 B;  1GSV A;  3KYQ A;  3OC2 A;  4EXO A;  3OCL A;  4HJ4 A;  4P6Z S;  2BAS A;  4FOF A;  5DFX A;  4H6J A;  1ZHH B;  4ETX A;  3EEA A;  2B02 A;  3LFV A;  3LIF A;  1S1Y A;  2VKS A;  4I3I A;  1KOU A;  2W3H A;  4Q0J A;  3CWF A;  5EFW A;  5HDS A;  2D01 A;  1IOU A;  4NXG A;  1OJG A;  2VA0 A;  3LIE A;  1P9W A;  4EQ1 A;  1BYW A;  3JVU A;  1T18 A;  2K31 A;  4E04 A;  2I9V A;  3GDI A;  3LR4 A;  4HJ3 A;  2CMN A;  3KSG A;  2W3F A;  2K2N A;  3EOI A;  4JGP A;  3CI6 A;  2M7U A;  1NWZ A;  2W3G A;  5TBM A;  4CQH A;  2W27 A;  3VE3 A;  3MMH A;  1V9Z A;  4HH2 A;  3UB8 A;  4EES A;  3RTY A;  4YOF A;  3MQ0 A;  4GHI A;  3HCY A;  4CLC E;  2Z6D A;  2V9A A;  3S7N A;  3FC7 A;  3T4Q A;  1D7E A;  3NOP C;  3OOV A;  5DKK A;  2QJ5 A;  2V0W A;  2KDK A;  3LYX A;  1UGU A;  4HI4 A;  3D3O A;  3VOL A;  5C5K A;  2DMW A;  2P7J A;  2J3T D;  3HJI A;  5DJU A;  2QHK A;  3E4O A;  1S66 L;  3OBF A;  5F6A A;  3T50 A;  4WUJ A;  1MC0 A;  4DJ3 A;  2GX5 A;  2Y79 A;  4L9E A;  4OOM A;  2WKQ A;  1OTB A;  2HF6 A;  2V1A A;  3H82 A;  3PBN A;  3PXP A;  3B47 A;  5L8M A;  4Y2F A;  4K08 A;  3E98 A;  1XJ2 A;  5HWT A;  3CAX A;  3KYZ A;  3LR0 A;  5TJJ A;  2XRN A;  1S4S A;  2J3W A;  3G6O A;  1JNU A;  3MXQ A;  2L4R A;  1W63 M;  3FPV A;  4L9F A;  5KIZ A;  3PBR A;  3GEC A;  4Q0I A;  3B33 A;  5G4Y A;  1ODV A;  4ME4 A;  5DKL A;  1NRJ A;  2Z6C A;  5HWV A;  2VEA A;  1IFQ A;  3B42 A;  3MR0 A;  4WLA A;  5DFY A;  4IHQ A;  2D02 A;  1F9I A;  3R4K A;  4AFI A;  3K3D A;  3CUE C;  2OWH A;  4JGO A;  4Q0H A;  2ZBB A;  4L0L A;  4BWI A;  2GZA A;  2J80 A;  1F98 A;  1N9N A;  3IBJ A;  3PBO A;  4EEU A;  1OPX A;  3VV4 A;  2XA7 M;  3S7Q A;  4O8G A;  1OT9 A;  2PHY A;  3KSH A;  3LI8 A;  4WEK A;  4F3L B;  2PDR A;  3T4O A;  3UE6 A;  3F1N A;  2FH5 A;  4R3A A;  3BJN A;  4O01 A;  4R38 A;  1VHM A;  5MC7 A;  2OOL A;  3LI9 A;  2VZW A;  4DN0 A;  3NHQ A;  3LIB A;  5AVE A;  3C8C A;  3CUE A;  3VE4 A;  3BWL A;  3KO6 A;  4NKP A;  4CLC B;  2ZMF A;  3PR6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...