5A92A

15k x-ray structure with cefotaxime: exploring the mechanism of beta- lactam ring protonation in the class a beta-lactamase acylation mechanism using neutron and x-ray crystallography
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
260
structure length
260
Chain Sequence
SVQQQLEALEKSSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTAPTLNTAIPGDPRDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQPEQKAENRNDILAAAAKIVTHGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-LACTAMASE CTX-M-97
publication title Exploring the Mechanism of Beta-Lactam Ring Protonation in the Class a Beta-Lactamase Acylation Mechanism Using Neutron and X-Ray Crystallography.
pubmed doi rcsb
source organism Escherichia coli
total genus 92
structure length 260
sequence length 260
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5a92A00
1K54C 2WGIA 2H0TA 4MBFA 5E2GA 2EXBA 5F82A 4C75A 5F1FA 1ESIA 3PBSA 3SS4A 4C3QA 2HDSA 3ZDJA 4R3JA 3UE0A 1K57A 5EVIC 4QJGA 4LV2A 4X68A 3W8KA 2ZMAA 3ITBA 5CHUA 3SH7A 3BLMA 4R4RA 3NCKA 1HVBA 3G31A 1KDSA 4E3IA 3OCNA 2H10A 3FZCA 1JWVA 2HPBA 3GV9A 4P87A 3UDXA 4KZ8A 2ZQCA 3UNWA 4IBRA 3V39A 3BFDA 1Y54A 1W79A 2Y2PA 5CERA 1U60A 4LENA 3HVFA 3LCEA 3Q7ZA 5EUAA 5JYOA 3NDEA 4E3KA 4N1XA 5FQQA 2ZQ9A 3D4FA 1S6RA 4FSFA 2DNSA 2CC1A 2QPNA 3SS3A 4JXVA 3ZG8B 2Y2KA 2Y2NA 3EQVA 4BL2A 2HDRA 3IH9A 5HL1A 3OPRA 4OOMA 4KENB 3NBLA 1K54A 3HBRA 3VP2A 1DJCA 2Y2QA 3GMWA 1NXYA 4O7DA 1I2SA 3C4OA 2ZC4B 1Q2PA 3E2KA 1L2SA 1DY6A 3BEBA 2XK1A 1RGYA 5EVIA 4JKTA 3HLBA 3NY4A 3VSLA 2Y59A 3MZFA 3V3RA 3PAEA 3OC2A 4WYYA 4ZDXA 4P6BA 1BLPA 4UAAA 2G2UA 2XD5A 3OPHA 1MXOA 5HARA 3ZGAB 5A91A 4R3BA 4OQIA 4KQOA 2EX6A 5EECA 2ZC7A 3TG9A 5FI7A 2BLSA 4YFMA 4BQMA 3M2JA 4GDBA 4MBKA 4BJPA 4UA9A 1Q2QA 3GVBA 5E2HA 4Y0OA 1TVFA 4ZBEA 1ZC2A 5GHZA 1XP4A 1CEFA 4DKIA 1MY8A 3C4PA 3WRZA 3QHYA 5BOHA 3HLGA 5GHXA 5JYPA 3NIAA 4R23A 1BLHA 1EWZA 1YLZA 4OQGA 1XGJA 4L0LA 4YINA 2DCFA 4BD0A 1QMFA 4DF6A 1YM1A 2J9OA 2HP9A 3G2ZA 3Q7VB 1BLCA 1J9MA 3P98A 5CGWA 1LI0A 4WZ4A 3RXXA 4FD8A 3UE3A 4Q8IA 3IQAA 1CI9A 5E43A 2IWCA 2Y2OA 4X56A 1K38A 5KSHA 1YLTA 1DJAA 4X6TA 1ES4A 5U47A 4RX2A 5EVIB 3ITAA 4KZ3A 4OPZA 3HLCA 4OPQA 1W8QA 5FQJA 3EQUA 3G2YA 3BM6A 5FQIA 2X71A 1I2WA 3BYDA 3S4XA 2DRWA 3SOIA 1WYCA 3G30A 4OP5A 2OLVA 3BFGA 5DTSA 4ZTKA 4WZ5A 3M6HA 3FYZA 2Q9NA 2RL3A 1JWPA 5CGXA 4ZJ2A 5HW3A 3G35A 4S2MA 4ZAMA 4OH0A 2XQZA 1GA9A 5AQBA 2XR0A 3HUOA 5EOOA 5DTTA 3ZVTA 5FQKA 2WGWB 1LHYA 4BD1A 3DTMA 2WYXA 3JYIA 4MEZA 3B3XA 1FR1A 4OP8A 1K56A 1ES3A 2WAEA 2Y2LA 3HL9A 3IXBA 5F83A 3VOYA 2PBYA 4R1GA 5CXWA 5DF8A 5L2FA 1IYQA 3CZDA 5EE8A 3QNCA 4KZ7A 3IT9A 4NETA 3MKFA 2GDNA 1IKIA 1FR6A 3OPPA 5FQ9A 1SCWA 4E6WA 4PM7A 2JE5A 5AQAA 3M6BA 5HAIA 4DDSA 1GHMA 3O88A 4P0MA 4K0XA 1ZG6A 1HD8A 4QD4A 5M1AA 1L0GA 3O86A 3O87A 5DF9A 4IBXA 3A3EA 2Y2GA 4OLDA 3MBZA 5FQMA 5KZHA 5FASA 3AGEA 4JF5A 3C5AA 1PYYA 1DJBA 1MWTA 2EX2A 3WS1A 3V5MA 1GHIA 2JCHA 3Q07A 1NY0A 1PW8A 4MBHA 3UDFA 5HAQA 5CGSA 4M3KA 4OOYA 1MWUA 2WKIA 3PBNA 5GHYA 4JXSA 4CJNA 5FATA 4KQRA 4S2JA 1BUEA 2ZM2A 4PM8A 3N6IA 2VGJA 4GOGA 3BFCA 5FI6A 4C6YA 4KQQA 3IXHA 1VM1A 4S2PA 1K4EA 4S2IA 1IKGA 1NRFA 1M6KA 1MBLA 4QHCA 4NK3A 4E3LA 1E4DA 1YMSA 4JLFA 3UDIA 3BFFA 3HREA 4Y0UA 1PZPA 1ES2A 4S2LA 2ZJ9A 2X02A 1NYMA 3CG5A 5G18A 3W4OA 4E3JA 3FKWA 1FCOA 2EXAA 3UY6A 3Q7VA 2G2WA 1K6SA 1FSYA 4WMCA 1O07A 1YT4A 4KZAA 4DXCA 4EBNA 3W4QA 1ZG4A 5CHJA 5M18A 4OPYA 4GNUA 4DE2A 3OZHA 1HZOA 3HLFA 1JVJA 1M40A 3S1YA 3DWKA 3VP1A 1CK3A 5EPHA 1KVMA 4D2OA 2P9VB 1RP5A 4DE1A 4DXBA 2ZC5B 1JTGA 1MWRA 3IH8A 2H0YA 2HDUA 3N7WA 1ZKJA 4FH4A 2PU4A 4LV3A 2ZQ8A 4U0TA 1ONGA 3ZG9B 1VQQA 3IWOA 1XPBA 2WGWA 3LY4A 3PTEA 3I7JA 5GL9A 2A3UA 5GLBA 1FSWA 4IVKA 1PWCA 1E3UA 2ZQAA 2ZQ7A 3ZG5A 4PM6A 1W5DA 4P85A 2WKEA 3PBTA 3GTCA 2V2FF 2B5RA 1IYOA 5FAOA 1WYBA 5AQ9A 1N9BA 5GLDA 3ZHHA 2ZD8A 2WADA 2OV5A 1OMEA 2FFFB 1JWZA 1KVLA 1KE3A 1ALQA 1ONHA 4R4SA 5FA7A 4JPMA 1SKFA 3HUNA 4N92A 4RVAA 3UO9A 5FSRA 3G32A 3A3JA 3S22A 1XGIA 3TOIA 1KGFA 3PAGA 3BRMA 2EFUA 3IF6C 1MKIA 1IEMA 3VFFA 3ZVWA 3HLEA 2WAFA 2R9XA 4BL3A 3GRJA 1XA1A 3LO7A 4DE0A 3NDGA 1PIOA 1PWGA 4HEFA 3Q1FA 1HTZA 3IHBA 5HFOA 2XFSA 4JF6A 3Q82A 5EVLA 3VP4A 1N4OA 3PBQA 1YLPA 1CI8A 1RGZA 1FQGA 2ZC3B 4GD8A 4S2OA 3W4PA 4E3MA 3V3SA 1ERMA 1S0WA 4E3NA 2ZM0A 2IWBA 3MXRA 1K56D 5TR7A 1K57C 1NZUA 1BSGA 2H5SA 3UN7A 1BULA 3UE1A 3IHAA 2WGVA 4OOLA 5FDHA 4HESA 5CEDA 2ZQDA 2XD1A 4ZJ1A 3NI9A 5EOEA 3GQZA 2WZXA 4N9LA 4OPRA 3WS2A 4R0QA 2EX9A 4KZBA 3FKVA 4GDNA 2XGNA 5HAPA 3IWQA 2JBFA 1NZOA 1W8YA 4LCMA 2X01A 3SH9A 1H8ZA 4RYEA 5D3OA 3IXGA 1G68A 3MKEA 4UA6A 4EBLA 1GCEA 1O7EA 1WE4A 1TEMA 1K6RA 4LV0A 1LLBA 1GHPA 2P9VA 4GN2A 1IYSA 4U0XA 3MZDA 3RXWA 3N4IA 5CRFA 1GA0A 3G4PA 2EFXA 4KZ5A 4JXGA 4MLLA 4B4XA 4FH2A 3WWXA 1FCMA 1I5QA 1L0DA 2UWXA 3DW0A 4JF4A 3AGDA 3ZG0A 4E6XA 2ZC6B 3ZG7B 2XDMA 1K4FA 4OVDA 2VGKA 4Z9QA 1SHVA 3C7UA 4KZ6A 1PWDA 2V1ZA 3N8RA 4OKPA 4IEDA 1TDGA 5GLAA 2HDQA 1C3BA 4B4ZA 2Q9MA 1SDNA 3VMAA 4EQIA 4JBFA 1L0EA 4GKUA 2RCXA 2Z2MB 3A3IA 2FFYA 3MFDA 4N1HA 1IYPA 1PI4A 2WK0A 4WBGA 5CTNA 5TFQA 4OQ0A 4PM5A 4WEJA 4U3TA 3MXSA 1H5XA 2XLNA 3OCLA 4PPRA 2V20A 4WMCD 3ZFZA 3UPOA 4WELA 1LL9A 4EBPA 1K55C 1NYYA 4WM9A 2J8YA 1YLYA 4XXRA 5EVID 2Y2HA 3IF5A 3TSGA 1YLJA 3SH8A 5E2FA 1LL5A 4KZ9A 4HBUA 2WKHA 4OONA 3ZCZA 4Y0TA 3CMZA 2WUQA 3HLWA 2J7VA 2E8IA 2Y2IA 5DVAA 2R9WA 3V50A 3IF6B 4A5RA 1JTDA 1FOFA 3P09A 3PBOA 4KG5A 3UPPA 4DE3A 5CTMA 2ZM8A 4EUZA 4FCFA 4BLMA 1FCNA 4OLGA 3C7VA 1W7FA 4F94A 3OPLA 2OLUA 4KG6A 1KE0A 4HBTA 4UHUA 4BENA 5A90A 3N8LA 3Q81A 5F1GA 4X53A 3AGFA 1E3UD 1KE4A 4X55A 1PI5A 3WS4A 4DDYA 4K0WA 3DWZA 4LCLA 5CECA 3IWIA 4LV1A 3FV7A 3PBRA 4S2KA 2Y4AA 4UA7A 1NJ4A 4QY6A 3WS0A 5IHVA 3BFEA 3M2KA 1MWSA 4GB7A 5KSCA 4PM9A 3BECA 3VSKA 2HP6A 2XF3A 2Y2JA 1EROA 3A3DA 1K55A 3N8SA 4WZ5C 1EI5A 5HX9A 5FAQA 3NC8A 1H8YA 1QMEA 4E3OA 4S2NC 4QU3A 1XKZA 4WEKA 1KDWA 1LI9A 2XFTA 2BG1A 1YMXA 1IELA 3G34A 2XEPA 2P74A 4QY5A 2QZ6A 4JXWA 1YLWA 1KGEA 4N9KA 4PMAA 4GD6A 2Y91A 4ID4A 1BTLA 5DF7A 3GSGA 3LY3A 1ESUA 1MPLA 4EV4A 3VP0A 1PW1A 1Z6FA 3FWLA 3BLSA 2Y55A 3WRTA 1XX2A 3CJMA 3RJUA 3ZNYA 4XUZA 2J9PA 5KMWA 3QNBA 2IWDA 2C5WB 2WZZA 4RA7A 1ERQA 5J8XA 5E2EA 4KG2A 5I94A 5A93A 4QB8A 2QMIA 1ES5A 4DRTA 4CPKA 4XUXA 3VFHA 1TDLA 2I72A 3HLDA 1BZAA 1AXBA 1XXMA 5FI2A 2ZLYA 3MZEA 2EX8A 3ISGA 1XA7A 4RX3A 4MNRA 3UPNA 4X69A 4OQHA 2JC7A 3HUMA 1L0FA 1RCJA 3GR2A 3LEZA 2HP5A 3VP3A 4B88A 4S2NA 5M19A 1YQSA 3E2LA 1SDEA 1E25A 5CHMA 2XH9A 2OSUA 5GLCA 3VOZA 3IXDA 3O3VA 1CEGA 4GZBA 4H8RA 3A3FA 5FAPA 4EWFA 3SS5A 3IF6A 5AQ7A 5CEBA 2PU2A 1G6AA 1PZOA 5TGFA 3WS5A 1BLSA 4KZ4A 3ZNTA 2C6WB 5A92A 4K91A 1KGGA 2Y2MA 4Y7PA 1BT5A 1K25A 5DTKA 4ZJ3A 4IVIA 2Z2LB 2A49A
chains in the Genus database with same CATH superfamily
2O9CA 1N9LA 1ESIA 3QP6A 3ZDJA 1K57A 4QJGA 4RQ9A 4X68A 5HDSA 2VJWA 3G31A 4E3IA 3OCNA 2H10A 3FZCA 2QYBA 3V39A 1TF1A 4HIAA 5CERA 5DFYA 3HVFA 3LCEA 3Q7ZA 4MN5A 2CMNA 4N1XA 3K3DA 5FQQA 3D4FA 4XT2A 4KENB 1J3WA 1TD5A 3NBLA 3HBRA 1DJCA 1NXYA 2L4RA 1P0ZA 2ZC4B 2ZBBA 5EVIA 3JPUA 2OAP1 3MZFA 3QP8A 4ZDXA 2VGLS 4UAAA 1BLPA 2XD5A 1MXOA 3ZGAB 4OQIA 5HDDA 2BASA 2D01A 4JGQA 5DJUA 4Y5FA 4ARZB 1Q2QA 3SW1A 4ZBEA 1ZC2A 3ICYA 4DKIA 4X25A 5BOHA 3HLGA 2VV8A 1YLZA 1MKMA 1S4SA 1W63M 4DF6A 1J9MA 1LI0A 1VB6A 3UE3A 4FD8A 3IQAA 5A8BA 3C8CA 4PKYG 4X56A 1DJAA 5U47A 4RX2A 4LRZE 4OPQA 3G2YA 2J3TC 2Z6CA 4NXGA 5HW3A 3G35A 5AQBA 4Y17A 3T4JA 5FQKA 4BD1A 3KSGA 3T1XA 3B3XA 4OP8A 4R1GA 4EU0A 3PXPA 4HH2A 1IYQA 5EE8A 3IT9A 4LFUA 4NETA 2OWJA 1FR6A 5FQ9A 1SCWA 4Y2FA 4E6WA 2JE5A 3M6BA 3O88A 4MN6A 4QD4A 5M1AA 3O86A 3T4LA 5DF9A 2PR5A 3MS6A 2V8CA 5FASA 3EOIA 4EUVA 1MWTA 4HHDA 3S7NA 2JCHA 3Q07A 4NEED 1PW8A 1NY0A 5HAQA 3QP1A 4HJ3A 5CGSA 2WKIA 4CJNA 5GHYA 5KIZA 1GSVA 5FATA 4KQRA 2ZM2A 3N6IA 1VM1A 5L8MA 1IKGA 3FC7A 4E3LA 4NK3A 1E4DA 1YMSA 3BFFA 4Y0UA 1PZPA 3C38A 3CG5A 1V9ZA 2B18A 1VETB 1K0KA 2G2WA 4WMCA 1O07A 3CUEA 1ZG4A 3L9KA 4GJ4A 4BBTA 3DWKA 3VP1A 4I5SA 4D2OA 2PD7A 4DXBA 4EEPA 1W63Q 4I39A 1OTDA 2ZQ8A 1ONGA 2VEAA 3LYXA 2WGWA 3OOVA 3NULA 2ACGA 2ZQ7A 1W5DA 2FZ0A 1A0KA 2Y79A 4JGPA 2ZD8A 2WADA 4F3LA 2DMWA 2FFFB 1ONHA 4P6ZM 4EEUA 4N92A 3H7WB 3A3JA 3S22A 5EFWA 1ZHHB 5F5YA 1IEMA 3VFFA 1F5MA 4I38A 1LL8A 5DKKA 3MQOA 1HTZA 3IHBA 3Q1FA 4ESPA 3Q82A 1T19A 1CI8A 1RGZA 4E3MA 4GD8A 1WA9A 2D02A 2ZL1A 3TE8A 2IWBA 1K56D 4L9EA 3VE4A 1BULA 4GCZA 2WGVA 5FDHA 4HESA 5CEDA 3NI9A 2WZXA 4R0QA 3BY8A 4GDNA 5HWWA 4ZRRA 2JBFA 3SH9A 4UA6A 4EBLA 3U2AA 1O7EA 3GDIA 1GHPA 4GN2A 2R78A 3HJKA 3RXWA 3N4IA 3G4PA 2EFXA 3LFVA 4FH2A 3UMDA 3DW0A 3ZG0A 4Z9QA 3C7UA 1T1AA 4OKPA 3H9WA 2HGVA 1L0EA 4GKUA 5EV0A 1PI4A 3G6OA 5HD3A 1OJ5A 1OJGA 2I9VA 2KOIA 1L3LA 3TRCA 3CHWP 3ZFZA 4WELA 2WKRA 1NYYA 5EVID 3SH8A 3BQ8A 1UWNX 2WKHA 2HJ9C 3F1PB 2WUQA 3V50A 1FOFA 2GX5A 3PBOA 4EUZA 1D7EA 1Y28A 1NRJA 1TS8A 4KG6A 3O5YA 5TBMB 4UHUA 3JVUA 5HWTA 3AGFA 3WS4A 3PR6A 3U4LP 2YKFA 5EM0A 3PBRA 5IHVA 3BFEA 2Y2JA 4MN7A 3N8SA 5HX9A 2JKRM 2Q0OA 3K3CA 3R4KA 3EWKA 4XT2B 1D06A 1Z6FA 3T12B 3NOPC 4KUOA 3KX0X 1GSXA 2WZZA 1OPXA 4KG2A 2QMIA 4BMWA 4DRTA 4XUXA 1TDLA 3MZEA 4MNRA 3UPNA 2JC7A 3DTEA 4X1LA 1L0FA 3GR2A 3LEZA 4HJ6A 3E2LA 2NUTC 2XH9A 2OSUA 5GLCA 3E4QA 2NUPC 2E8JA 4EWFA 4HP9A 2O99A 2V8FA 4LRYC 2PU2A 4G3KA 1BLSA 4KZ4A 4PKYA 4KUKA 4K91A 3RH8B 5IS1A 5DTKA 2A49A 2VK3A 5EVIC 3W8KA 2ZMAA 3ITBA 5CHUA 3BLMA 1HVBA 1KDSA 3CI6A 2HPBA 2M1CA 2Y2PA 4LENA 3MQ0A 5EUAA 5JYOA 3NDEA 4E3KA 2W3GA 2CC1A 3SS3A 4I3AA 5HD5A 1GSWA 5HL1A 3OPRA 5J4EA 3GMWA 3MMHA 1I2SA 1Q2PA 3E2KA 1L2SA 1DY6A 2XK1A 3HLBA 3VSLA 5HPFA 2Y59A 3V3RA 1DP8A 3OC2A 3R7WA 4WYYA 3MJQA 4P6BA 5A91A 4KQOA 2MJ6A 2ZC7A 4HNBA 5FI7A 2BLSA 4UA9A 5EVEA 4Y0OA 1NLYA 1T18A 1IFQA 1BYWA 5GHXA 3NIAA 4Q0IA 3MSHA 4YINA 2DCFA 1SZVA 1QMFA 3G2ZA 3P98A 5CGWA 4WZ4A 1CI9A 2IWCA 2Y2OA 1K38A 4MMNA 4OPZA 2PHYA 3EQUA 3BM6A 4UQIS 3S7OA 2X71A 1I2WA 4G3WA 3SOIA 4OP5A 3M6HA 2Q9NA 4ZJ2A 4OH0A 2XQZA 2XR0A 3HUOA 2A24A 3UB5P 2WGWB 3ULFA 3DTMA 3JYIA 1K56A 1ES3A 1UGUA 3VOYA 2KDKA 5CXWA 2O9AA 3QNCA 3QP5A 2VX8A 3LUQA 3MKFA 4F3LB 5AQAA 2L0WA 3CUEC 4P0MA 1ZG6A 1L0GA 5KZHA 3LI9A 2Y2GA 1FILA 1PYYA 3V5MA 1Z09A 4JXSA 4S2JA 1UWPX 2VGJA 1VHMA 3BFCA 5FI6A 4C6YA 2W3HA 1OT9A 3IXHA 4S2PA 1NRFA 2V9AA 4QHCA 2ZL1B 1P9WA 4JLFA 4R70A 1ES2A 3H82A 1NYMA 3MFXA 5G18A 3W4OA 4E3JA 3FKWA 3UY6A 4O0PA 2QJ7A 1FSYA 3KYEA 3TW8A 5CHJA 5L09A 1G6OA 1JVJA 2JKTM 5EPHA 4DE1A 1JTGA 5F6AA 1XJ6A 3N7WA 4FH4A 1F98A 2PU4A 3PHYA 4LV3A 4U0TA 1VQQA 3IWOA 1FSWA 1PWCA 1PNEA 3KSHA 3ZG5A 3MQQA 2V2FF 2VGLM 5GLDA 2W0NA 4GS9B 3PYPA 5MC7A 4R4SA 2HJEA 5FA7A 1SKFA 3HUNA 4MCWA 3G32A 3V67A 3BRMA 3BY9A 2W3DA 4BL3A 4DE0A 2KLIA 4HEFA 2XFSA 4GHIA 5IU1A 1YLPA 3V3SA 1ERMA 3F1NB 2ZM0A 2JHEA 5TR7A 3LGOA 3E0YA 5EOEA 4KZBA 3MF0A 2AVXA 2P08A 4LCMA 4RYEA 5D3OA 2M7UA 3IXGA 1G68A 4R6LA 2WKPA 4WL9A 3UE6A 2K2NA 1TEMA 2P9VA 2INWA 3DAVA 4DJ2A 2GJ3A 3WWXA 1L0DA 2PYPA 3AGDA 2ZC6B 5L07A 2XDMA 4OVDA 3K2NA 2V1ZA 1TDGA 4NXFA 5GLAA 2HDQA 1LSWA 4B4ZA 5DJTA 3LIBA 2Q9MA 4EQIA 3T4SA 2Z2MB 2FFYA 1T1BA 4N1HA 1IYPA 1STZA 3LEQA 4QPRA 1H5XA 1LSXA 3UPOA 1LL9A 4EBPA 3C2WA 1G5UA 4WM9A 3TJZC 4XXRA 3TSGA 1LL5A 4HBUA 1TS7A 4OONA 3ZCZA 2QJ5A 3HLWA 2J7VA 2Y2IA 4HQAA 4A5RA 2ZM8A 3ZYTA 5F68A 1S67L 1FCNA 4OLGA 4F94A 3OPLA 2OLUA 4LRXC 2W1TA 5F1GA 1YKDA 4X53A 4IUHA 4ME4A 4X55A 1PI5A 4BBUA 2O9BA 4K0WA 3BJNA 4LV1A 2Y4AA 4GB7A 5KSCA 4PM9A 3BECA 4HOIA 4P6ZS 1N9NA 2JKFA 1EROA 3A3DA 3NC8A 5J3WA 2BG1A 1DRMA 2XEPA 2P74A 2QZ6A 4JXWA 1XJ2A 4PMAA 5DF7A 3GSGA 2G7UA 3VP0A 2W3FA 1LSVA 3BLSA 3WRTA 2M7VA 3QP2A 3CJMA 3ZNYA 5KMWA 4RA7A 1ERQA 3SZTA 5A93A 1ES5A 1OT6A 2I72A 3R7WB 1XXMA 2GZAA 3ISGA 1XA7A 3LICA 3UB6A 3VOLA 4B88A 3UB8A 3IXDA 1CEGA 2XA7M 3A3FA 5CEBA 3WS5A 2C6WB 3LR3A 5A92A 2Y2MA 4ZJ3A 3KSIA 4KQDA 4IVIA 2Z2LB 4KZ5A 5LBRA 4ETZA 4MBFA 5F82A 4C75A 3PBSA 3SS4A 4R3JA 3UE0A 5HPIA 3A0SA 4LV2A 3SH7A 4R4RA 3NCKA 2HF6A 4P87A 4KZ8A 2ZQCA 3UNWA 4ARZA 1W79A 2OWHA 4EXOA 2VV7A 2DNSA 2Y2KA 3EQVA 2HDRA 2LB9A 1NWZA 1MZUA 4WN5A 1K54A 2OAQ1 2Y2QA 3IS2A 4O7DA 3BEBA 1YPRA 1RGYA 4JKTA 3EGDC 5J7EA 2G2UA 1H3QA 2PD8A 5HARA 4R3BA 2EX6A 5EECA 1S1ZA 3M2JA 4MBKA 4BJPA 3D3OA 5GHZA 1CEFA 3C4PA 3WRZA 2ZMVA 1BLHA 1XGJA 4L0LA 4BD0A 4HH3A 4GW9A 5E2FA 1BLCA 3RXXA 2PT7A 5E43A 5KSHA 4X6TA 5EVIB 3ITAA 4Y13A 2P7JA 1OTBA 1WYCA 2V1AA 3G30A 3BFGA 5DTSA 5HWVA 3FYZA 2RL3A 5CGXA 3E4PA 5EOOA 3ZVTA 3B47A 3FPWA 1LHYA 2H28A 1FR1A 4DJ3A 3HL9A 1KOUA 3IXBA 4CLCE 5DF8A 2J80A 3CZDA 4KZ7A 1S66L 3MXQA 3OBFA 2GDNA 1IKIA 3OPPA 4DDSA 1GHMA 1TS0A 1CJFA 4IBXA 3A3EA 4OLDA 5FQMA 4M4XA 1D1JA 1DJBA 3WS1A 3UDFA 3GECA 4OOYA 3PBNA 1BUEA 4GHIB 4GOGA 1H0MA 4CLCD 4S2IA 2JKRI 1M6KA 1MBLA 3KYQA 3UDIA 2B02A 1FCOA 1ZTUA 3LIEA 3Q7VA 1K6SA 3T50A 5AJGA 4EBNA 3W4QA 5M18A 4DE2A 2KX6A 1HZOA 4NXEA 1M40A 3W2ZA 1CK3A 1KVMA 2P9VB 1RP5A 4BBVA 2ZC5B 3IH8A 2H0YA 3CITA 4LPZA 2VA0A 4BWIA 3T4OA 3CWFA 1XPBA 3LY4A 3PTEA 3I7JA 3P01A 3CLOA 3E98A 2A3UA 5GLBA 2W27A 1NLZA 1DP6A 4L9FA 4NXBA 4Q0HA 3DTKA 2PAVP 3PBTA 2EWWA 2B5RA 1IYOA 3IX4A 4FUWA 5FAOA 5AQ9A 1N9BA 3ZHHA 1FIKA 4EW7A 3UB9A 1OMEA 3VE3A 1JWZA 1KVLA 1KE3A 3UO9A 1XGIA 3UMEA 3KSFA 3IF6C 1VEUA 1V9YA 3T4QA 3ZVWA 3HLEA 2LB5A 2R9XA 5DFXA 2PRFA 3LO7A 3NDGA 5IT5A 2VKSA 3F1OA 5HFOA 3VP4A 2UV0E 2ZC3B 3W4PA 1FQGA 3LR4A 1S0WA 4E3NA 2W1TB 1NZUA 3UN7A 3LIDA 4Q0JA 4UQIM 2XD1A 4ZJ1A 4N9LA 2PBDP 3WS2A 4DMZA 1SKOA 3IWQA 1NZOA 1W8YA 3MKEA 1GCEA 1WE4A 1K6RA 4LV0A 4CLCC 2J3TD 1LLBA 3MZDA 1MC0A 4MLLA 5HZHA 1G28A 1FCMA 1I5QA 2UWXA 1XFNA 5TBMA 4JF4A 4O01A 4E6XA 3ZG7B 3HCYA 2YKHA 4EESA 1PWDA 2EWVA 3VMAA 1SDNA 4PAUA 3A3IA 3MFDA 1ACFA 2WK0A 4OQ0A 4U3TA 3MXSA 4PPRA 3CPTA 2B95A 2Y8HA 3IF5A 4Y0TA 3CMZA 2E8IA 1JTDA 4KG5A 4DE3A 5CTMA 4H6JA 5EM1A 4FCFA 2EA9A 3C7VA 1W7FA 3KYZA 5AVFA 3FPVA 3NHQA 2O0YA 4HBTA 5A90A 3T4TA 3N8LA 1E3UD 2W3EA 1JNUA 1F2KA 3FV7A 4MDZA 1YSPA 1MWSA 1OTAA 5F69A 2XF3A 4LGWA 4WZ5C 1K55A 2BTFP 1EI5A 5FAQA 1H8YA 1QMEA 1IOUA 4QU3A 1LI9A 2XFTA 1IELA 3G34A 4QY5A 4N9KA 1OTEA 4EERA 4JGRA 1MPLA 1PW1A 2IA2A 3IX8A 1XX2A 3FG8A 2J9PA 3IS2B 2C5WB 5E2EA 5I94A 4QB8A 2QHKA 3VFHA 1BZAA 1AXBA 2ZLYA 4EQ1A 2EX8A 3EEHA 3A0RA 4OQHA 3HUMA 4AFIA 1RCJA 5M19A 2HP5A 3VP3A 4S2NA 1YQSA 1X0OA 3VOZA 4H8RA 3DBAA 3SS5A 3IF6A 2JKTI 3IBJA 5TGFA 3ZNTA 1HLUP 4Y7PA 4R23A 1K54C 2WGIA 4R3AA 2H0TA 5E2GA 2EXBA 2VZWA 5F1FA 4C3QA 2HDSA 4NKPA 1PFLA 2P04A 1F9IA 1JWVA 3GV9A 3UDXA 4IBRA 3BFDA 2XRNA 1Y54A 2L1MA 3LI8A 1U60A 4CLCA 2ZQ9A 1S6RA 4FSFA 4IHQA 3ZG8B 2QPNA 4JXVA 2Y2NA 4BL2A 3IH9A 3A0VA 4OOMA 2WKQA 4I3JA 4GLQA 4L9GA 3VP2A 1H8MA 3C4OA 3S7PA 3NY4A 4HJ4A 3PAEA 5C5KA 4B93A 3E4OA 5G4ZA 3DTIA 4Y3IA 4IJGA 3OPHA 4X1MA 3TG9A 2HV1A 4FTXA 4YFMA 2VV6A 4BQMA 3IX3A 5HDCA 4GDBA 3GVBA 5E2HA 1TVFA 1XP4A 1MY8A 3QHYA 5JYPA 4D60A 1EWZA 4OQGA 2V0WA 1LT0A 1YM1A 2J9OA 2HP9A 3Q7VB 4Q8IA 1YLTA 1ES4A 3NOTC 4B9OA 4KZ3A 2JKGA 3HLCA 3BWLA 4HP4A 1W8QA 5FQJA 3BW6A 5FQIA 3BYDA 3NECA 3S4XA 2DRWA 4JGOA 3L7HA 2OLVA 4ZTKA 4WZ5A 4II7A 1JWPA 2V0UA 4S2MA 4ZAMA 5FEFA 1GA9A 2V1BA 5DTTA 2XA7S 1ODVA 2K31A 2WYXA 4MEZA 5DKLA 2WAEA 2Y2LA 5F83A 2PBYA 5L2FA 5TJJA 2JN7A 4PM7A 4WLAA 5HAIA 4K0XA 1HD8A 3O87A 3MBZA 1CQAA 3AGEA 4JF5A 3C5AA 2EX2A 1GHIA 1VEUB 4MBHA 4M3KA 1MWUA 3F1OB 4PM8A 4KQQA 1K4EA 2A24B 2GNXA 4I3IA 1PRQA 3HREA 4S2LA 2ZJ9A 1XFQA 2X02A 4GS9A 2EXAA 1YT4A 4KZAA 4DXCA 4OPYA 1SKOB 4QWOA 4GNUA 3IBRA 3OZHA 3HLFA 3B42A 2OOLA 3S1YA 2XROA 2ZMFA 1MWRA 2HDUA 1ZKJA 4PHTA 3ZG9B 3F1NA 5GL9A 4IVKA 5FEGA 5L10A 1E3UA 2ZQAA 1OTIA 1N9OA 4PM6A 4P85A 2WKEA 3GTCA 1WYBA 4WF0A 3H82B 2OV5A 1ALQA 4JPMA 4K08A 4RVAA 5FSRA 4YNRA 3CPTB 3LR5A 3TOIA 1KGFA 3PAGA 2EFUA 1MKIA 2WAFA 3GRJA 1XA1A 4UEYA 5FDSA 4H6JB 1PIOA 1PWGA 4YOFA 4JF6A 5EVLA 1N4OA 3NJAA 3PBQA 4S2OA 3OLOA 2PR6A 4FOFA 3ZQ5A 4E04A 3MXRA 3HJIA 1CF0A 1K57C 1BSGA 2H5SA 3UE1A 3IHAA 4OOLA 2ZQDA 1Y4OA 1VETA 3GQZA 3LR0A 1XJ4A 4OPRA 2ZOIA 2EX9A 3T1QB 3FKVA 3QP4A 2XGNA 2QWSA 5HAPA 2X01A 1H8ZA 5HL6A 4LLOB 4IUKA 1IYSA 1AWIA 4U0XA 4CQHA 5CRFA 1DP9A 1GA0A 1YSQA 1TS6A 4JXGA 4B4XA 3P7NA 2K7SA 3LIFA 5HSQA 1K4FA 2VLGA 2VGKA 1SHVA 3LIAA 4KZ6A 2HZ5A 4G3VA 3N8RA 4IEDA 1C3BA 4JBFA 2RCXA 5CTNA 1S4RA 4WBGA 5TFQA 4NG2A 4PM5A 4WEJA 1P9RA 3OCLA 2XLNA 1S1YA 4WMCD 2V20A 3NOUC 3D9YA 1K55C 3H7WA 1YLYA 2J8YA 2Y2HA 1YLJA 2A2LA 4KZ9A 1YAXA 5DVAA 2R9WA 3MR0A 3IF6B 3P09A 3UPPA 3EEAA 4YWZA 4BLMA 2J3WA 1KE0A 4BENA 3Q81A 3EGXC 2W1RA 1KE4A 3RFBA 4DDYA 3DWZA 4LCLA 5CECA 3IWIA 4Y15A 3T4KA 4S2KA 4UA7A 3WS0A 1NJ4A 4QY6A 3M2KA 2Z6DA 3VSKA 5G4YA 2HP6A 3D72A 4E3OA 4S2NC 1XKZA 4WEKA 1KDWA 1YMXA 1EW0A 3RTYA 1P97A 4CLCB 1YLWA 1KGEA 4GD6A 2Y91A 4ID4A 1XJ3A 1BTLA 3KO6A 3LY3A 1ESUA 4EV4A 3S7QA 4HY8A 3BQAA 4O8GA 5K5BA 3FWLA 2Y55A 3RJUA 4XUZA 4WUJA 3JVVA 3QNBA 2IWDA 3VV4A 4Z1WA 5J8XA 4DN0A 3T1SA 1T1CA 4CPKA 3HLDA 4HI4A 5FI2A 4R38A 4RX3A 2PYRA 2FH5A 4X69A 4EETB 1SDEA 1E25A 3B33A 5CHMA 3CAXA 2XSSA 3O3VA 3F1PA 2ZOHA 4GZBA 5FAPA 2QKPA 5AQ7A 5AVEA 1G6AA 5FL3A 5CX7A 1PZOA 3C30A 3UB7A 2PDRA 1KGGA 1BT5A 1K25A 4ETXA 5I5LA 3T1RA
chains in the Genus database with same CATH topology
1K54C 2WGIA 2H0TA 4MBFA 5E2GA 2EXBA 5F82A 4C75A 5F1FA 1ESIA 3PBSA 3SS4A 4C3QA 2HDSA 3ZDJA 4R3JA 3UE0A 1K57A 5EVIC 4QJGA 4LV2A 4X68A 3W8KA 2ZMAA 3ITBA 5CHUA 3SH7A 3BLMA 4R4RA 3NCKA 1HVBA 3G31A 1KDSA 4E3IA 3OCNA 2H10A 3FZCA 1JWVA 2HPBA 3GV9A 4P87A 3UDXA 4KZ8A 2ZQCA 3UNWA 4IBRA 3V39A 3BFDA 1Y54A 1W79A 2Y2PA 5CERA 1U60A 4LENA 3HVFA 3LCEA 3Q7ZA 5EUAA 5JYOA 3NDEA 4E3KA 4N1XA 5FQQA 2ZQ9A 3D4FA 1S6RA 4FSFA 2DNSA 2CC1A 2QPNA 3SS3A 4JXVA 3ZG8B 2Y2KA 2Y2NA 3EQVA 4BL2A 2HDRA 3IH9A 5HL1A 3OPRA 4OOMA 4KENB 3NBLA 1K54A 3HBRA 3VP2A 1DJCA 2Y2QA 3GMWA 1NXYA 4O7DA 1I2SA 3C4OA 2ZC4B 1Q2PA 3E2KA 1L2SA 1DY6A 3BEBA 2XK1A 1RGYA 5EVIA 4JKTA 3HLBA 3NY4A 3VSLA 2Y59A 3MZFA 3V3RA 3PAEA 3OC2A 4WYYA 4ZDXA 4P6BA 1BLPA 4UAAA 2G2UA 2XD5A 3OPHA 1MXOA 5HARA 3ZGAB 5A91A 4R3BA 4OQIA 4KQOA 2EX6A 5EECA 2ZC7A 3TG9A 5FI7A 2BLSA 4YFMA 4BQMA 3M2JA 4GDBA 4MBKA 4BJPA 4UA9A 1Q2QA 3GVBA 5E2HA 4Y0OA 1TVFA 4ZBEA 1ZC2A 5GHZA 1XP4A 1CEFA 4DKIA 1MY8A 3C4PA 3WRZA 3QHYA 5BOHA 3HLGA 5GHXA 5JYPA 3NIAA 4R23A 1BLHA 1EWZA 1YLZA 4OQGA 1XGJA 4L0LA 4YINA 2DCFA 4BD0A 1QMFA 4DF6A 1YM1A 2J9OA 2HP9A 3G2ZA 3Q7VB 1BLCA 1J9MA 3P98A 5CGWA 1LI0A 4WZ4A 3RXXA 4FD8A 3UE3A 4Q8IA 3IQAA 1CI9A 5E43A 2IWCA 2Y2OA 4X56A 1K38A 5KSHA 1YLTA 1DJAA 4X6TA 1ES4A 5U47A 4RX2A 5EVIB 3ITAA 4KZ3A 4OPZA 3HLCA 4OPQA 1W8QA 5FQJA 3EQUA 3G2YA 3BM6A 5FQIA 2X71A 1I2WA 3BYDA 3S4XA 2DRWA 3SOIA 1WYCA 3G30A 4OP5A 2OLVA 3BFGA 5DTSA 4ZTKA 4WZ5A 3M6HA 3FYZA 2Q9NA 2RL3A 1JWPA 5CGXA 4ZJ2A 5HW3A 3G35A 4S2MA 4ZAMA 4OH0A 2XQZA 1GA9A 5AQBA 2XR0A 3HUOA 5EOOA 5DTTA 3ZVTA 5FQKA 2WGWB 1LHYA 4BD1A 3DTMA 2WYXA 3JYIA 4MEZA 3B3XA 1FR1A 4OP8A 1K56A 1ES3A 2WAEA 2Y2LA 3HL9A 3IXBA 5F83A 3VOYA 2PBYA 4R1GA 5CXWA 5DF8A 5L2FA 1IYQA 3CZDA 5EE8A 3QNCA 4KZ7A 3IT9A 4NETA 3MKFA 2GDNA 1IKIA 1FR6A 3OPPA 5FQ9A 1SCWA 4E6WA 4PM7A 2JE5A 5AQAA 3M6BA 5HAIA 4DDSA 1GHMA 3O88A 4P0MA 4K0XA 1ZG6A 1HD8A 4QD4A 5M1AA 1L0GA 3O86A 3O87A 5DF9A 4IBXA 3A3EA 2Y2GA 4OLDA 3MBZA 5FQMA 5KZHA 5FASA 3AGEA 4JF5A 3C5AA 1PYYA 1DJBA 1MWTA 2EX2A 3WS1A 3V5MA 1GHIA 2JCHA 3Q07A 1NY0A 1PW8A 4MBHA 3UDFA 5HAQA 5CGSA 4M3KA 4OOYA 1MWUA 2WKIA 3PBNA 5GHYA 4JXSA 4CJNA 5FATA 4KQRA 4S2JA 1BUEA 2ZM2A 4PM8A 3N6IA 2VGJA 4GOGA 3BFCA 5FI6A 4C6YA 4KQQA 3IXHA 1VM1A 4S2PA 1K4EA 4S2IA 1IKGA 1NRFA 1M6KA 1MBLA 4QHCA 4NK3A 4E3LA 1E4DA 1YMSA 4JLFA 3UDIA 3BFFA 3HREA 4Y0UA 1PZPA 1ES2A 4S2LA 2ZJ9A 2X02A 1NYMA 3CG5A 5G18A 3W4OA 4E3JA 3FKWA 1FCOA 2EXAA 3UY6A 3Q7VA 2G2WA 1K6SA 1FSYA 4WMCA 1O07A 1YT4A 4KZAA 4DXCA 4EBNA 3W4QA 1ZG4A 5CHJA 5M18A 4OPYA 4GNUA 4DE2A 3OZHA 1HZOA 3HLFA 1JVJA 1M40A 3S1YA 3DWKA 3VP1A 1CK3A 5EPHA 1KVMA 4D2OA 2P9VB 1RP5A 4DE1A 4DXBA 2ZC5B 1JTGA 1MWRA 3IH8A 2H0YA 2HDUA 3N7WA 1ZKJA 4FH4A 2PU4A 4LV3A 2ZQ8A 4U0TA 1ONGA 3ZG9B 1VQQA 3IWOA 1XPBA 2WGWA 3LY4A 3PTEA 3I7JA 5GL9A 2A3UA 5GLBA 1FSWA 4IVKA 1PWCA 1E3UA 2ZQAA 2ZQ7A 3ZG5A 4PM6A 1W5DA 4P85A 2WKEA 3PBTA 3GTCA 2V2FF 2B5RA 1IYOA 5FAOA 1WYBA 5AQ9A 1N9BA 5GLDA 3ZHHA 2ZD8A 2WADA 2OV5A 1OMEA 2FFFB 1JWZA 1KVLA 1KE3A 1ALQA 1ONHA 4R4SA 5FA7A 4JPMA 1SKFA 3HUNA 4N92A 4RVAA 3UO9A 5FSRA 3G32A 3A3JA 3S22A 1XGIA 3TOIA 1KGFA 3PAGA 3BRMA 2EFUA 3IF6C 1MKIA 1IEMA 3VFFA 3ZVWA 3HLEA 2WAFA 2R9XA 4BL3A 3GRJA 1XA1A 3LO7A 4DE0A 3NDGA 1PIOA 1PWGA 4HEFA 3Q1FA 1HTZA 3IHBA 5HFOA 2XFSA 4JF6A 3Q82A 5EVLA 3VP4A 1N4OA 3PBQA 1YLPA 1CI8A 1RGZA 1FQGA 2ZC3B 4GD8A 4S2OA 3W4PA 4E3MA 3V3SA 1ERMA 1S0WA 4E3NA 2ZM0A 2IWBA 3MXRA 1K56D 5TR7A 1K57C 1NZUA 1BSGA 2H5SA 3UN7A 1BULA 3UE1A 3IHAA 2WGVA 4OOLA 5FDHA 4HESA 5CEDA 2ZQDA 2XD1A 4ZJ1A 3NI9A 5EOEA 3GQZA 2WZXA 4N9LA 4OPRA 3WS2A 4R0QA 2EX9A 4KZBA 3FKVA 4GDNA 2XGNA 5HAPA 3IWQA 2JBFA 1NZOA 1W8YA 4LCMA 2X01A 3SH9A 1H8ZA 4RYEA 5D3OA 3IXGA 1G68A 3MKEA 4UA6A 4EBLA 1GCEA 1O7EA 1WE4A 1TEMA 1K6RA 4LV0A 1LLBA 1GHPA 2P9VA 4GN2A 1IYSA 4U0XA 3MZDA 3RXWA 3N4IA 5CRFA 1GA0A 3G4PA 2EFXA 4KZ5A 4JXGA 4MLLA 4B4XA 4FH2A 3WWXA 1FCMA 1I5QA 1L0DA 2UWXA 3DW0A 4JF4A 3AGDA 3ZG0A 4E6XA 2ZC6B 3ZG7B 2XDMA 1K4FA 4OVDA 2VGKA 4Z9QA 1SHVA 3C7UA 4KZ6A 1PWDA 2V1ZA 3N8RA 4OKPA 4IEDA 1TDGA 5GLAA 2HDQA 1C3BA 4B4ZA 2Q9MA 1SDNA 3VMAA 4EQIA 4JBFA 1L0EA 4GKUA 2RCXA 2Z2MB 3A3IA 2FFYA 3MFDA 4N1HA 1IYPA 1PI4A 2WK0A 4WBGA 5CTNA 5TFQA 4OQ0A 4PM5A 4WEJA 4U3TA 3MXSA 1H5XA 2XLNA 3OCLA 4PPRA 2V20A 4WMCD 3ZFZA 3UPOA 4WELA 1LL9A 4EBPA 1K55C 1NYYA 4WM9A 2J8YA 1YLYA 4XXRA 5EVID 2Y2HA 3IF5A 3TSGA 1YLJA 3SH8A 5E2FA 1LL5A 4KZ9A 4HBUA 2WKHA 4OONA 3ZCZA 4Y0TA 3CMZA 2WUQA 3HLWA 2J7VA 2E8IA 2Y2IA 5DVAA 2R9WA 3V50A 3IF6B 4A5RA 1JTDA 1FOFA 3P09A 3PBOA 4KG5A 3UPPA 4DE3A 5CTMA 2ZM8A 4EUZA 4FCFA 4BLMA 1FCNA 4OLGA 3C7VA 1W7FA 4F94A 3OPLA 2OLUA 4KG6A 1KE0A 4HBTA 4UHUA 4BENA 5A90A 3N8LA 3Q81A 5F1GA 4X53A 3AGFA 1E3UD 1KE4A 4X55A 1PI5A 3WS4A 4DDYA 4K0WA 3DWZA 4LCLA 5CECA 3IWIA 4LV1A 3FV7A 3PBRA 4S2KA 2Y4AA 4UA7A 1NJ4A 4QY6A 3WS0A 5IHVA 3BFEA 3M2KA 1MWSA 4GB7A 5KSCA 4PM9A 3BECA 3VSKA 2HP6A 2XF3A 2Y2JA 1EROA 3A3DA 1K55A 3N8SA 4WZ5C 1EI5A 5HX9A 5FAQA 3NC8A 1H8YA 1QMEA 4E3OA 4S2NC 4QU3A 1XKZA 4WEKA 1KDWA 1LI9A 2XFTA 2BG1A 1YMXA 1IELA 3G34A 2XEPA 2P74A 4QY5A 2QZ6A 4JXWA 1YLWA 1KGEA 4N9KA 4PMAA 4GD6A 2Y91A 4ID4A 1BTLA 5DF7A 3GSGA 3LY3A 1ESUA 1MPLA 4EV4A 3VP0A 1PW1A 1Z6FA 3FWLA 3BLSA 2Y55A 3WRTA 1XX2A 3CJMA 3RJUA 3ZNYA 4XUZA 2J9PA 5KMWA 3QNBA 2IWDA 2C5WB 2WZZA 4RA7A 1ERQA 5J8XA 5E2EA 4KG2A 5I94A 5A93A 4QB8A 2QMIA 1ES5A 4DRTA 4CPKA 4XUXA 3VFHA 1TDLA 2I72A 3HLDA 1BZAA 1AXBA 1XXMA 5FI2A 2ZLYA 3MZEA 2EX8A 3ISGA 1XA7A 4RX3A 4MNRA 3UPNA 4X69A 4OQHA 2JC7A 3HUMA 1L0FA 1RCJA 3GR2A 3LEZA 2HP5A 3VP3A 4B88A 4S2NA 5M19A 1YQSA 3E2LA 1SDEA 1E25A 5CHMA 2XH9A 2OSUA 5GLCA 3VOZA 3IXDA 3O3VA 1CEGA 4GZBA 4H8RA 3A3FA 5FAPA 4EWFA 3SS5A 3IF6A 5AQ7A 5CEBA 2PU2A 1G6AA 1PZOA 5TGFA 3WS5A 1BLSA 4KZ4A 3ZNTA 2C6WB 5A92A 4K91A 1KGGA 2Y2MA 4Y7PA 1BT5A 1K25A 5DTKA 4ZJ3A 4IVIA 2Z2LB 2A49A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K54 C;  2WGI A;  2H0T A;  4MBF A;  5E2G A;  2EXB A;  5F82 A;  4C75 A;  5F1F A;  1ESI A;  3PBS A;  3SS4 A;  4C3Q A;  2HDS A;  3ZDJ A;  4R3J A;  3UE0 A;  1K57 A;  5EVI C;  4QJG A;  4LV2 A;  4X68 A;  3W8K A;  2ZMA A;  3ITB A;  5CHU A;  3SH7 A;  3BLM A;  4R4R A;  3NCK A;  1HVB A;  3G31 A;  1KDS A;  4E3I A;  3OCN A;  2H10 A;  3FZC A;  1JWV A;  2HPB A;  3GV9 A;  4P87 A;  3UDX A;  4KZ8 A;  2ZQC A;  3UNW A;  4IBR A;  3V39 A;  3BFD A;  1Y54 A;  1W79 A;  2Y2P A;  5CER A;  1U60 A;  4LEN A;  3HVF A;  3LCE A;  3Q7Z A;  5EUA A;  5JYO A;  3NDE A;  4E3K A;  4N1X A;  5FQQ A;  2ZQ9 A;  3D4F A;  1S6R A;  4FSF A;  2DNS A;  2CC1 A;  2QPN A;  3SS3 A;  4JXV A;  3ZG8 B;  2Y2K A;  2Y2N A;  3EQV A;  4BL2 A;  2HDR A;  3IH9 A;  5HL1 A;  3OPR A;  4OOM A;  4KEN B;  3NBL A;  1K54 A;  3HBR A;  3VP2 A;  1DJC A;  2Y2Q A;  3GMW A;  1NXY A;  4O7D A;  1I2S A;  3C4O A;  2ZC4 B;  1Q2P A;  3E2K A;  1L2S A;  1DY6 A;  3BEB A;  2XK1 A;  1RGY A;  5EVI A;  4JKT A;  3HLB A;  3NY4 A;  3VSL A;  2Y59 A;  3MZF A;  3V3R A;  3PAE A;  3OC2 A;  4WYY A;  4ZDX A;  4P6B A;  1BLP A;  4UAA A;  2G2U A;  2XD5 A;  3OPH A;  1MXO A;  5HAR A;  3ZGA B;  5A91 A;  4R3B A;  4OQI A;  4KQO A;  2EX6 A;  5EEC A;  2ZC7 A;  3TG9 A;  5FI7 A;  2BLS A;  4YFM A;  4BQM A;  3M2J A;  4GDB A;  4MBK A;  4BJP A;  4UA9 A;  1Q2Q A;  3GVB A;  5E2H A;  4Y0O A;  1TVF A;  4ZBE A;  1ZC2 A;  5GHZ A;  1XP4 A;  1CEF A;  4DKI A;  1MY8 A;  3C4P A;  3WRZ A;  3QHY A;  5BOH A;  3HLG A;  5GHX A;  5JYP A;  3NIA A;  4R23 A;  1BLH A;  1EWZ A;  1YLZ A;  4OQG A;  1XGJ A;  4L0L A;  4YIN A;  2DCF A;  4BD0 A;  1QMF A;  4DF6 A;  1YM1 A;  2J9O A;  2HP9 A;  3G2Z A;  3Q7V B;  1BLC A;  1J9M A;  3P98 A;  5CGW A;  1LI0 A;  4WZ4 A;  3RXX A;  4FD8 A;  3UE3 A;  4Q8I A;  3IQA A;  1CI9 A;  5E43 A;  2IWC A;  2Y2O A;  4X56 A;  1K38 A;  5KSH A;  1YLT A;  1DJA A;  4X6T A;  1ES4 A;  5U47 A;  4RX2 A;  5EVI B;  3ITA A;  4KZ3 A;  4OPZ A;  3HLC A;  4OPQ A;  1W8Q A;  5FQJ A;  3EQU A;  3G2Y A;  3BM6 A;  5FQI A;  2X71 A;  1I2W A;  3BYD A;  3S4X A;  2DRW A;  3SOI A;  1WYC A;  3G30 A;  4OP5 A;  2OLV A;  3BFG A;  5DTS A;  4ZTK A;  4WZ5 A;  3M6H A;  3FYZ A;  2Q9N A;  2RL3 A;  1JWP A;  5CGX A;  4ZJ2 A;  5HW3 A;  3G35 A;  4S2M A;  4ZAM A;  4OH0 A;  2XQZ A;  1GA9 A;  5AQB A;  2XR0 A;  3HUO A;  5EOO A;  5DTT A;  3ZVT A;  5FQK A;  2WGW B;  1LHY A;  4BD1 A;  3DTM A;  2WYX A;  3JYI A;  4MEZ A;  3B3X A;  1FR1 A;  4OP8 A;  1K56 A;  1ES3 A;  2WAE A;  2Y2L A;  3HL9 A;  3IXB A;  5F83 A;  3VOY A;  2PBY A;  4R1G A;  5CXW A;  5DF8 A;  5L2F A;  1IYQ A;  3CZD A;  5EE8 A;  3QNC A;  4KZ7 A;  3IT9 A;  4NET A;  3MKF A;  2GDN A;  1IKI A;  1FR6 A;  3OPP A;  5FQ9 A;  1SCW A;  4E6W A;  4PM7 A;  2JE5 A;  5AQA A;  3M6B A;  5HAI A;  4DDS A;  1GHM A;  3O88 A;  4P0M A;  4K0X A;  1ZG6 A;  1HD8 A;  4QD4 A;  5M1A A;  1L0G A;  3O86 A;  3O87 A;  5DF9 A;  4IBX A;  3A3E A;  2Y2G A;  4OLD A;  3MBZ A;  5FQM A;  5KZH A;  5FAS A;  3AGE A;  4JF5 A;  3C5A A;  1PYY A;  1DJB A;  1MWT A;  2EX2 A;  3WS1 A;  3V5M A;  1GHI A;  2JCH A;  3Q07 A;  1NY0 A;  1PW8 A;  4MBH A;  3UDF A;  5HAQ A;  5CGS A;  4M3K A;  4OOY A;  1MWU A;  2WKI A;  3PBN A;  5GHY A;  4JXS A;  4CJN A;  5FAT A;  4KQR A;  4S2J A;  1BUE A;  2ZM2 A;  4PM8 A;  3N6I A;  2VGJ A;  4GOG A;  3BFC A;  5FI6 A;  4C6Y A;  4KQQ A;  3IXH A;  1VM1 A;  4S2P A;  1K4E A;  4S2I A;  1IKG A;  1NRF A;  1M6K A;  1MBL A;  4QHC A;  4NK3 A;  4E3L A;  1E4D A;  1YMS A;  4JLF A;  3UDI A;  3BFF A;  3HRE A;  4Y0U A;  1PZP A;  1ES2 A;  4S2L A;  2ZJ9 A;  2X02 A;  1NYM A;  3CG5 A;  5G18 A;  3W4O A;  4E3J A;  3FKW A;  1FCO A;  2EXA A;  3UY6 A;  3Q7V A;  2G2W A;  1K6S A;  1FSY A;  4WMC A;  1O07 A;  1YT4 A;  4KZA A;  4DXC A;  4EBN A;  3W4Q A;  1ZG4 A;  5CHJ A;  5M18 A;  4OPY A;  4GNU A;  4DE2 A;  3OZH A;  1HZO A;  3HLF A;  1JVJ A;  1M40 A;  3S1Y A;  3DWK A;  3VP1 A;  1CK3 A;  5EPH A;  1KVM A;  4D2O A;  2P9V B;  1RP5 A;  4DE1 A;  4DXB A;  2ZC5 B;  1JTG A;  1MWR A;  3IH8 A;  2H0Y A;  2HDU A;  3N7W A;  1ZKJ A;  4FH4 A;  2PU4 A;  4LV3 A;  2ZQ8 A;  4U0T A;  1ONG A;  3ZG9 B;  1VQQ A;  3IWO A;  1XPB A;  2WGW A;  3LY4 A;  3PTE A;  3I7J A;  5GL9 A;  2A3U A;  5GLB A;  1FSW A;  4IVK A;  1PWC A;  1E3U A;  2ZQA A;  2ZQ7 A;  3ZG5 A;  4PM6 A;  1W5D A;  4P85 A;  2WKE A;  3PBT A;  3GTC A;  2V2F F;  2B5R A;  1IYO A;  5FAO A;  1WYB A;  5AQ9 A;  1N9B A;  5GLD A;  3ZHH A;  2ZD8 A;  2WAD A;  2OV5 A;  1OME A;  2FFF B;  1JWZ A;  1KVL A;  1KE3 A;  1ALQ A;  1ONH A;  4R4S A;  5FA7 A;  4JPM A;  1SKF A;  3HUN A;  4N92 A;  4RVA A;  3UO9 A;  5FSR A;  3G32 A;  3A3J A;  3S22 A;  1XGI A;  3TOI A;  1KGF A;  3PAG A;  3BRM A;  2EFU A;  3IF6 C;  1MKI A;  1IEM A;  3VFF A;  3ZVW A;  3HLE A;  2WAF A;  2R9X A;  4BL3 A;  3GRJ A;  1XA1 A;  3LO7 A;  4DE0 A;  3NDG A;  1PIO A;  1PWG A;  4HEF A;  3Q1F A;  1HTZ A;  3IHB A;  5HFO A;  2XFS A;  4JF6 A;  3Q82 A;  5EVL A;  3VP4 A;  1N4O A;  3PBQ A;  1YLP A;  1CI8 A;  1RGZ A;  1FQG A;  2ZC3 B;  4GD8 A;  4S2O A;  3W4P A;  4E3M A;  3V3S A;  1ERM A;  1S0W A;  4E3N A;  2ZM0 A;  2IWB A;  3MXR A;  1K56 D;  5TR7 A;  1K57 C;  1NZU A;  1BSG A;  2H5S A;  3UN7 A;  1BUL A;  3UE1 A;  3IHA A;  2WGV A;  4OOL A;  5FDH A;  4HES A;  5CED A;  2ZQD A;  2XD1 A;  4ZJ1 A;  3NI9 A;  5EOE A;  3GQZ A;  2WZX A;  4N9L A;  4OPR A;  3WS2 A;  4R0Q A;  2EX9 A;  4KZB A;  3FKV A;  4GDN A;  2XGN A;  5HAP A;  3IWQ A;  2JBF A;  1NZO A;  1W8Y A;  4LCM A;  2X01 A;  3SH9 A;  1H8Z A;  4RYE A;  5D3O A;  3IXG A;  1G68 A;  3MKE A;  4UA6 A;  4EBL A;  1GCE A;  1O7E A;  1WE4 A;  1TEM A;  1K6R A;  4LV0 A;  1LLB A;  1GHP A;  2P9V A;  4GN2 A;  1IYS A;  4U0X A;  3MZD A;  3RXW A;  3N4I A;  5CRF A;  1GA0 A;  3G4P A;  2EFX A;  4KZ5 A;  4JXG A;  4MLL A;  4B4X A;  4FH2 A;  3WWX A;  1FCM A;  1I5Q A;  1L0D A;  2UWX A;  3DW0 A;  4JF4 A;  3AGD A;  3ZG0 A;  4E6X A;  2ZC6 B;  3ZG7 B;  2XDM A;  1K4F A;  4OVD A;  2VGK A;  4Z9Q A;  1SHV A;  3C7U A;  4KZ6 A;  1PWD A;  2V1Z A;  3N8R A;  4OKP A;  4IED A;  1TDG A;  5GLA A;  2HDQ A;  1C3B A;  4B4Z A;  2Q9M A;  1SDN A;  3VMA A;  4EQI A;  4JBF A;  1L0E A;  4GKU A;  2RCX A;  2Z2M B;  3A3I A;  2FFY A;  3MFD A;  4N1H A;  1IYP A;  1PI4 A;  2WK0 A;  4WBG A;  5CTN A;  5TFQ A;  4OQ0 A;  4PM5 A;  4WEJ A;  4U3T A;  3MXS A;  1H5X A;  2XLN A;  3OCL A;  4PPR A;  2V20 A;  4WMC D;  3ZFZ A;  3UPO A;  4WEL A;  1LL9 A;  4EBP A;  1K55 C;  1NYY A;  4WM9 A;  2J8Y A;  1YLY A;  4XXR A;  5EVI D;  2Y2H A;  3IF5 A;  3TSG A;  1YLJ A;  3SH8 A;  5E2F A;  1LL5 A;  4KZ9 A;  4HBU A;  2WKH A;  4OON A;  3ZCZ A;  4Y0T A;  3CMZ A;  2WUQ A;  3HLW A;  2J7V A;  2E8I A;  2Y2I A;  5DVA A;  2R9W A;  3V50 A;  3IF6 B;  4A5R A;  1JTD A;  1FOF A;  3P09 A;  3PBO A;  4KG5 A;  3UPP A;  4DE3 A;  5CTM A;  2ZM8 A;  4EUZ A;  4FCF A;  4BLM A;  1FCN A;  4OLG A;  3C7V A;  1W7F A;  4F94 A;  3OPL A;  2OLU A;  4KG6 A;  1KE0 A;  4HBT A;  4UHU A;  4BEN A;  5A90 A;  3N8L A;  3Q81 A;  5F1G A;  4X53 A;  3AGF A;  1E3U D;  1KE4 A;  4X55 A;  1PI5 A;  3WS4 A;  4DDY A;  4K0W A;  3DWZ A;  4LCL A;  5CEC A;  3IWI A;  4LV1 A;  3FV7 A;  3PBR A;  4S2K A;  2Y4A A;  4UA7 A;  1NJ4 A;  4QY6 A;  3WS0 A;  5IHV A;  3BFE A;  3M2K A;  1MWS A;  4GB7 A;  5KSC A;  4PM9 A;  3BEC A;  3VSK A;  2HP6 A;  2XF3 A;  2Y2J A;  1ERO A;  3A3D A;  1K55 A;  3N8S A;  4WZ5 C;  1EI5 A;  5HX9 A;  5FAQ A;  3NC8 A;  1H8Y A;  1QME A;  4E3O A;  4S2N C;  4QU3 A;  1XKZ A;  4WEK A;  1KDW A;  1LI9 A;  2XFT A;  2BG1 A;  1YMX A;  1IEL A;  3G34 A;  2XEP A;  2P74 A;  4QY5 A;  2QZ6 A;  4JXW A;  1YLW A;  1KGE A;  4N9K A;  4PMA A;  4GD6 A;  2Y91 A;  4ID4 A;  1BTL A;  5DF7 A;  3GSG A;  3LY3 A;  1ESU A;  1MPL A;  4EV4 A;  3VP0 A;  1PW1 A;  1Z6F A;  3FWL A;  3BLS A;  2Y55 A;  3WRT A;  1XX2 A;  3CJM A;  3RJU A;  3ZNY A;  4XUZ A;  2J9P A;  5KMW A;  3QNB A;  2IWD A;  2C5W B;  2WZZ A;  4RA7 A;  1ERQ A;  5J8X A;  5E2E A;  4KG2 A;  5I94 A;  5A93 A;  4QB8 A;  2QMI A;  1ES5 A;  4DRT A;  4CPK A;  4XUX A;  3VFH A;  1TDL A;  2I72 A;  3HLD A;  1BZA A;  1AXB A;  1XXM A;  5FI2 A;  2ZLY A;  3MZE A;  2EX8 A;  3ISG A;  1XA7 A;  4RX3 A;  4MNR A;  3UPN A;  4X69 A;  4OQH A;  2JC7 A;  3HUM A;  1L0F A;  1RCJ A;  3GR2 A;  3LEZ A;  2HP5 A;  3VP3 A;  4B88 A;  4S2N A;  5M19 A;  1YQS A;  3E2L A;  1SDE A;  1E25 A;  5CHM A;  2XH9 A;  2OSU A;  5GLC A;  3VOZ A;  3IXD A;  3O3V A;  1CEG A;  4GZB A;  4H8R A;  3A3F A;  5FAP A;  4EWF A;  3SS5 A;  3IF6 A;  5AQ7 A;  5CEB A;  2PU2 A;  1G6A A;  1PZO A;  5TGF A;  3WS5 A;  1BLS A;  4KZ4 A;  3ZNT A;  2C6W B;  5A92 A;  4K91 A;  1KGG A;  2Y2M A;  4Y7P A;  1BT5 A;  1K25 A;  5DTK A;  4ZJ3 A;  4IVI A;  2Z2L B;  2A49 A; 
#chains in the Genus database with same CATH topology
 2O9C A;  1N9L A;  1ESI A;  3QP6 A;  3ZDJ A;  1K57 A;  4QJG A;  4RQ9 A;  4X68 A;  5HDS A;  2VJW A;  3G31 A;  4E3I A;  3OCN A;  2H10 A;  3FZC A;  2QYB A;  3V39 A;  1TF1 A;  4HIA A;  5CER A;  5DFY A;  3HVF A;  3LCE A;  3Q7Z A;  4MN5 A;  2CMN A;  4N1X A;  3K3D A;  5FQQ A;  3D4F A;  4XT2 A;  4KEN B;  1J3W A;  1TD5 A;  3NBL A;  3HBR A;  1DJC A;  1NXY A;  2L4R A;  1P0Z A;  2ZC4 B;  2ZBB A;  5EVI A;  3JPU A;  2OAP 1;  3MZF A;  3QP8 A;  4ZDX A;  2VGL S;  4UAA A;  1BLP A;  2XD5 A;  1MXO A;  3ZGA B;  4OQI A;  5HDD A;  2BAS A;  2D01 A;  4JGQ A;  5DJU A;  4Y5F A;  4ARZ B;  1Q2Q A;  3SW1 A;  4ZBE A;  1ZC2 A;  3ICY A;  4DKI A;  4X25 A;  5BOH A;  3HLG A;  2VV8 A;  1YLZ A;  1MKM A;  1S4S A;  1W63 M;  4DF6 A;  1J9M A;  1LI0 A;  1VB6 A;  3UE3 A;  4FD8 A;  3IQA A;  5A8B A;  3C8C A;  4PKY G;  4X56 A;  1DJA A;  5U47 A;  4RX2 A;  4LRZ E;  4OPQ A;  3G2Y A;  2J3T C;  2Z6C A;  4NXG A;  5HW3 A;  3G35 A;  5AQB A;  4Y17 A;  3T4J A;  5FQK A;  4BD1 A;  3KSG A;  3T1X A;  3B3X A;  4OP8 A;  4R1G A;  4EU0 A;  3PXP A;  4HH2 A;  1IYQ A;  5EE8 A;  3IT9 A;  4LFU A;  4NET A;  2OWJ A;  1FR6 A;  5FQ9 A;  1SCW A;  4Y2F A;  4E6W A;  2JE5 A;  3M6B A;  3O88 A;  4MN6 A;  4QD4 A;  5M1A A;  3O86 A;  3T4L A;  5DF9 A;  2PR5 A;  3MS6 A;  2V8C A;  5FAS A;  3EOI A;  4EUV A;  1MWT A;  4HHD A;  3S7N A;  2JCH A;  3Q07 A;  4NEE D;  1PW8 A;  1NY0 A;  5HAQ A;  3QP1 A;  4HJ3 A;  5CGS A;  2WKI A;  4CJN A;  5GHY A;  5KIZ A;  1GSV A;  5FAT A;  4KQR A;  2ZM2 A;  3N6I A;  1VM1 A;  5L8M A;  1IKG A;  3FC7 A;  4E3L A;  4NK3 A;  1E4D A;  1YMS A;  3BFF A;  4Y0U A;  1PZP A;  3C38 A;  3CG5 A;  1V9Z A;  2B18 A;  1VET B;  1K0K A;  2G2W A;  4WMC A;  1O07 A;  3CUE A;  1ZG4 A;  3L9K A;  4GJ4 A;  4BBT A;  3DWK A;  3VP1 A;  4I5S A;  4D2O A;  2PD7 A;  4DXB A;  4EEP A;  1W63 Q;  4I39 A;  1OTD A;  2ZQ8 A;  1ONG A;  2VEA A;  3LYX A;  2WGW A;  3OOV A;  3NUL A;  2ACG A;  2ZQ7 A;  1W5D A;  2FZ0 A;  1A0K A;  2Y79 A;  4JGP A;  2ZD8 A;  2WAD A;  4F3L A;  2DMW A;  2FFF B;  1ONH A;  4P6Z M;  4EEU A;  4N92 A;  3H7W B;  3A3J A;  3S22 A;  5EFW A;  1ZHH B;  5F5Y A;  1IEM A;  3VFF A;  1F5M A;  4I38 A;  1LL8 A;  5DKK A;  3MQO A;  1HTZ A;  3IHB A;  3Q1F A;  4ESP A;  3Q82 A;  1T19 A;  1CI8 A;  1RGZ A;  4E3M A;  4GD8 A;  1WA9 A;  2D02 A;  2ZL1 A;  3TE8 A;  2IWB A;  1K56 D;  4L9E A;  3VE4 A;  1BUL A;  4GCZ A;  2WGV A;  5FDH A;  4HES A;  5CED A;  3NI9 A;  2WZX A;  4R0Q A;  3BY8 A;  4GDN A;  5HWW A;  4ZRR A;  2JBF A;  3SH9 A;  4UA6 A;  4EBL A;  3U2A A;  1O7E A;  3GDI A;  1GHP A;  4GN2 A;  2R78 A;  3HJK A;  3RXW A;  3N4I A;  3G4P A;  2EFX A;  3LFV A;  4FH2 A;  3UMD A;  3DW0 A;  3ZG0 A;  4Z9Q A;  3C7U A;  1T1A A;  4OKP A;  3H9W A;  2HGV A;  1L0E A;  4GKU A;  5EV0 A;  1PI4 A;  3G6O A;  5HD3 A;  1OJ5 A;  1OJG A;  2I9V A;  2KOI A;  1L3L A;  3TRC A;  3CHW P;  3ZFZ A;  4WEL A;  2WKR A;  1NYY A;  5EVI D;  3SH8 A;  3BQ8 A;  1UWN X;  2WKH A;  2HJ9 C;  3F1P B;  2WUQ A;  3V50 A;  1FOF A;  2GX5 A;  3PBO A;  4EUZ A;  1D7E A;  1Y28 A;  1NRJ A;  1TS8 A;  4KG6 A;  3O5Y A;  5TBM B;  4UHU A;  3JVU A;  5HWT A;  3AGF A;  3WS4 A;  3PR6 A;  3U4L P;  2YKF A;  5EM0 A;  3PBR A;  5IHV A;  3BFE A;  2Y2J A;  4MN7 A;  3N8S A;  5HX9 A;  2JKR M;  2Q0O A;  3K3C A;  3R4K A;  3EWK A;  4XT2 B;  1D06 A;  1Z6F A;  3T12 B;  3NOP C;  4KUO A;  3KX0 X;  1GSX A;  2WZZ A;  1OPX A;  4KG2 A;  2QMI A;  4BMW A;  4DRT A;  4XUX A;  1TDL A;  3MZE A;  4MNR A;  3UPN A;  2JC7 A;  3DTE A;  4X1L A;  1L0F A;  3GR2 A;  3LEZ A;  4HJ6 A;  3E2L A;  2NUT C;  2XH9 A;  2OSU A;  5GLC A;  3E4Q A;  2NUP C;  2E8J A;  4EWF A;  4HP9 A;  2O99 A;  2V8F A;  4LRY C;  2PU2 A;  4G3K A;  1BLS A;  4KZ4 A;  4PKY A;  4KUK A;  4K91 A;  3RH8 B;  5IS1 A;  5DTK A;  2A49 A;  2VK3 A;  5EVI C;  3W8K A;  2ZMA A;  3ITB A;  5CHU A;  3BLM A;  1HVB A;  1KDS A;  3CI6 A;  2HPB A;  2M1C A;  2Y2P A;  4LEN A;  3MQ0 A;  5EUA A;  5JYO A;  3NDE A;  4E3K A;  2W3G A;  2CC1 A;  3SS3 A;  4I3A A;  5HD5 A;  1GSW A;  5HL1 A;  3OPR A;  5J4E A;  3GMW A;  3MMH A;  1I2S A;  1Q2P A;  3E2K A;  1L2S A;  1DY6 A;  2XK1 A;  3HLB A;  3VSL A;  5HPF A;  2Y59 A;  3V3R A;  1DP8 A;  3OC2 A;  3R7W A;  4WYY A;  3MJQ A;  4P6B A;  5A91 A;  4KQO A;  2MJ6 A;  2ZC7 A;  4HNB A;  5FI7 A;  2BLS A;  4UA9 A;  5EVE A;  4Y0O A;  1NLY A;  1T18 A;  1IFQ A;  1BYW A;  5GHX A;  3NIA A;  4Q0I A;  3MSH A;  4YIN A;  2DCF A;  1SZV A;  1QMF A;  3G2Z A;  3P98 A;  5CGW A;  4WZ4 A;  1CI9 A;  2IWC A;  2Y2O A;  1K38 A;  4MMN A;  4OPZ A;  2PHY A;  3EQU A;  3BM6 A;  4UQI S;  3S7O A;  2X71 A;  1I2W A;  4G3W A;  3SOI A;  4OP5 A;  3M6H A;  2Q9N A;  4ZJ2 A;  4OH0 A;  2XQZ A;  2XR0 A;  3HUO A;  2A24 A;  3UB5 P;  2WGW B;  3ULF A;  3DTM A;  3JYI A;  1K56 A;  1ES3 A;  1UGU A;  3VOY A;  2KDK A;  5CXW A;  2O9A A;  3QNC A;  3QP5 A;  2VX8 A;  3LUQ A;  3MKF A;  4F3L B;  5AQA A;  2L0W A;  3CUE C;  4P0M A;  1ZG6 A;  1L0G A;  5KZH A;  3LI9 A;  2Y2G A;  1FIL A;  1PYY A;  3V5M A;  1Z09 A;  4JXS A;  4S2J A;  1UWP X;  2VGJ A;  1VHM A;  3BFC A;  5FI6 A;  4C6Y A;  2W3H A;  1OT9 A;  3IXH A;  4S2P A;  1NRF A;  2V9A A;  4QHC A;  2ZL1 B;  1P9W A;  4JLF A;  4R70 A;  1ES2 A;  3H82 A;  1NYM A;  3MFX A;  5G18 A;  3W4O A;  4E3J A;  3FKW A;  3UY6 A;  4O0P A;  2QJ7 A;  1FSY A;  3KYE A;  3TW8 A;  5CHJ A;  5L09 A;  1G6O A;  1JVJ A;  2JKT M;  5EPH A;  4DE1 A;  1JTG A;  5F6A A;  1XJ6 A;  3N7W A;  4FH4 A;  1F98 A;  2PU4 A;  3PHY A;  4LV3 A;  4U0T A;  1VQQ A;  3IWO A;  1FSW A;  1PWC A;  1PNE A;  3KSH A;  3ZG5 A;  3MQQ A;  2V2F F;  2VGL M;  5GLD A;  2W0N A;  4GS9 B;  3PYP A;  5MC7 A;  4R4S A;  2HJE A;  5FA7 A;  1SKF A;  3HUN A;  4MCW A;  3G32 A;  3V67 A;  3BRM A;  3BY9 A;  2W3D A;  4BL3 A;  4DE0 A;  2KLI A;  4HEF A;  2XFS A;  4GHI A;  5IU1 A;  1YLP A;  3V3S A;  1ERM A;  3F1N B;  2ZM0 A;  2JHE A;  5TR7 A;  3LGO A;  3E0Y A;  5EOE A;  4KZB A;  3MF0 A;  2AVX A;  2P08 A;  4LCM A;  4RYE A;  5D3O A;  2M7U A;  3IXG A;  1G68 A;  4R6L A;  2WKP A;  4WL9 A;  3UE6 A;  2K2N A;  1TEM A;  2P9V A;  2INW A;  3DAV A;  4DJ2 A;  2GJ3 A;  3WWX A;  1L0D A;  2PYP A;  3AGD A;  2ZC6 B;  5L07 A;  2XDM A;  4OVD A;  3K2N A;  2V1Z A;  1TDG A;  4NXF A;  5GLA A;  2HDQ A;  1LSW A;  4B4Z A;  5DJT A;  3LIB A;  2Q9M A;  4EQI A;  3T4S A;  2Z2M B;  2FFY A;  1T1B A;  4N1H A;  1IYP A;  1STZ A;  3LEQ A;  4QPR A;  1H5X A;  1LSX A;  3UPO A;  1LL9 A;  4EBP A;  3C2W A;  1G5U A;  4WM9 A;  3TJZ C;  4XXR A;  3TSG A;  1LL5 A;  4HBU A;  1TS7 A;  4OON A;  3ZCZ A;  2QJ5 A;  3HLW A;  2J7V A;  2Y2I A;  4HQA A;  4A5R A;  2ZM8 A;  3ZYT A;  5F68 A;  1S67 L;  1FCN A;  4OLG A;  4F94 A;  3OPL A;  2OLU A;  4LRX C;  2W1T A;  5F1G A;  1YKD A;  4X53 A;  4IUH A;  4ME4 A;  4X55 A;  1PI5 A;  4BBU A;  2O9B A;  4K0W A;  3BJN A;  4LV1 A;  2Y4A A;  4GB7 A;  5KSC A;  4PM9 A;  3BEC A;  4HOI A;  4P6Z S;  1N9N A;  2JKF A;  1ERO A;  3A3D A;  3NC8 A;  5J3W A;  2BG1 A;  1DRM A;  2XEP A;  2P74 A;  2QZ6 A;  4JXW A;  1XJ2 A;  4PMA A;  5DF7 A;  3GSG A;  2G7U A;  3VP0 A;  2W3F A;  1LSV A;  3BLS A;  3WRT A;  2M7V A;  3QP2 A;  3CJM A;  3ZNY A;  5KMW A;  4RA7 A;  1ERQ A;  3SZT A;  5A93 A;  1ES5 A;  1OT6 A;  2I72 A;  3R7W B;  1XXM A;  2GZA A;  3ISG A;  1XA7 A;  3LIC A;  3UB6 A;  3VOL A;  4B88 A;  3UB8 A;  3IXD A;  1CEG A;  2XA7 M;  3A3F A;  5CEB A;  3WS5 A;  2C6W B;  3LR3 A;  5A92 A;  2Y2M A;  4ZJ3 A;  3KSI A;  4KQD A;  4IVI A;  2Z2L B;  4KZ5 A;  5LBR A;  4ETZ A;  4MBF A;  5F82 A;  4C75 A;  3PBS A;  3SS4 A;  4R3J A;  3UE0 A;  5HPI A;  3A0S A;  4LV2 A;  3SH7 A;  4R4R A;  3NCK A;  2HF6 A;  4P87 A;  4KZ8 A;  2ZQC A;  3UNW A;  4ARZ A;  1W79 A;  2OWH A;  4EXO A;  2VV7 A;  2DNS A;  2Y2K A;  3EQV A;  2HDR A;  2LB9 A;  1NWZ A;  1MZU A;  4WN5 A;  1K54 A;  2OAQ 1;  2Y2Q A;  3IS2 A;  4O7D A;  3BEB A;  1YPR A;  1RGY A;  4JKT A;  3EGD C;  5J7E A;  2G2U A;  1H3Q A;  2PD8 A;  5HAR A;  4R3B A;  2EX6 A;  5EEC A;  1S1Z A;  3M2J A;  4MBK A;  4BJP A;  3D3O A;  5GHZ A;  1CEF A;  3C4P A;  3WRZ A;  2ZMV A;  1BLH A;  1XGJ A;  4L0L A;  4BD0 A;  4HH3 A;  4GW9 A;  5E2F A;  1BLC A;  3RXX A;  2PT7 A;  5E43 A;  5KSH A;  4X6T A;  5EVI B;  3ITA A;  4Y13 A;  2P7J A;  1OTB A;  1WYC A;  2V1A A;  3G30 A;  3BFG A;  5DTS A;  5HWV A;  3FYZ A;  2RL3 A;  5CGX A;  3E4P A;  5EOO A;  3ZVT A;  3B47 A;  3FPW A;  1LHY A;  2H28 A;  1FR1 A;  4DJ3 A;  3HL9 A;  1KOU A;  3IXB A;  4CLC E;  5DF8 A;  2J80 A;  3CZD A;  4KZ7 A;  1S66 L;  3MXQ A;  3OBF A;  2GDN A;  1IKI A;  3OPP A;  4DDS A;  1GHM A;  1TS0 A;  1CJF A;  4IBX A;  3A3E A;  4OLD A;  5FQM A;  4M4X A;  1D1J A;  1DJB A;  3WS1 A;  3UDF A;  3GEC A;  4OOY A;  3PBN A;  1BUE A;  4GHI B;  4GOG A;  1H0M A;  4CLC D;  4S2I A;  2JKR I;  1M6K A;  1MBL A;  3KYQ A;  3UDI A;  2B02 A;  1FCO A;  1ZTU A;  3LIE A;  3Q7V A;  1K6S A;  3T50 A;  5AJG A;  4EBN A;  3W4Q A;  5M18 A;  4DE2 A;  2KX6 A;  1HZO A;  4NXE A;  1M40 A;  3W2Z A;  1CK3 A;  1KVM A;  2P9V B;  1RP5 A;  4BBV A;  2ZC5 B;  3IH8 A;  2H0Y A;  3CIT A;  4LPZ A;  2VA0 A;  4BWI A;  3T4O A;  3CWF A;  1XPB A;  3LY4 A;  3PTE A;  3I7J A;  3P01 A;  3CLO A;  3E98 A;  2A3U A;  5GLB A;  2W27 A;  1NLZ A;  1DP6 A;  4L9F A;  4NXB A;  4Q0H A;  3DTK A;  2PAV P;  3PBT A;  2EWW A;  2B5R A;  1IYO A;  3IX4 A;  4FUW A;  5FAO A;  5AQ9 A;  1N9B A;  3ZHH A;  1FIK A;  4EW7 A;  3UB9 A;  1OME A;  3VE3 A;  1JWZ A;  1KVL A;  1KE3 A;  3UO9 A;  1XGI A;  3UME A;  3KSF A;  3IF6 C;  1VEU A;  1V9Y A;  3T4Q A;  3ZVW A;  3HLE A;  2LB5 A;  2R9X A;  5DFX A;  2PRF A;  3LO7 A;  3NDG A;  5IT5 A;  2VKS A;  3F1O A;  5HFO A;  3VP4 A;  2UV0 E;  2ZC3 B;  3W4P A;  1FQG A;  3LR4 A;  1S0W A;  4E3N A;  2W1T B;  1NZU A;  3UN7 A;  3LID A;  4Q0J A;  4UQI M;  2XD1 A;  4ZJ1 A;  4N9L A;  2PBD P;  3WS2 A;  4DMZ A;  1SKO A;  3IWQ A;  1NZO A;  1W8Y A;  3MKE A;  1GCE A;  1WE4 A;  1K6R A;  4LV0 A;  4CLC C;  2J3T D;  1LLB A;  3MZD A;  1MC0 A;  4MLL A;  5HZH A;  1G28 A;  1FCM A;  1I5Q A;  2UWX A;  1XFN A;  5TBM A;  4JF4 A;  4O01 A;  4E6X A;  3ZG7 B;  3HCY A;  2YKH A;  4EES A;  1PWD A;  2EWV A;  3VMA A;  1SDN A;  4PAU A;  3A3I A;  3MFD A;  1ACF A;  2WK0 A;  4OQ0 A;  4U3T A;  3MXS A;  4PPR A;  3CPT A;  2B95 A;  2Y8H A;  3IF5 A;  4Y0T A;  3CMZ A;  2E8I A;  1JTD A;  4KG5 A;  4DE3 A;  5CTM A;  4H6J A;  5EM1 A;  4FCF A;  2EA9 A;  3C7V A;  1W7F A;  3KYZ A;  5AVF A;  3FPV A;  3NHQ A;  2O0Y A;  4HBT A;  5A90 A;  3T4T A;  3N8L A;  1E3U D;  2W3E A;  1JNU A;  1F2K A;  3FV7 A;  4MDZ A;  1YSP A;  1MWS A;  1OTA A;  5F69 A;  2XF3 A;  4LGW A;  4WZ5 C;  1K55 A;  2BTF P;  1EI5 A;  5FAQ A;  1H8Y A;  1QME A;  1IOU A;  4QU3 A;  1LI9 A;  2XFT A;  1IEL A;  3G34 A;  4QY5 A;  4N9K A;  1OTE A;  4EER A;  4JGR A;  1MPL A;  1PW1 A;  2IA2 A;  3IX8 A;  1XX2 A;  3FG8 A;  2J9P A;  3IS2 B;  2C5W B;  5E2E A;  5I94 A;  4QB8 A;  2QHK A;  3VFH A;  1BZA A;  1AXB A;  2ZLY A;  4EQ1 A;  2EX8 A;  3EEH A;  3A0R A;  4OQH A;  3HUM A;  4AFI A;  1RCJ A;  5M19 A;  2HP5 A;  3VP3 A;  4S2N A;  1YQS A;  1X0O A;  3VOZ A;  4H8R A;  3DBA A;  3SS5 A;  3IF6 A;  2JKT I;  3IBJ A;  5TGF A;  3ZNT A;  1HLU P;  4Y7P A;  4R23 A;  1K54 C;  2WGI A;  4R3A A;  2H0T A;  5E2G A;  2EXB A;  2VZW A;  5F1F A;  4C3Q A;  2HDS A;  4NKP A;  1PFL A;  2P04 A;  1F9I A;  1JWV A;  3GV9 A;  3UDX A;  4IBR A;  3BFD A;  2XRN A;  1Y54 A;  2L1M A;  3LI8 A;  1U60 A;  4CLC A;  2ZQ9 A;  1S6R A;  4FSF A;  4IHQ A;  3ZG8 B;  2QPN A;  4JXV A;  2Y2N A;  4BL2 A;  3IH9 A;  3A0V A;  4OOM A;  2WKQ A;  4I3J A;  4GLQ A;  4L9G A;  3VP2 A;  1H8M A;  3C4O A;  3S7P A;  3NY4 A;  4HJ4 A;  3PAE A;  5C5K A;  4B93 A;  3E4O A;  5G4Z A;  3DTI A;  4Y3I A;  4IJG A;  3OPH A;  4X1M A;  3TG9 A;  2HV1 A;  4FTX A;  4YFM A;  2VV6 A;  4BQM A;  3IX3 A;  5HDC A;  4GDB A;  3GVB A;  5E2H A;  1TVF A;  1XP4 A;  1MY8 A;  3QHY A;  5JYP A;  4D60 A;  1EWZ A;  4OQG A;  2V0W A;  1LT0 A;  1YM1 A;  2J9O A;  2HP9 A;  3Q7V B;  4Q8I A;  1YLT A;  1ES4 A;  3NOT C;  4B9O A;  4KZ3 A;  2JKG A;  3HLC A;  3BWL A;  4HP4 A;  1W8Q A;  5FQJ A;  3BW6 A;  5FQI A;  3BYD A;  3NEC A;  3S4X A;  2DRW A;  4JGO A;  3L7H A;  2OLV A;  4ZTK A;  4WZ5 A;  4II7 A;  1JWP A;  2V0U A;  4S2M A;  4ZAM A;  5FEF A;  1GA9 A;  2V1B A;  5DTT A;  2XA7 S;  1ODV A;  2K31 A;  2WYX A;  4MEZ A;  5DKL A;  2WAE A;  2Y2L A;  5F83 A;  2PBY A;  5L2F A;  5TJJ A;  2JN7 A;  4PM7 A;  4WLA A;  5HAI A;  4K0X A;  1HD8 A;  3O87 A;  3MBZ A;  1CQA A;  3AGE A;  4JF5 A;  3C5A A;  2EX2 A;  1GHI A;  1VEU B;  4MBH A;  4M3K A;  1MWU A;  3F1O B;  4PM8 A;  4KQQ A;  1K4E A;  2A24 B;  2GNX A;  4I3I A;  1PRQ A;  3HRE A;  4S2L A;  2ZJ9 A;  1XFQ A;  2X02 A;  4GS9 A;  2EXA A;  1YT4 A;  4KZA A;  4DXC A;  4OPY A;  1SKO B;  4QWO A;  4GNU A;  3IBR A;  3OZH A;  3HLF A;  3B42 A;  2OOL A;  3S1Y A;  2XRO A;  2ZMF A;  1MWR A;  2HDU A;  1ZKJ A;  4PHT A;  3ZG9 B;  3F1N A;  5GL9 A;  4IVK A;  5FEG A;  5L10 A;  1E3U A;  2ZQA A;  1OTI A;  1N9O A;  4PM6 A;  4P85 A;  2WKE A;  3GTC A;  1WYB A;  4WF0 A;  3H82 B;  2OV5 A;  1ALQ A;  4JPM A;  4K08 A;  4RVA A;  5FSR A;  4YNR A;  3CPT B;  3LR5 A;  3TOI A;  1KGF A;  3PAG A;  2EFU A;  1MKI A;  2WAF A;  3GRJ A;  1XA1 A;  4UEY A;  5FDS A;  4H6J B;  1PIO A;  1PWG A;  4YOF A;  4JF6 A;  5EVL A;  1N4O A;  3NJA A;  3PBQ A;  4S2O A;  3OLO A;  2PR6 A;  4FOF A;  3ZQ5 A;  4E04 A;  3MXR A;  3HJI A;  1CF0 A;  1K57 C;  1BSG A;  2H5S A;  3UE1 A;  3IHA A;  4OOL A;  2ZQD A;  1Y4O A;  1VET A;  3GQZ A;  3LR0 A;  1XJ4 A;  4OPR A;  2ZOI A;  2EX9 A;  3T1Q B;  3FKV A;  3QP4 A;  2XGN A;  2QWS A;  5HAP A;  2X01 A;  1H8Z A;  5HL6 A;  4LLO B;  4IUK A;  1IYS A;  1AWI A;  4U0X A;  4CQH A;  5CRF A;  1DP9 A;  1GA0 A;  1YSQ A;  1TS6 A;  4JXG A;  4B4X A;  3P7N A;  2K7S A;  3LIF A;  5HSQ A;  1K4F A;  2VLG A;  2VGK A;  1SHV A;  3LIA A;  4KZ6 A;  2HZ5 A;  4G3V A;  3N8R A;  4IED A;  1C3B A;  4JBF A;  2RCX A;  5CTN A;  1S4R A;  4WBG A;  5TFQ A;  4NG2 A;  4PM5 A;  4WEJ A;  1P9R A;  3OCL A;  2XLN A;  1S1Y A;  4WMC D;  2V20 A;  3NOU C;  3D9Y A;  1K55 C;  3H7W A;  1YLY A;  2J8Y A;  2Y2H A;  1YLJ A;  2A2L A;  4KZ9 A;  1YAX A;  5DVA A;  2R9W A;  3MR0 A;  3IF6 B;  3P09 A;  3UPP A;  3EEA A;  4YWZ A;  4BLM A;  2J3W A;  1KE0 A;  4BEN A;  3Q81 A;  3EGX C;  2W1R A;  1KE4 A;  3RFB A;  4DDY A;  3DWZ A;  4LCL A;  5CEC A;  3IWI A;  4Y15 A;  3T4K A;  4S2K A;  4UA7 A;  3WS0 A;  1NJ4 A;  4QY6 A;  3M2K A;  2Z6D A;  3VSK A;  5G4Y A;  2HP6 A;  3D72 A;  4E3O A;  4S2N C;  1XKZ A;  4WEK A;  1KDW A;  1YMX A;  1EW0 A;  3RTY A;  1P97 A;  4CLC B;  1YLW A;  1KGE A;  4GD6 A;  2Y91 A;  4ID4 A;  1XJ3 A;  1BTL A;  3KO6 A;  3LY3 A;  1ESU A;  4EV4 A;  3S7Q A;  4HY8 A;  3BQA A;  4O8G A;  5K5B A;  3FWL A;  2Y55 A;  3RJU A;  4XUZ A;  4WUJ A;  3JVV A;  3QNB A;  2IWD A;  3VV4 A;  4Z1W A;  5J8X A;  4DN0 A;  3T1S A;  1T1C A;  4CPK A;  3HLD A;  4HI4 A;  5FI2 A;  4R38 A;  4RX3 A;  2PYR A;  2FH5 A;  4X69 A;  4EET B;  1SDE A;  1E25 A;  3B33 A;  5CHM A;  3CAX A;  2XSS A;  3O3V A;  3F1P A;  2ZOH A;  4GZB A;  5FAP A;  2QKP A;  5AQ7 A;  5AVE A;  1G6A A;  5FL3 A;  5CX7 A;  1PZO A;  3C30 A;  3UB7 A;  2PDR A;  1KGG A;  1BT5 A;  1K25 A;  4ETX A;  5I5L A;  3T1R A; 
#chains in the Genus database with same CATH homology
 1K54 C;  2WGI A;  2H0T A;  4MBF A;  5E2G A;  2EXB A;  5F82 A;  4C75 A;  5F1F A;  1ESI A;  3PBS A;  3SS4 A;  4C3Q A;  2HDS A;  3ZDJ A;  4R3J A;  3UE0 A;  1K57 A;  5EVI C;  4QJG A;  4LV2 A;  4X68 A;  3W8K A;  2ZMA A;  3ITB A;  5CHU A;  3SH7 A;  3BLM A;  4R4R A;  3NCK A;  1HVB A;  3G31 A;  1KDS A;  4E3I A;  3OCN A;  2H10 A;  3FZC A;  1JWV A;  2HPB A;  3GV9 A;  4P87 A;  3UDX A;  4KZ8 A;  2ZQC A;  3UNW A;  4IBR A;  3V39 A;  3BFD A;  1Y54 A;  1W79 A;  2Y2P A;  5CER A;  1U60 A;  4LEN A;  3HVF A;  3LCE A;  3Q7Z A;  5EUA A;  5JYO A;  3NDE A;  4E3K A;  4N1X A;  5FQQ A;  2ZQ9 A;  3D4F A;  1S6R A;  4FSF A;  2DNS A;  2CC1 A;  2QPN A;  3SS3 A;  4JXV A;  3ZG8 B;  2Y2K A;  2Y2N A;  3EQV A;  4BL2 A;  2HDR A;  3IH9 A;  5HL1 A;  3OPR A;  4OOM A;  4KEN B;  3NBL A;  1K54 A;  3HBR A;  3VP2 A;  1DJC A;  2Y2Q A;  3GMW A;  1NXY A;  4O7D A;  1I2S A;  3C4O A;  2ZC4 B;  1Q2P A;  3E2K A;  1L2S A;  1DY6 A;  3BEB A;  2XK1 A;  1RGY A;  5EVI A;  4JKT A;  3HLB A;  3NY4 A;  3VSL A;  2Y59 A;  3MZF A;  3V3R A;  3PAE A;  3OC2 A;  4WYY A;  4ZDX A;  4P6B A;  1BLP A;  4UAA A;  2G2U A;  2XD5 A;  3OPH A;  1MXO A;  5HAR A;  3ZGA B;  5A91 A;  4R3B A;  4OQI A;  4KQO A;  2EX6 A;  5EEC A;  2ZC7 A;  3TG9 A;  5FI7 A;  2BLS A;  4YFM A;  4BQM A;  3M2J A;  4GDB A;  4MBK A;  4BJP A;  4UA9 A;  1Q2Q A;  3GVB A;  5E2H A;  4Y0O A;  1TVF A;  4ZBE A;  1ZC2 A;  5GHZ A;  1XP4 A;  1CEF A;  4DKI A;  1MY8 A;  3C4P A;  3WRZ A;  3QHY A;  5BOH A;  3HLG A;  5GHX A;  5JYP A;  3NIA A;  4R23 A;  1BLH A;  1EWZ A;  1YLZ A;  4OQG A;  1XGJ A;  4L0L A;  4YIN A;  2DCF A;  4BD0 A;  1QMF A;  4DF6 A;  1YM1 A;  2J9O A;  2HP9 A;  3G2Z A;  3Q7V B;  1BLC A;  1J9M A;  3P98 A;  5CGW A;  1LI0 A;  4WZ4 A;  3RXX A;  4FD8 A;  3UE3 A;  4Q8I A;  3IQA A;  1CI9 A;  5E43 A;  2IWC A;  2Y2O A;  4X56 A;  1K38 A;  5KSH A;  1YLT A;  1DJA A;  4X6T A;  1ES4 A;  5U47 A;  4RX2 A;  5EVI B;  3ITA A;  4KZ3 A;  4OPZ A;  3HLC A;  4OPQ A;  1W8Q A;  5FQJ A;  3EQU A;  3G2Y A;  3BM6 A;  5FQI A;  2X71 A;  1I2W A;  3BYD A;  3S4X A;  2DRW A;  3SOI A;  1WYC A;  3G30 A;  4OP5 A;  2OLV A;  3BFG A;  5DTS A;  4ZTK A;  4WZ5 A;  3M6H A;  3FYZ A;  2Q9N A;  2RL3 A;  1JWP A;  5CGX A;  4ZJ2 A;  5HW3 A;  3G35 A;  4S2M A;  4ZAM A;  4OH0 A;  2XQZ A;  1GA9 A;  5AQB A;  2XR0 A;  3HUO A;  5EOO A;  5DTT A;  3ZVT A;  5FQK A;  2WGW B;  1LHY A;  4BD1 A;  3DTM A;  2WYX A;  3JYI A;  4MEZ A;  3B3X A;  1FR1 A;  4OP8 A;  1K56 A;  1ES3 A;  2WAE A;  2Y2L A;  3HL9 A;  3IXB A;  5F83 A;  3VOY A;  2PBY A;  4R1G A;  5CXW A;  5DF8 A;  5L2F A;  1IYQ A;  3CZD A;  5EE8 A;  3QNC A;  4KZ7 A;  3IT9 A;  4NET A;  3MKF A;  2GDN A;  1IKI A;  1FR6 A;  3OPP A;  5FQ9 A;  1SCW A;  4E6W A;  4PM7 A;  2JE5 A;  5AQA A;  3M6B A;  5HAI A;  4DDS A;  1GHM A;  3O88 A;  4P0M A;  4K0X A;  1ZG6 A;  1HD8 A;  4QD4 A;  5M1A A;  1L0G A;  3O86 A;  3O87 A;  5DF9 A;  4IBX A;  3A3E A;  2Y2G A;  4OLD A;  3MBZ A;  5FQM A;  5KZH A;  5FAS A;  3AGE A;  4JF5 A;  3C5A A;  1PYY A;  1DJB A;  1MWT A;  2EX2 A;  3WS1 A;  3V5M A;  1GHI A;  2JCH A;  3Q07 A;  1NY0 A;  1PW8 A;  4MBH A;  3UDF A;  5HAQ A;  5CGS A;  4M3K A;  4OOY A;  1MWU A;  2WKI A;  3PBN A;  5GHY A;  4JXS A;  4CJN A;  5FAT A;  4KQR A;  4S2J A;  1BUE A;  2ZM2 A;  4PM8 A;  3N6I A;  2VGJ A;  4GOG A;  3BFC A;  5FI6 A;  4C6Y A;  4KQQ A;  3IXH A;  1VM1 A;  4S2P A;  1K4E A;  4S2I A;  1IKG A;  1NRF A;  1M6K A;  1MBL A;  4QHC A;  4NK3 A;  4E3L A;  1E4D A;  1YMS A;  4JLF A;  3UDI A;  3BFF A;  3HRE A;  4Y0U A;  1PZP A;  1ES2 A;  4S2L A;  2ZJ9 A;  2X02 A;  1NYM A;  3CG5 A;  5G18 A;  3W4O A;  4E3J A;  3FKW A;  1FCO A;  2EXA A;  3UY6 A;  3Q7V A;  2G2W A;  1K6S A;  1FSY A;  4WMC A;  1O07 A;  1YT4 A;  4KZA A;  4DXC A;  4EBN A;  3W4Q A;  1ZG4 A;  5CHJ A;  5M18 A;  4OPY A;  4GNU A;  4DE2 A;  3OZH A;  1HZO A;  3HLF A;  1JVJ A;  1M40 A;  3S1Y A;  3DWK A;  3VP1 A;  1CK3 A;  5EPH A;  1KVM A;  4D2O A;  2P9V B;  1RP5 A;  4DE1 A;  4DXB A;  2ZC5 B;  1JTG A;  1MWR A;  3IH8 A;  2H0Y A;  2HDU A;  3N7W A;  1ZKJ A;  4FH4 A;  2PU4 A;  4LV3 A;  2ZQ8 A;  4U0T A;  1ONG A;  3ZG9 B;  1VQQ A;  3IWO A;  1XPB A;  2WGW A;  3LY4 A;  3PTE A;  3I7J A;  5GL9 A;  2A3U A;  5GLB A;  1FSW A;  4IVK A;  1PWC A;  1E3U A;  2ZQA A;  2ZQ7 A;  3ZG5 A;  4PM6 A;  1W5D A;  4P85 A;  2WKE A;  3PBT A;  3GTC A;  2V2F F;  2B5R A;  1IYO A;  5FAO A;  1WYB A;  5AQ9 A;  1N9B A;  5GLD A;  3ZHH A;  2ZD8 A;  2WAD A;  2OV5 A;  1OME A;  2FFF B;  1JWZ A;  1KVL A;  1KE3 A;  1ALQ A;  1ONH A;  4R4S A;  5FA7 A;  4JPM A;  1SKF A;  3HUN A;  4N92 A;  4RVA A;  3UO9 A;  5FSR A;  3G32 A;  3A3J A;  3S22 A;  1XGI A;  3TOI A;  1KGF A;  3PAG A;  3BRM A;  2EFU A;  3IF6 C;  1MKI A;  1IEM A;  3VFF A;  3ZVW A;  3HLE A;  2WAF A;  2R9X A;  4BL3 A;  3GRJ A;  1XA1 A;  3LO7 A;  4DE0 A;  3NDG A;  1PIO A;  1PWG A;  4HEF A;  3Q1F A;  1HTZ A;  3IHB A;  5HFO A;  2XFS A;  4JF6 A;  3Q82 A;  5EVL A;  3VP4 A;  1N4O A;  3PBQ A;  1YLP A;  1CI8 A;  1RGZ A;  1FQG A;  2ZC3 B;  4GD8 A;  4S2O A;  3W4P A;  4E3M A;  3V3S A;  1ERM A;  1S0W A;  4E3N A;  2ZM0 A;  2IWB A;  3MXR A;  1K56 D;  5TR7 A;  1K57 C;  1NZU A;  1BSG A;  2H5S A;  3UN7 A;  1BUL A;  3UE1 A;  3IHA A;  2WGV A;  4OOL A;  5FDH A;  4HES A;  5CED A;  2ZQD A;  2XD1 A;  4ZJ1 A;  3NI9 A;  5EOE A;  3GQZ A;  2WZX A;  4N9L A;  4OPR A;  3WS2 A;  4R0Q A;  2EX9 A;  4KZB A;  3FKV A;  4GDN A;  2XGN A;  5HAP A;  3IWQ A;  2JBF A;  1NZO A;  1W8Y A;  4LCM A;  2X01 A;  3SH9 A;  1H8Z A;  4RYE A;  5D3O A;  3IXG A;  1G68 A;  3MKE A;  4UA6 A;  4EBL A;  1GCE A;  1O7E A;  1WE4 A;  1TEM A;  1K6R A;  4LV0 A;  1LLB A;  1GHP A;  2P9V A;  4GN2 A;  1IYS A;  4U0X A;  3MZD A;  3RXW A;  3N4I A;  5CRF A;  1GA0 A;  3G4P A;  2EFX A;  4KZ5 A;  4JXG A;  4MLL A;  4B4X A;  4FH2 A;  3WWX A;  1FCM A;  1I5Q A;  1L0D A;  2UWX A;  3DW0 A;  4JF4 A;  3AGD A;  3ZG0 A;  4E6X A;  2ZC6 B;  3ZG7 B;  2XDM A;  1K4F A;  4OVD A;  2VGK A;  4Z9Q A;  1SHV A;  3C7U A;  4KZ6 A;  1PWD A;  2V1Z A;  3N8R A;  4OKP A;  4IED A;  1TDG A;  5GLA A;  2HDQ A;  1C3B A;  4B4Z A;  2Q9M A;  1SDN A;  3VMA A;  4EQI A;  4JBF A;  1L0E A;  4GKU A;  2RCX A;  2Z2M B;  3A3I A;  2FFY A;  3MFD A;  4N1H A;  1IYP A;  1PI4 A;  2WK0 A;  4WBG A;  5CTN A;  5TFQ A;  4OQ0 A;  4PM5 A;  4WEJ A;  4U3T A;  3MXS A;  1H5X A;  2XLN A;  3OCL A;  4PPR A;  2V20 A;  4WMC D;  3ZFZ A;  3UPO A;  4WEL A;  1LL9 A;  4EBP A;  1K55 C;  1NYY A;  4WM9 A;  2J8Y A;  1YLY A;  4XXR A;  5EVI D;  2Y2H A;  3IF5 A;  3TSG A;  1YLJ A;  3SH8 A;  5E2F A;  1LL5 A;  4KZ9 A;  4HBU A;  2WKH A;  4OON A;  3ZCZ A;  4Y0T A;  3CMZ A;  2WUQ A;  3HLW A;  2J7V A;  2E8I A;  2Y2I A;  5DVA A;  2R9W A;  3V50 A;  3IF6 B;  4A5R A;  1JTD A;  1FOF A;  3P09 A;  3PBO A;  4KG5 A;  3UPP A;  4DE3 A;  5CTM A;  2ZM8 A;  4EUZ A;  4FCF A;  4BLM A;  1FCN A;  4OLG A;  3C7V A;  1W7F A;  4F94 A;  3OPL A;  2OLU A;  4KG6 A;  1KE0 A;  4HBT A;  4UHU A;  4BEN A;  5A90 A;  3N8L A;  3Q81 A;  5F1G A;  4X53 A;  3AGF A;  1E3U D;  1KE4 A;  4X55 A;  1PI5 A;  3WS4 A;  4DDY A;  4K0W A;  3DWZ A;  4LCL A;  5CEC A;  3IWI A;  4LV1 A;  3FV7 A;  3PBR A;  4S2K A;  2Y4A A;  4UA7 A;  1NJ4 A;  4QY6 A;  3WS0 A;  5IHV A;  3BFE A;  3M2K A;  1MWS A;  4GB7 A;  5KSC A;  4PM9 A;  3BEC A;  3VSK A;  2HP6 A;  2XF3 A;  2Y2J A;  1ERO A;  3A3D A;  1K55 A;  3N8S A;  4WZ5 C;  1EI5 A;  5HX9 A;  5FAQ A;  3NC8 A;  1H8Y A;  1QME A;  4E3O A;  4S2N C;  4QU3 A;  1XKZ A;  4WEK A;  1KDW A;  1LI9 A;  2XFT A;  2BG1 A;  1YMX A;  1IEL A;  3G34 A;  2XEP A;  2P74 A;  4QY5 A;  2QZ6 A;  4JXW A;  1YLW A;  1KGE A;  4N9K A;  4PMA A;  4GD6 A;  2Y91 A;  4ID4 A;  1BTL A;  5DF7 A;  3GSG A;  3LY3 A;  1ESU A;  1MPL A;  4EV4 A;  3VP0 A;  1PW1 A;  1Z6F A;  3FWL A;  3BLS A;  2Y55 A;  3WRT A;  1XX2 A;  3CJM A;  3RJU A;  3ZNY A;  4XUZ A;  2J9P A;  5KMW A;  3QNB A;  2IWD A;  2C5W B;  2WZZ A;  4RA7 A;  1ERQ A;  5J8X A;  5E2E A;  4KG2 A;  5I94 A;  5A93 A;  4QB8 A;  2QMI A;  1ES5 A;  4DRT A;  4CPK A;  4XUX A;  3VFH A;  1TDL A;  2I72 A;  3HLD A;  1BZA A;  1AXB A;  1XXM A;  5FI2 A;  2ZLY A;  3MZE A;  2EX8 A;  3ISG A;  1XA7 A;  4RX3 A;  4MNR A;  3UPN A;  4X69 A;  4OQH A;  2JC7 A;  3HUM A;  1L0F A;  1RCJ A;  3GR2 A;  3LEZ A;  2HP5 A;  3VP3 A;  4B88 A;  4S2N A;  5M19 A;  1YQS A;  3E2L A;  1SDE A;  1E25 A;  5CHM A;  2XH9 A;  2OSU A;  5GLC A;  3VOZ A;  3IXD A;  3O3V A;  1CEG A;  4GZB A;  4H8R A;  3A3F A;  5FAP A;  4EWF A;  3SS5 A;  3IF6 A;  5AQ7 A;  5CEB A;  2PU2 A;  1G6A A;  1PZO A;  5TGF A;  3WS5 A;  1BLS A;  4KZ4 A;  3ZNT A;  2C6W B;  5A92 A;  4K91 A;  1KGG A;  2Y2M A;  4Y7P A;  1BT5 A;  1K25 A;  5DTK A;  4ZJ3 A;  4IVI A;  2Z2L B;  2A49 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...