5A93A

293k joint x-ray neutron with cefotaxime: exploring the mechanism of beta-lactam ring protonation in the class a beta-lactamase acylation mechanism using neutron and x-ray crystallography
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
260
structure length
260
Chain Sequence
SVQQQLEALEKSSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTAPTLNTAIPGDPRDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQPEQKAENRNDILAAAAKIVTHGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-LACTAMASE CTX-M-97
publication title Exploring the Mechanism of Beta-Lactam Ring Protonation in the Class a Beta-Lactamase Acylation Mechanism Using Neutron and X-Ray Crystallography.
pubmed doi rcsb
source organism Escherichia coli
total genus 95
structure length 260
sequence length 260
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5a93A00
2WGWA 4HBTA 2H5SA 4MBKA 5HL1A 2Y2IA 1PW1A 1PWGA 3GSGA 4OP5A 3NY4A 4X68A 1K54A 1G68A 5EUAA 2J8YA 1NZUA 1XGJA 2A49A 1KE0A 4MNRA 4BL3A 5FQ9A 3IXDA 1E3UD 3SS4A 5JYPA 3I7JA 5A93A 3AGEA 2BLSA 2P9VB 4X69A 1K6RA 2WGWB 4P0MA 2IWDA 5DF8A 1PZOA 1ESIA 1QMFA 1ZG6A 4DKIA 1NY0A 2XF3A 3SH7A 1BLPA 3O87A 3V3SA 3JYIA 4LCLA 1KGGA 1YT4A 3VP2A 3GRJA 3G2YA 3G35A 1MWSA 3ZDJA 4HESA 1W7FA 3LEZA 5DF7A 4OOYA 3FZCA 2RCXA 2XD5A 3WS1A 1EWZA 3C4OA 1FR1A 2OV5A 4DE1A 1NXYA 4E6XA 1N9BA 1DY6A 1NYYA 1EI5A 1RP5A 3C5AA 3C7UA 4FD8A 2DNSA 3EQUA 3NDEA 3O88A 3FYZA 2ZC3B 4ID4A 1U60A 5HFOA 4BL2A 1KE4A 1K56A 2ZLYA 3Q82A 1IYQA 4OPQA 4U0XA 1IELA 4E3OA 4A5RA 1BLCA 1KGEA 1YQSA 4JBFA 1GHMA 3CJMA 2EXBA 3BLMA 4DF6A 3ZG9B 1ES5A 3P98A 2WZZA 2ZJ9A 3VMAA 3O86A 1N4OA 3UO9A 1HD8A 4HBUA 2R9WA 4OVDA 1O07A 4FCFA 5FA7A 1ZKJA 4GB7A 2QZ6A 5DTTA 5CGXA 3G32A 2ZM2A 4E6WA 4QD4A 3PAGA 3BYDA 4EV4A 3BFCA 3PBOA 1WYBA 4GDNA 3MBZA 5A90A 1NZOA 2OSUA 4P85A 5CEBA 2BG1A 1PI4A 3OPHA 1CI8A 3ZVTA 3RJUA 5E43A 3IF6C 1YMXA 2V1ZA 4O7DA 4GOGA 2V20A 3OCLA 3DW0A 4KENB 4UA9A 5FAOA 2H0YA 3WWXA 4XUXA 3IF5A 3OPRA 4GN2A 4KZBA 1E3UA 1ERQA 3A3EA 1XXMA 4R23A 1W5DA 3HLFA 2QMIA 3GQZA 3BFGA 1M40A 4C3QA 3ZG5A 1CEFA 1E4DA 3NI9A 5FI2A 1MY8A 5D3OA 3ZNYA 5A92A 4E3MA 1YM1A 1EROA 4BQMA 5EPHA 1O7EA 3M2KA 5F82A 5I94A 2ZC6B 5FI6A 3S1YA 3TSGA 2WZXA 1XX2A 4DXBA 5KMWA 1VQQA 3HREA 2Y2GA 4DDYA 3AGFA 3HUNA 3N4IA 2HDUA 5GHYA 2XEPA 2HDSA 2WGVA 3IF6A 5HARA 1K4EA 4OLGA 1Y54A 1ES2A 3PBQA 4X56A 1LL9A 4Y0OA 1ERMA 4DE2A 1VM1A 4FH2A 2Z2MB 4UA6A 1BT5A 2ZD8A 5FAQA 4DDSA 4H8RA 2EXAA 4Z9QA 3IXBA 4LV0A 3CG5A 1GA9A 2XK1A 2RL3A 4GD6A 1BUEA 4N1XA 4UHUA 3ZNTA 3NBLA 4WYYA 3IF6B 4EWFA 4ZJ1A 2X01A 2IWBA 4B4ZA 3NC8A 3S22A 4IVIA 1BULA 3B3XA 3UDFA 4GDBA 3BFFA 5FSRA 1CK3A 1FSWA 4R0QA 4E3KA 3GR2A 2PU2A 1FR6A 3HUOA 3ISGA 4P6BA 4RX3A 5FQIA 5DVAA 3TOIA 3ZHHA 4BLMA 1WE4A 4WMCA 3GVBA 1PWDA 2XGNA 4S2IA 3A3FA 1ONGA 4U3TA 5EVID 2Q9MA 2Y91A 3IWQA 3UE0A 3Q07A 2G2UA 1W79A 5DTKA 5CHUA 5GLBA 4JXWA 3O3VA 5U47A 3UPPA 1AXBA 4X55A 4S2KA 4UA7A 3ZG8B 2XFSA 5E2GA 3VSLA 2XD1A 3UDXA 4B4XA 5AQ9A 2J9OA 1IYPA 1MKIA 3FV7A 4OPZA 4ZBEA 5KSCA 3OZHA 4Y0TA 1Q2QA 2ZQ7A 2Y2KA 2XFTA 4WM9A 5TR7A 3SH8A 4ZDXA 3HVFA 3MXSA 4LENA 4EBPA 1TDGA 1BLSA 1PWCA 5HW3A 1MXOA 2I72A 3OPLA 5FAPA 4D2OA 3OC2A 5L2FA 3A3DA 1YLZA 3FKVA 4RA7A 5F83A 3GV9A 1PYYA 2XR0A 5CGSA 2WK0A 3BRMA 3IQAA 5HX9A 1E25A 1K25A 4OQ0A 4QJGA 3WRZA 4RVAA 1IYOA 4KZAA 3G2ZA 2ZC5B 1KGFA 1K57C 3CMZA 5CXWA 4F94A 5FI7A 5EVIC 1YLWA 4B88A 5FDHA 5EVLA 3HL9A 3UY6A 5F1FA 1DJCA 3BFEA 3ZVWA 3W4OA 3ITAA 1YLYA 4KQQA 2R9XA 3W4QA 4MBHA 1FSYA 3G31A 5FQMA 5FQQA 2PBYA 3VFFA 2XDMA 2VGJA 1ONHA 4ZJ2A 3NCKA 2VGKA 3A3IA 5BOHA 5AQBA 1GA0A 1Z6FA 1L0EA 4PPRA 4QY5A 4YINA 4BJPA 1OMEA 3HLWA 4OONA 3ITBA 1XA1A 5CHMA 4LV3A 2UWXA 3VP3A 2Y2JA 4WBGA 4HEFA 4WEJA 4GNUA 2J7VA 1CI9A 4KZ6A 3LO7A 3RXWA 4S2OA 3RXXA 3G4PA 2XLNA 2WKHA 3LCEA 4N1HA 4R4RA 3FKWA 2JC7A 1IYSA 3GTCA 5GLAA 1K57A 3Q81A 1YLPA 2ZM8A 4IVKA 3V50A 3IHBA 3N8RA 3IWIA 5EVIA 4OH0A 3AGDA 5FQJA 4PM5A 4P87A 1FQGA 3VOYA 1YMSA 5GHXA 2XQZA 5GHZA 5HAPA 1ES3A 2ZC7A 4LV2A 2WYXA 1SCWA 2OLUA 4KZ7A 2HDRA 4S2NC 1HTZA 1L2SA 3M2JA 3DWKA 2HP6A 4QY6A 3VP1A 4E3IA 3G34A 4EBNA 5CRFA 1GCEA 2JBFA 1SDEA 4WELA 1XA7A 2Y2OA 1S6RA 2Y2QA 3M6HA 1W8QA 2WKEA 1XP4A 4PM6A 2C6WB 3C4PA 3IT9A 2OLVA 1FCNA 4E3JA 4M3KA 2ZC4B 4OQHA 4KZ3A 4WZ5C 4CJNA 1I2WA 1ZG4A 4PM8A 4MBFA 2JCHA 3MKEA 4KG5A 4R4SA 2G2WA 3VFHA 5CEDA 2H0TA 1ES4A 5E2HA 4E3LA 4K0XA 2Y2NA 3UDIA 2WUQA 4S2NA 2E8IA 2Y2MA 3BLSA 4R1GA 3IHAA 4WEKA 1CEGA 3BECA 3S4XA 2WKIA 3PBRA 2FFYA 4YFMA 3N8SA 3VP4A 1I2SA 1ZC2A 5GL9A 1LHYA 3VSKA 1L0FA 4NETA 4ZTKA 4QHCA 4Q8IA 2EX2A 1SKFA 5A91A 1XGIA 3MKFA 1GHIA 2Y2HA 4S2JA 1LL5A 1HVBA 1NYMA 3MZFA 4OLDA 4ZJ3A 2HPBA 4WZ5A 3Q7ZA 2QPNA 1FOFA 5TFQA 4ZAMA 4N92A 3N7WA 3V5MA 1TEMA 5F1GA 1FCMA 3HLBA 4R3JA 3MZDA 3VOZA 2HDQA 3PBTA 4OOMA 4JF4A 1GHPA 4QU3A 4IBXA 4C75A 3LY3A 1RGYA 1G6AA 5CECA 4PM9A 4DE3A 1JTGA 1MWTA 3IWOA 4UAAA 2P9VA 3SS3A 4JXGA 3UPOA 2A3UA 1S0WA 4OQIA 3M6BA 3PBSA 4S2MA 5M1AA 5CTNA 3TG9A 5KZHA 3E2KA 1H5XA 1JTDA 1LLBA 4FH4A 3HUMA 4GKUA 4MLLA 5GLCA 1L0GA 1PW8A 1IKIA 3QNBA 4U0TA 5EOEA 2Y55A 4DXCA 3BM6A 2B5RA 4EQIA 5EOOA 3E2LA 1H8ZA 4L0LA 3PTEA 5CERA 2IWCA 4DE0A 3IXHA 3OCNA 3G30A 2EX9A 5FQKA 1XPBA 5HAQA 1FCOA 5E2EA 3MFDA 2ZQCA 4LCMA 5HAIA 4K0WA 4XUZA 5DF9A 1IKGA 1K55C 4OOLA 1TVFA 1MPLA 4X53A 3VP0A 4S2LA 1PI5A 2Y4AA 3SOIA 1TDLA 5DTSA 1KDWA 3WS5A 1HZOA 3OPPA 1MBLA 4FSFA 4OPRA 2V2FF 1YLJA 2EFXA 1C3BA 2Q9NA 3ZFZA 1KDSA 2J9PA 3N8LA 1IEMA 1RCJA 2EFUA 1KVLA 3EQVA 5AQ7A 3FWLA 3ZG0A 4DRTA 5E2FA 3ZG7B 2WGIA 2ZQ9A 4QB8A 5J8XA 1Q2PA 2DRWA 2WAFA 3NIAA 3BEBA 5AQAA 2EX6A 4IEDA 4BENA 4KQRA 4NK3A 1JWVA 2Y2LA 3N6IA 4LV1A 3CZDA 4BD0A 3QHYA 2HP5A 5IHVA 3ZCZA 2ZQ8A 4JPMA 5TGFA 1SDNA 3QNCA 4X6TA 4RX2A 4KZ9A 4JXVA 4PMAA 4EUZA 4WMCD 3Q1FA 4JXSA 1K55A 2X02A 1DJBA 2ZMAA 4N9LA 1YLTA 2HP9A 4OQGA 1DJAA 1RGZA 4Y0UA 2FFFB 1J9MA 5EVIB 4KQOA 3UE3A 3WS4A 1K6SA 3IXGA 2PU4A 2P74A 4KZ4A 5EECA 3SH9A 2GDNA 3DTMA 3MZEA 1MWUA 1I5QA 1MWRA 3PBNA 2ZQAA 1M6KA 1XKZA 3DWZA 3SS5A 1ESUA 2H10A 3HBRA 4N9KA 3P09A 4OP8A 1BLHA 1BTLA 1KE3A 4JLFA 4XXRA 3HLGA 5EE8A 4KG6A 3MXRA 2Y2PA 4C6YA 5G18A 1NJ4A 1H8YA 2X71A 4OKPA 1ALQA 1PZPA 1JWPA 3A3JA 1QMEA 4GZBA 5FATA 4BD1A 3IH8A 4JF5A 3Q7VA 3V39A 4EBLA 1JWZA 4JF6A 3UNWA 4JKTA 3D4FA 5CHJA 3BFDA 4KZ8A 3PAEA 1K56D 1L0DA 2CC1A 2ZQDA 4MEZA 2JE5A 5CTMA 4E3NA 1BZAA 4R3BA 3WRTA 1SHVA 4GD8A 1KVMA 1K4FA 3HLDA 2WAEA 4IBRA 3W4PA 1K54C 3Q7VB 5JYOA 3HLEA 4OPYA 1PIOA 3WS2A 4WZ4A 5M19A 2ZM0A 4RYEA 1W8YA 2WADA 3W8KA 5M18A 1LI0A 3HLCA 4K91A 4KG2A 3UN7A 2EX8A 4PM7A 3NDGA 3IH9A 3UPNA 5FASA 1BSGA 4S2PA 2DCFA 2Z2LB 3LY4A 2Y59A 3V3RA 1WYCA 2C5WB 3C7VA 3UE1A 3GMWA 5GLDA 4CPKA 5CGWA 3ZGAB 1LI9A 4KZ5A 1NRFA 4Y7PA 2XH9A 3WS0A 1K38A 1JVJA 5KSHA
chains in the Genus database with same CATH superfamily
4II7A 3T1RA 3RTYA 3NY4A 4MN5A 4BL3A 2J8YA 1NZUA 1ZHHB 2A2LA 2HJ9C 4LGWA 3UMEA 4X69A 1ZG6A 4CLCE 4DKIA 1HLUP 4OOYA 3WS1A 1NXYA 1YSPA 4FD8A 3FYZA 2AVXA 1KE4A 4OPQA 1IYQA 4JBFA 2JKRM 3CJMA 3EGXC 3ZG9B 1ES5A 3P98A 3O86A 1N4OA 5FEFA 1HD8A 1OTEA 2KOIA 1O07A 1ZKJA 5DTTA 5DJTA 3BYDA 4EV4A 4GDNA 3MBZA 4PKYG 1PI4A 1YAXA 2WKQA 1XJ4A 3S7PA 1D7EA 2MJ6A 3LICA 2V1BA 4GOGA 3OCLA 3DW0A 4KENB 4UA9A 2H0YA 3BQ8A 3DTKA 3OPRA 3MQ0A 2M7VA 1S1YA 1E3UA 3A3EA 1E4DA 5FI2A 4MDZA 2YKFA 5FI6A 3L7HA 3HUNA 3IF6A 3LR0A 2VA0A 1P0ZA 1ERMA 1GSVA 4FOFA 4UHUA 1BUEA 3NBLA 3IF6B 4WN5A 3S22A 4IVIA 1BULA 3UDFA 1F98A 3GR2A 1FR6A 3HUOA 3ISGA 5FQIA 3O5YA 5DVAA 1WE4A 1YKDA 3GVBA 5EVID 3A3FA 3IWQA 2ZOHA 3O3VA 1S1ZA 1AXBA 1V9ZA 4LFUA 5E2GA 3IX4A 3FV7A 2ZQ7A 4WM9A 1LSWA 4RQ9A 4ZDXA 3T4TA 3MXSA 3MXQA 3DTIA 5HW3A 3OPLA 2I72A 4RA7A 3B47A 4I3IA 1STZA 1IYOA 4KZAA 3L9KA 5J3WA 2W0NA 5EVIC 4UQIM 1DP9A 5F1FA 1DJCA 3BFEA 4ARZB 4MBHA 3NOTC 2VGJA 1ONHA 4EESA 4CQHA 1Z6FA 4OONA 1XA1A 4F3LB 4LV3A 3S7NA 2GZAA 4GNUA 2W3DA 3IBRA 4GJ4A 3G4PA 4R4RA 2JC7A 1IYSA 5GLAA 3Q81A 1YLPA 3IHBA 3EWKA 4OH0A 1LSVA 4JGOA 4PM5A 1FQGA 1IOUA 4LV2A 4KZ7A 2HDRA 1L2SA 3DWKA 3VP1A 4EBNA 1GCEA 5K5BA 4IUHA 1XA7A 4IUKA 2Y2OA 4BBVA 1G6OA 1EW0A 3M6HA 1W8QA 1XP4A 5HDSA 4ME4A 1LT0A 2JHEA 4M3KA 2ZC4B 4GS9A 4OQHA 3T4OA 2JCHA 4R4SA 5CEDA 3V67A 1OT6A 2W27A 2PAVP 4K0XA 3UDIA 2WUQA 4WEKA 2VGLM 2WKIA 3UE6A 1I2SA 4L9FA 4Y13A 5GL9A 3VSKA 2VV6A 2EX2A 4R3AA 4Y2FA 1NYMA 1GSXA 2XRNA 4NKPA 3MZDA 3LR5A 1XJ2A 4UAAA 2P9VA 5TBMB 1SKOA 1N9NA 3R4KA 1S0WA 5HWWA 4L9GA 3PBSA 5M1AA 1IFQA 3TG9A 5KZHA 2QKPA 3B42A 3E2KA 5EFWA 4MLLA 2M1CA 4GLQA 4U0TA 3D9YA 3LYXA 3K2NA 1SKOB 4L0LA 2IWCA 4GCZA 3S7QA 5FQKA 3P7NA 1FCOA 2QHKA 1DRMA 5HAIA 3RFBA 4KUKA 3H9WA 1IKGA 1MPLA 1PI5A 2Y4AA 1TDLA 1HZOA 3OPPA 4OPRA 2V2FF 2Q9NA 3ZFZA 2W3HA 3H82A 5AQ7A 1IEMA 1RCJA 1KVLA 3EQVA 3FWLA 3A0SA 2WGIA 5J8XA 2DRWA 2WAFA 1FIKA 2EX6A 4IEDA 3QHYA 4JPMA 3H82B 4RX2A 4KZ9A 4PMAA 2X02A 4HQAA 1DJBA 2V1AA 1DJAA 1RGZA 3LIAA 3UE3A 3IXGA 1KOUA 2PU4A 4KZ4A 5EECA 3SH9A 4HJ4A 3MZEA 3T1QB 1MWUA 1P9RA 2H10A 3VE3A 4LLOB 5F5YA 2XSSA 4XXRA 3T12B 3NJAA 5EE8A 1A0KA 2HF6A 2EWWA 2G7UA 3A3JA 2EA9A 4JKTA 2B18A 3PAEA 1L0DA 2BTFP 3LIFA 2Z6DA 1BZAA 4GD8A 5EV0A 4EEUA 4YOFA 3WS2A 4WZ4A 5M18A 2OWHA 3UB6A 1VEUA 2JKGA 2PR6A 2DCFA 3BWLA 2Z2LB 3ZGAB 3F1NB 1LI9A 4Z1WA 3H7WA 3WS0A 4HNBA 1K38A 2H5SA 1PWGA 3GSGA 3CPTB 3E0YA 4X68A 1K54A 5HDCA 4MNRA 5FQ9A 2W3EA 3H7WB 5JYPA 2INWA 3BQAA 2BLSA 5DF8A 4MMNA 3F1PA 2IWDA 1QMFA 2A24A 1NLZA 3K3CA 2XF3A 4PHTA 1BLPA 3V3SA 3JYIA 3VP2A 3GRJA 3G35A 1VHMA 4LRYC 1FR1A 4E6XA 5DFYA 4ETZA 5IT5A 1NYYA 2A24B 3C5AA 1RP5A 2NUPC 3NDEA 3T4LA 4X25A 3KYZA 4EW7A 2ZC3B 5HFOA 4BL2A 3NHQA 1K56A 4U0XA 4E3OA 3KSFA 2JN7A 4A5RA 1T19A 1GHMA 2EXBA 1S4SA 2WZZA 5IS1A 4HBUA 4OVDA 5FA7A 2PD7A 2QZ6A 2O9BA 5CGXA 4P6ZS 3BFCA 3PBOA 4D60A 4AFIA 1NZOA 2OSUA 4P85A 2J80A 2BG1A 3OPHA 2ZMFA 3RJUA 5E43A 2V1ZA 4O7DA 3PYPA 5FAOA 4XUXA 4GHIA 4GN2A 4EQ1A 3HLFA 4EUVA 3GQZA 1CEFA 3NI9A 1MY8A 5D3OA 3ZNYA 2XROA 4GHIB 5EPHA 1O7EA 2ZC6B 2VZWA 3S1YA 3TSGA 2WZXA 3HREA 4FTXA 1XFQA 1UWPX 2HDUA 4EETB 3FG8A 2D02A 1K4EA 1ES2A 3PBQA 3CI6A 4Y0OA 4UA6A 2Z2MB 1BT5A 2ZD8A 1DP6A 4EERA 4H8RA 2EXAA 4Z9QA 3CG5A 4N1XA 2IWBA 4DN0A 3BFFA 5FSRA 4P6BA 3ZHHA 4BLMA 4WMCA 1ONGA 1AWIA 3UE0A 3F1OA 3Q07A 5U47A 3UPPA 2XFSA 3UDXA 4B4XA 5AQ9A 1MKIA 3F1OB 2OAQ1 5TR7A 4KQDA 3SH8A 1S67L 1F2KA 3ZYTA 3HVFA 4EBPA 3LFVA 1PWCA 3A3DA 3EOIA 1YLZA 4DJ2A 3BRMA 5HX9A 4JGQA 1K25A 3G2ZA 1WA9A 1K57C 4XT2A 3NOUC 5EVLA 3W4OA 1YLYA 1FSYA 2GJ3A 2PBYA 3QP4A 2XDMA 4MN6A 2K31A 5BOHA 4HP9A 2VEAA 4PPRA 4BJPA 1OMEA 3HLWA 5CHMA 4HEFA 3GECA 3RXWA 2V0WA 4HP4A 4JGPA 2WKHA 5G4ZA 4N1HA 4IVKA 5FQJA 4P87A 2JKFA 2WYXA 4E3IA 5CRFA 3T1SA 2V9AA 2Y2QA 4G3WA 2WKEA 1G5UA 3CUEC 3UB5P 5L10A 2C6WB 5L07A 3KX0X 4E3JA 4KZ3A 5AVEA 4CJNA 5TJJA 4PM8A 1ZG4A 4MBFA 3MKEA 4KG5A 3LEQA 3BY9A 1P97A 5HSQA 3LI8A 2V0UA 2Y2NA 4DMZA 2QYBA 4S2NA 5EVEA 3S4XA 3PBRA 2FFYA 4YFMA 3N8SA 4IJGA 4CLCA 1SKFA 4M4XA 2XA7M 3MKFA 4I39A 4X1MA 5HD5A 4ZJ3A 2PT7A 4DJ3A 4WZ5A 2VV7A 4ZAMA 4HHDA 1TEMA 3HLBA 2HDQA 3PBTA 3TE8A 4C75A 3LY3A 1G6AA 1TD5A 1JTGA 3P01A 3QP6A 4JXGA 3M6BA 1H5XA 4FH4A 2BASA 2Q0OA 3QNBA 3BM6A 2B5RA 4EQIA 3E2LA 3PTEA 4DE0A 4JGRA 2EX9A 1XPBA 3D72A 3MFDA 3KYEA 4XUZA 1T18A 3CITA 4X53A 2W3FA 5DTSA 2EWVA 1YLJA 1C3BA 1KDSA 3N8LA 4DRTA 5E2FA 4KQRA 2HP5A 2ZQ8A 1W63M 4HOIA 4R70A 4WL9A 1OJGA 2J3WA 4EU0A 4WMCD 1K55A 4EXOA 2ZMAA 4N9LA 2HP9A 3D3OA 4KQOA 2I9VA 1N9LA 2VK3A 3WS4A 1X0OA 3E4QA 1P9WA 3PBNA 3DWZA 3S7OA 3SS5A 3HBRA 3P09A 4OP8A 1BTLA 4JLFA 3HLGA 1ACFA 3HJKA 2WKPA 5FATA 4BD1A 3IH8A 4EBLA 3V39A 3UNWA 1OPXA 4GS9B 2ZQDA 2CC1A 4MEZA 2JE5A 3C38A 5F69A 2KX6A 3MS6A 4R3BA 3WRTA 1KVMA 3EEAA 1XJ3A 4IBRA 4OPYA 3T4KA 4K91A 5AVFA 4PM7A 3IH9A 5FASA 5J7EA 4S2PA 2P04A 3U4LP 1UGUA 2Y59A 1WYCA 5GLDA 2VX8A 5CGWA 4Y17A 2VJWA 5KSHA 4G3KA 4HBTA 3UB8A 5EUAA 1SZVA 2A49A 1E3UD 3SS4A 5A93A 2P9VB 3MFXA 1K6RA 1ESIA 3LR3A 3SH7A 3O87A 4LCLA 3E4PA 1KGGA 1YT4A 3JVVA 5F6AA 3G2YA 3ZDJA 1W7FA 2RCXA 1EWZA 3C4OA 5AJGA 4PAUA 1FILA 1N9BA 1YSQA 2KLIA 4H6JA 1CQAA 4ID4A 4WUJA 1U60A 1BLCA 3K3DA 2IA2A 2UV0E 4H6JB 2ZJ9A 3UO9A 2R9WA 2JKTI 3MQOA 4O8GA 1T1BA 1T1AA 4QD4A 3PAGA 1WYBA 3PXPA 4I5SA 4BBUA 3LR4A 3ZQ5A 2V8FA 3IF6C 1YMXA 5FL3A 2V20A 3WWXA 4LRZE 5DKLA 4KZBA 1XXMA 4R23A 3BFGA 1M40A 4C3QA 3ZG5A 3T4QA 3LI9A 5A92A 4Q0HA 3NOPC 1YM1A 3M2KA 5I94A 5KMWA 1XX2A 4DDYA 4EEPA 5FDSA 2XEPA 3QP8A 2WGVA 3HJIA 2JKRI 4X56A 1LL9A 1VM1A 4DDSA 3MSHA 1TS7A 3IXBA 1GA9A 2XK1A 2RL3A 3IX3A 3ZNTA 4EWFA 1OJ5A 4B4ZA 3NC8A 4GDBA 1F5MA 1H3QA 1CK3A 1FSWA 4R0QA 3TOIA 1VEUB 4S2IA 4U3TA 2Q9MA 1S66L 4NXGA 1W79A 5DTKA 5GLBA 1MZUA 4JXWA 4X55A 4UA7A 3VSLA 3LIDA 4OPZA 4ZBEA 5KSCA 4BMWA 2L0WA 2Y2KA 3ULFA 1H0MA 4NEED 2Y79A 2B02A 2VLGA 3OLOA 1MXOA 5L8MA 4D2OA 3F1PB 4HH2A 3OC2A 5L2FA 2K7SA 3FKVA 2W3GA 2V8CA 3GV9A 1PYYA 5CGSA 2WK0A 4Y15A 3IQAA 4OQ0A 4RVAA 2ZC5B 1KGFA 4F94A 1YLWA 3HL9A 2CMNA 3UY6A 3ZVWA 3ITAA 2HGVA 4ZRRA 5FQMA 4ZJ2A 3T4JA 3A3IA 3MJQA 4QY5A 3VP3A 2UWXA 1MKMA 4WBGA 4ESPA 3A0RA 2ZOIA 3RXXA 2XLNA 1K0KA 3FKWA 2ZM8A 3V50A 3IS2A 3N8RA 5EVIA 2QJ5A 4MCWA 4NXFA 5C5KA 3CHWP 3BW6A 3OOVA 5HAPA 1ES3A 2L4RA 1HTZA 2HP6A 3FC7A 3VV4A 5HWVA 1JNUA 3IS2B 5HPIA 4WELA 1SDEA 4Q0JA 1S6RA 4O01A 3LIBA 1NWZA 1FCNA 1PRQA 3R7WA 4UQIS 3EGDC 2G2WA 2H0TA 2PD8A 5J4EA 5E2HA 2HV1A 3BLSA 4WLAA 3R7WB 1CEGA 3BECA 2KDKA 3JVUA 4HIAA 2M7UA 1LHYA 3KSHA 4ZTKA 4QHCA 5A91A 1XGIA 2Y2HA 1CJFA 4S2JA 1HVBA 3HCYA 2HPBA 3Q7ZA 2QPNA 3KSIA 3N7WA 5L09A 3VOZA 4HY8A 4WF0A 4IBXA 1RGYA 2E8JA 5CECA 4PM9A 1BYWA 3IWOA 1MC0A 3TJZC 3SS3A 2Z6CA 3JPUA 1ZTUA 4OQIA 5CTNA 3MF0A 1JTDA 1LLBA 3HUMA 4DXCA 4Y3IA 4NXBA 2HZ5A 5CERA 3OCNA 3G30A 3KSGA 1D06A 2VGLS 2ZQCA 4R6LA 2GNXA 3T4SA 4K0WA 5DF9A 4HH3A 1D1JA 4XT2B 1KDWA 5HWTA 3WS5A 4FSFA 2EFXA 2J9PA 2EFUA 5HL6A 2ZQ9A 3NIAA 3BEBA 5AQAA 1JWVA 2Y2LA 3N6IA 4LV1A 4BD0A 1UWNX 5IHVA 3W2ZA 3FPVA 5HZHA 1L3LA 4X6TA 4HJ3A 4JXVA 4EUZA 3Q1FA 1YLTA 4Y0UA 4L9EA 2FFFB 1J9MA 1K6SA 1LSXA 1ODVA 1T1CA 2GDNA 3DTMA 1MWRA 2ZQAA 1XKZA 4ETXA 3PHYA 2LB9A 4UEYA 4G3VA 2DMWA 3BJNA 4BBTA 4I3AA 4KG6A 3MXRA 4C6YA 2P7JA 5G18A 2X71A 4OKPA 1ALQA 2O9AA 2QWSA 2VKSA 4GZBA 1N9OA 1VB6A 4JF5A 3Q7VA 4JF6A 5CHJA 3BFDA 2P08A 4KZ8A 3NECA 1K56D 5CTMA 5HDDA 4K08A 1K4FA 3HLDA 2WAEA 3E98A 1Y28A 2LB5A 1K54C 3Q7VB 5FEGA 3HLEA 1CF0A 5HD3A 5A8BA 5M19A 2ZM0A 5EM1A 1W8YA 2YKHA 3NULA 3SZTA 4KG2A 3UN7A 4CLCB 3NDGA 3UPNA 1NRJA 4QWOA 3ICYA 2PDRA 3V3RA 3UE1A 3GMWA 3LGOA 4CPKA 4KZ5A 3QP5A 5LBRA 3KO6A 2WGWA 4MBKA 4P6ZM 5HL1A 5CX7A 2Y2IA 1PW1A 1TS8A 4OP5A 5F68A 1G68A 1XGJA 5KIZA 1KE0A 2PYRA 3IXDA 3I7JA 3AGEA 2W1TA 2WGWB 4P0MA 2NUTC 1PZOA 1NY0A 3UB7A 2R78A 1MWSA 4HESA 3LEZA 5DF7A 3FZCA 2XD5A 1TS6A 2OV5A 2W1TB 4DE1A 1DY6A 3C7UA 1EI5A 2DNSA 3EQUA 4ARZA 3O88A 3QP1A 2ZLYA 2J3TD 3Q82A 3OBFA 1IELA 1KGEA 1YQSA 1OTIA 4F3LA 3BLMA 3LIEA 4DF6A 3VMAA 4FCFA 4GB7A 4LRXC 3G32A 2ZM2A 4E6WA 2O0YA 5DJUA 5A90A 5CEBA 1CI8A 3ZVTA 4YWZA 2PRFA 2J3TC 3IF5A 5IU1A 1ERQA 1W5DA 3PR6A 2QMIA 4I38A 4E3MA 2H28A 1EROA 4BQMA 3B33A 5F82A 4DXBA 1VQQA 2Y2GA 3AGFA 4I3JA 3N4IA 4HJ6A 5GHYA 2HDSA 5HARA 4OLGA 1Y54A 2VV8A 1GSWA 1TS0A 4DE2A 4FH2A 5FAQA 1YPRA 4LV0A 1OTBA 4GD6A 4WYYA 4LPZA 4ZJ1A 2X01A 3B3XA 4E3KA 2PU2A 4RX3A 2FZ0A 1PWDA 3MR0A 2XGNA 3IX8A 2Y91A 4GW9A 4NG2A 2G2UA 4YNRA 3GDIA 5CHUA 5TBMA 4S2KA 3ZG8B 1OTAA 2XD1A 2PYPA 2J9OA 1IYPA 4O0PA 3OZHA 3VE4A 4Y0TA 1PNEA 1Q2QA 2XFTA 4BWIA 3CAXA 4LENA 1TDGA 1BLSA 2D01A 5FAPA 3MQQA 5F83A 2XR0A 2FH5A 1E25A 4QJGA 3WRZA 3CMZA 5CXWA 1TF1A 5FI7A 4Q0IA 4B88A 3SW1A 5FDHA 3T1XA 2OOLA 4KQQA 2R9XA 3W4QA 3E4OA 3G31A 4NXEA 3TRCA 5FQQA 3VFFA 4HI4A 3NCKA 4CLCD 2VGKA 5AQBA 1GA0A 4YINA 1L0EA 4PKYA 3ITBA 3RH8B 2Y2JA 5DKKA 4WEJA 5I5LA 2J7VA 1CI9A 4KZ6A 3LO7A 3UB9A 3UMDA 4S2OA 1LL8A 3LCEA 3GTCA 1K57A 1OT9A 1DP8A 3IWIA 1VETA 3DAVA 3AGDA 2PR5A 1G28A 3VOYA 3VOLA 1YMSA 5GHXA 2XQZA 3CWFA 5GHZA 3KYQA 2ZC7A 1SCWA 2OLUA 2O9CA 4S2NC 3M2JA 4QY6A 4MN7A 3G34A 2JBFA 1VETB 3LUQA 4FUWA 2OAP1 4CLCC 1NLYA 1XJ6A 4PM6A 2ZMVA 2ZBBA 3C4PA 3IT9A 2OLVA 4WZ5C 1I2WA 5MC7A 3VFHA 1ES4A 4E3LA 4KUOA 5G4YA 2ZL1A 2E8IA 2Y2MA 4R1GA 3IHAA 3VP4A 1ZC2A 1L0FA 4NETA 4Q8IA 2ZL1B 3CUEA 1XFNA 1GHIA 1W63Q 2B95A 1LL5A 3MZFA 4OLDA 3T50A 1Y4OA 2OWJA 3F1NA 3QP2A 1FOFA 5TFQA 3C2WA 4N92A 3U2AA 3V5MA 5F1GA 1PFLA 4B93A 1FCMA 4R3JA 3CPTA 4OOMA 4JF4A 3EEHA 1J3WA 1GHPA 4QU3A 4DE3A 1MWTA 3UPOA 2A3UA 4S2MA 2PHYA 1F9IA 2W1RA 2L1MA 3A0VA 3G6OA 4GKUA 5GLCA 1L0GA 1PW8A 1IKIA 2ACGA 5EOEA 2Y55A 5EOOA 1H8ZA 1OTDA 5HPFA 3IXHA 5HAQA 1V9YA 5E2EA 1H8MA 4LCMA 4OOLA 1K55C 1TVFA 3DTEA 3C8CA 2XA7S 4S2LA 3VP0A 3SOIA 2Y8HA 1MBLA 2WKRA 3FPWA 3ZG0A 5EM0A 3ZG7B 4QB8A 4IHQA 1Q2PA 4BENA 4NK3A 3CZDA 3ZCZA 5TGFA 1SDNA 3QNCA 4R38A 4JXSA 4E04A 4Y5FA 4OQGA 5EVIB 2HJEA 2P74A 5DFXA 1I5QA 1M6KA 3DBAA 1ESUA 2GX5A 4N9KA 4X1LA 1BLHA 1KE3A 3TW8A 2Y2PA 1NJ4A 1H8YA 1Z09A 1PZPA 1JWPA 1QMEA 3MMHA 1S4RA 1JWZA 3D4FA 4B9OA 3BY8A 3IBJA 3CLOA 4E3NA 2O99A 2K2NA 1SHVA 3W4PA 5JYOA 1PIOA 4RYEA 2WADA 3W8KA 1LI0A 4QPRA 3HLCA 2EX8A 2QJ7A 1BSGA 3LY4A 2C5WB 3C30A 3C7VA 2JKTM 1NRFA 4Y7PA 2XH9A 2PBDP 1JVJA
chains in the Genus database with same CATH topology
2WGWA 4HBTA 2H5SA 4MBKA 5HL1A 2Y2IA 1PW1A 1PWGA 3GSGA 4OP5A 3NY4A 4X68A 1K54A 1G68A 5EUAA 2J8YA 1NZUA 1XGJA 2A49A 1KE0A 4MNRA 4BL3A 5FQ9A 3IXDA 1E3UD 3SS4A 5JYPA 3I7JA 5A93A 3AGEA 2BLSA 2P9VB 4X69A 1K6RA 2WGWB 4P0MA 2IWDA 5DF8A 1PZOA 1ESIA 1QMFA 1ZG6A 4DKIA 1NY0A 2XF3A 3SH7A 1BLPA 3O87A 3V3SA 3JYIA 4LCLA 1KGGA 1YT4A 3VP2A 3GRJA 3G2YA 3G35A 1MWSA 3ZDJA 4HESA 1W7FA 3LEZA 5DF7A 4OOYA 3FZCA 2RCXA 2XD5A 3WS1A 1EWZA 3C4OA 1FR1A 2OV5A 4DE1A 1NXYA 4E6XA 1N9BA 1DY6A 1NYYA 1EI5A 1RP5A 3C5AA 3C7UA 4FD8A 2DNSA 3EQUA 3NDEA 3O88A 3FYZA 2ZC3B 4ID4A 1U60A 5HFOA 4BL2A 1KE4A 1K56A 2ZLYA 3Q82A 1IYQA 4OPQA 4U0XA 1IELA 4E3OA 4A5RA 1BLCA 1KGEA 1YQSA 4JBFA 1GHMA 3CJMA 2EXBA 3BLMA 4DF6A 3ZG9B 1ES5A 3P98A 2WZZA 2ZJ9A 3VMAA 3O86A 1N4OA 3UO9A 1HD8A 4HBUA 2R9WA 4OVDA 1O07A 4FCFA 5FA7A 1ZKJA 4GB7A 2QZ6A 5DTTA 5CGXA 3G32A 2ZM2A 4E6WA 4QD4A 3PAGA 3BYDA 4EV4A 3BFCA 3PBOA 1WYBA 4GDNA 3MBZA 5A90A 1NZOA 2OSUA 4P85A 5CEBA 2BG1A 1PI4A 3OPHA 1CI8A 3ZVTA 3RJUA 5E43A 3IF6C 1YMXA 2V1ZA 4O7DA 4GOGA 2V20A 3OCLA 3DW0A 4KENB 4UA9A 5FAOA 2H0YA 3WWXA 4XUXA 3IF5A 3OPRA 4GN2A 4KZBA 1E3UA 1ERQA 3A3EA 1XXMA 4R23A 1W5DA 3HLFA 2QMIA 3GQZA 3BFGA 1M40A 4C3QA 3ZG5A 1CEFA 1E4DA 3NI9A 5FI2A 1MY8A 5D3OA 3ZNYA 5A92A 4E3MA 1YM1A 1EROA 4BQMA 5EPHA 1O7EA 3M2KA 5F82A 5I94A 2ZC6B 5FI6A 3S1YA 3TSGA 2WZXA 1XX2A 4DXBA 5KMWA 1VQQA 3HREA 2Y2GA 4DDYA 3AGFA 3HUNA 3N4IA 2HDUA 5GHYA 2XEPA 2HDSA 2WGVA 3IF6A 5HARA 1K4EA 4OLGA 1Y54A 1ES2A 3PBQA 4X56A 1LL9A 4Y0OA 1ERMA 4DE2A 1VM1A 4FH2A 2Z2MB 4UA6A 1BT5A 2ZD8A 5FAQA 4DDSA 4H8RA 2EXAA 4Z9QA 3IXBA 4LV0A 3CG5A 1GA9A 2XK1A 2RL3A 4GD6A 1BUEA 4N1XA 4UHUA 3ZNTA 3NBLA 4WYYA 3IF6B 4EWFA 4ZJ1A 2X01A 2IWBA 4B4ZA 3NC8A 3S22A 4IVIA 1BULA 3B3XA 3UDFA 4GDBA 3BFFA 5FSRA 1CK3A 1FSWA 4R0QA 4E3KA 3GR2A 2PU2A 1FR6A 3HUOA 3ISGA 4P6BA 4RX3A 5FQIA 5DVAA 3TOIA 3ZHHA 4BLMA 1WE4A 4WMCA 3GVBA 1PWDA 2XGNA 4S2IA 3A3FA 1ONGA 4U3TA 5EVID 2Q9MA 2Y91A 3IWQA 3UE0A 3Q07A 2G2UA 1W79A 5DTKA 5CHUA 5GLBA 4JXWA 3O3VA 5U47A 3UPPA 1AXBA 4X55A 4S2KA 4UA7A 3ZG8B 2XFSA 5E2GA 3VSLA 2XD1A 3UDXA 4B4XA 5AQ9A 2J9OA 1IYPA 1MKIA 3FV7A 4OPZA 4ZBEA 5KSCA 3OZHA 4Y0TA 1Q2QA 2ZQ7A 2Y2KA 2XFTA 4WM9A 5TR7A 3SH8A 4ZDXA 3HVFA 3MXSA 4LENA 4EBPA 1TDGA 1BLSA 1PWCA 5HW3A 1MXOA 2I72A 3OPLA 5FAPA 4D2OA 3OC2A 5L2FA 3A3DA 1YLZA 3FKVA 4RA7A 5F83A 3GV9A 1PYYA 2XR0A 5CGSA 2WK0A 3BRMA 3IQAA 5HX9A 1E25A 1K25A 4OQ0A 4QJGA 3WRZA 4RVAA 1IYOA 4KZAA 3G2ZA 2ZC5B 1KGFA 1K57C 3CMZA 5CXWA 4F94A 5FI7A 5EVIC 1YLWA 4B88A 5FDHA 5EVLA 3HL9A 3UY6A 5F1FA 1DJCA 3BFEA 3ZVWA 3W4OA 3ITAA 1YLYA 4KQQA 2R9XA 3W4QA 4MBHA 1FSYA 3G31A 5FQMA 5FQQA 2PBYA 3VFFA 2XDMA 2VGJA 1ONHA 4ZJ2A 3NCKA 2VGKA 3A3IA 5BOHA 5AQBA 1GA0A 1Z6FA 1L0EA 4PPRA 4QY5A 4YINA 4BJPA 1OMEA 3HLWA 4OONA 3ITBA 1XA1A 5CHMA 4LV3A 2UWXA 3VP3A 2Y2JA 4WBGA 4HEFA 4WEJA 4GNUA 2J7VA 1CI9A 4KZ6A 3LO7A 3RXWA 4S2OA 3RXXA 3G4PA 2XLNA 2WKHA 3LCEA 4N1HA 4R4RA 3FKWA 2JC7A 1IYSA 3GTCA 5GLAA 1K57A 3Q81A 1YLPA 2ZM8A 4IVKA 3V50A 3IHBA 3N8RA 3IWIA 5EVIA 4OH0A 3AGDA 5FQJA 4PM5A 4P87A 1FQGA 3VOYA 1YMSA 5GHXA 2XQZA 5GHZA 5HAPA 1ES3A 2ZC7A 4LV2A 2WYXA 1SCWA 2OLUA 4KZ7A 2HDRA 4S2NC 1HTZA 1L2SA 3M2JA 3DWKA 2HP6A 4QY6A 3VP1A 4E3IA 3G34A 4EBNA 5CRFA 1GCEA 2JBFA 1SDEA 4WELA 1XA7A 2Y2OA 1S6RA 2Y2QA 3M6HA 1W8QA 2WKEA 1XP4A 4PM6A 2C6WB 3C4PA 3IT9A 2OLVA 1FCNA 4E3JA 4M3KA 2ZC4B 4OQHA 4KZ3A 4WZ5C 4CJNA 1I2WA 1ZG4A 4PM8A 4MBFA 2JCHA 3MKEA 4KG5A 4R4SA 2G2WA 3VFHA 5CEDA 2H0TA 1ES4A 5E2HA 4E3LA 4K0XA 2Y2NA 3UDIA 2WUQA 4S2NA 2E8IA 2Y2MA 3BLSA 4R1GA 3IHAA 4WEKA 1CEGA 3BECA 3S4XA 2WKIA 3PBRA 2FFYA 4YFMA 3N8SA 3VP4A 1I2SA 1ZC2A 5GL9A 1LHYA 3VSKA 1L0FA 4NETA 4ZTKA 4QHCA 4Q8IA 2EX2A 1SKFA 5A91A 1XGIA 3MKFA 1GHIA 2Y2HA 4S2JA 1LL5A 1HVBA 1NYMA 3MZFA 4OLDA 4ZJ3A 2HPBA 4WZ5A 3Q7ZA 2QPNA 1FOFA 5TFQA 4ZAMA 4N92A 3N7WA 3V5MA 1TEMA 5F1GA 1FCMA 3HLBA 4R3JA 3MZDA 3VOZA 2HDQA 3PBTA 4OOMA 4JF4A 1GHPA 4QU3A 4IBXA 4C75A 3LY3A 1RGYA 1G6AA 5CECA 4PM9A 4DE3A 1JTGA 1MWTA 3IWOA 4UAAA 2P9VA 3SS3A 4JXGA 3UPOA 2A3UA 1S0WA 4OQIA 3M6BA 3PBSA 4S2MA 5M1AA 5CTNA 3TG9A 5KZHA 3E2KA 1H5XA 1JTDA 1LLBA 4FH4A 3HUMA 4GKUA 4MLLA 5GLCA 1L0GA 1PW8A 1IKIA 3QNBA 4U0TA 5EOEA 2Y55A 4DXCA 3BM6A 2B5RA 4EQIA 5EOOA 3E2LA 1H8ZA 4L0LA 3PTEA 5CERA 2IWCA 4DE0A 3IXHA 3OCNA 3G30A 2EX9A 5FQKA 1XPBA 5HAQA 1FCOA 5E2EA 3MFDA 2ZQCA 4LCMA 5HAIA 4K0WA 4XUZA 5DF9A 1IKGA 1K55C 4OOLA 1TVFA 1MPLA 4X53A 3VP0A 4S2LA 1PI5A 2Y4AA 3SOIA 1TDLA 5DTSA 1KDWA 3WS5A 1HZOA 3OPPA 1MBLA 4FSFA 4OPRA 2V2FF 1YLJA 2EFXA 1C3BA 2Q9NA 3ZFZA 1KDSA 2J9PA 3N8LA 1IEMA 1RCJA 2EFUA 1KVLA 3EQVA 5AQ7A 3FWLA 3ZG0A 4DRTA 5E2FA 3ZG7B 2WGIA 2ZQ9A 4QB8A 5J8XA 1Q2PA 2DRWA 2WAFA 3NIAA 3BEBA 5AQAA 2EX6A 4IEDA 4BENA 4KQRA 4NK3A 1JWVA 2Y2LA 3N6IA 4LV1A 3CZDA 4BD0A 3QHYA 2HP5A 5IHVA 3ZCZA 2ZQ8A 4JPMA 5TGFA 1SDNA 3QNCA 4X6TA 4RX2A 4KZ9A 4JXVA 4PMAA 4EUZA 4WMCD 3Q1FA 4JXSA 1K55A 2X02A 1DJBA 2ZMAA 4N9LA 1YLTA 2HP9A 4OQGA 1DJAA 1RGZA 4Y0UA 2FFFB 1J9MA 5EVIB 4KQOA 3UE3A 3WS4A 1K6SA 3IXGA 2PU4A 2P74A 4KZ4A 5EECA 3SH9A 2GDNA 3DTMA 3MZEA 1MWUA 1I5QA 1MWRA 3PBNA 2ZQAA 1M6KA 1XKZA 3DWZA 3SS5A 1ESUA 2H10A 3HBRA 4N9KA 3P09A 4OP8A 1BLHA 1BTLA 1KE3A 4JLFA 4XXRA 3HLGA 5EE8A 4KG6A 3MXRA 2Y2PA 4C6YA 5G18A 1NJ4A 1H8YA 2X71A 4OKPA 1ALQA 1PZPA 1JWPA 3A3JA 1QMEA 4GZBA 5FATA 4BD1A 3IH8A 4JF5A 3Q7VA 3V39A 4EBLA 1JWZA 4JF6A 3UNWA 4JKTA 3D4FA 5CHJA 3BFDA 4KZ8A 3PAEA 1K56D 1L0DA 2CC1A 2ZQDA 4MEZA 2JE5A 5CTMA 4E3NA 1BZAA 4R3BA 3WRTA 1SHVA 4GD8A 1KVMA 1K4FA 3HLDA 2WAEA 4IBRA 3W4PA 1K54C 3Q7VB 5JYOA 3HLEA 4OPYA 1PIOA 3WS2A 4WZ4A 5M19A 2ZM0A 4RYEA 1W8YA 2WADA 3W8KA 5M18A 1LI0A 3HLCA 4K91A 4KG2A 3UN7A 2EX8A 4PM7A 3NDGA 3IH9A 3UPNA 5FASA 1BSGA 4S2PA 2DCFA 2Z2LB 3LY4A 2Y59A 3V3RA 1WYCA 2C5WB 3C7VA 3UE1A 3GMWA 5GLDA 4CPKA 5CGWA 3ZGAB 1LI9A 4KZ5A 1NRFA 4Y7PA 2XH9A 3WS0A 1K38A 1JVJA 5KSHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WGW A;  4HBT A;  2H5S A;  4MBK A;  5HL1 A;  2Y2I A;  1PW1 A;  1PWG A;  3GSG A;  4OP5 A;  3NY4 A;  4X68 A;  1K54 A;  1G68 A;  5EUA A;  2J8Y A;  1NZU A;  1XGJ A;  2A49 A;  1KE0 A;  4MNR A;  4BL3 A;  5FQ9 A;  3IXD A;  1E3U D;  3SS4 A;  5JYP A;  3I7J A;  5A93 A;  3AGE A;  2BLS A;  2P9V B;  4X69 A;  1K6R A;  2WGW B;  4P0M A;  2IWD A;  5DF8 A;  1PZO A;  1ESI A;  1QMF A;  1ZG6 A;  4DKI A;  1NY0 A;  2XF3 A;  3SH7 A;  1BLP A;  3O87 A;  3V3S A;  3JYI A;  4LCL A;  1KGG A;  1YT4 A;  3VP2 A;  3GRJ A;  3G2Y A;  3G35 A;  1MWS A;  3ZDJ A;  4HES A;  1W7F A;  3LEZ A;  5DF7 A;  4OOY A;  3FZC A;  2RCX A;  2XD5 A;  3WS1 A;  1EWZ A;  3C4O A;  1FR1 A;  2OV5 A;  4DE1 A;  1NXY A;  4E6X A;  1N9B A;  1DY6 A;  1NYY A;  1EI5 A;  1RP5 A;  3C5A A;  3C7U A;  4FD8 A;  2DNS A;  3EQU A;  3NDE A;  3O88 A;  3FYZ A;  2ZC3 B;  4ID4 A;  1U60 A;  5HFO A;  4BL2 A;  1KE4 A;  1K56 A;  2ZLY A;  3Q82 A;  1IYQ A;  4OPQ A;  4U0X A;  1IEL A;  4E3O A;  4A5R A;  1BLC A;  1KGE A;  1YQS A;  4JBF A;  1GHM A;  3CJM A;  2EXB A;  3BLM A;  4DF6 A;  3ZG9 B;  1ES5 A;  3P98 A;  2WZZ A;  2ZJ9 A;  3VMA A;  3O86 A;  1N4O A;  3UO9 A;  1HD8 A;  4HBU A;  2R9W A;  4OVD A;  1O07 A;  4FCF A;  5FA7 A;  1ZKJ A;  4GB7 A;  2QZ6 A;  5DTT A;  5CGX A;  3G32 A;  2ZM2 A;  4E6W A;  4QD4 A;  3PAG A;  3BYD A;  4EV4 A;  3BFC A;  3PBO A;  1WYB A;  4GDN A;  3MBZ A;  5A90 A;  1NZO A;  2OSU A;  4P85 A;  5CEB A;  2BG1 A;  1PI4 A;  3OPH A;  1CI8 A;  3ZVT A;  3RJU A;  5E43 A;  3IF6 C;  1YMX A;  2V1Z A;  4O7D A;  4GOG A;  2V20 A;  3OCL A;  3DW0 A;  4KEN B;  4UA9 A;  5FAO A;  2H0Y A;  3WWX A;  4XUX A;  3IF5 A;  3OPR A;  4GN2 A;  4KZB A;  1E3U A;  1ERQ A;  3A3E A;  1XXM A;  4R23 A;  1W5D A;  3HLF A;  2QMI A;  3GQZ A;  3BFG A;  1M40 A;  4C3Q A;  3ZG5 A;  1CEF A;  1E4D A;  3NI9 A;  5FI2 A;  1MY8 A;  5D3O A;  3ZNY A;  5A92 A;  4E3M A;  1YM1 A;  1ERO A;  4BQM A;  5EPH A;  1O7E A;  3M2K A;  5F82 A;  5I94 A;  2ZC6 B;  5FI6 A;  3S1Y A;  3TSG A;  2WZX A;  1XX2 A;  4DXB A;  5KMW A;  1VQQ A;  3HRE A;  2Y2G A;  4DDY A;  3AGF A;  3HUN A;  3N4I A;  2HDU A;  5GHY A;  2XEP A;  2HDS A;  2WGV A;  3IF6 A;  5HAR A;  1K4E A;  4OLG A;  1Y54 A;  1ES2 A;  3PBQ A;  4X56 A;  1LL9 A;  4Y0O A;  1ERM A;  4DE2 A;  1VM1 A;  4FH2 A;  2Z2M B;  4UA6 A;  1BT5 A;  2ZD8 A;  5FAQ A;  4DDS A;  4H8R A;  2EXA A;  4Z9Q A;  3IXB A;  4LV0 A;  3CG5 A;  1GA9 A;  2XK1 A;  2RL3 A;  4GD6 A;  1BUE A;  4N1X A;  4UHU A;  3ZNT A;  3NBL A;  4WYY A;  3IF6 B;  4EWF A;  4ZJ1 A;  2X01 A;  2IWB A;  4B4Z A;  3NC8 A;  3S22 A;  4IVI A;  1BUL A;  3B3X A;  3UDF A;  4GDB A;  3BFF A;  5FSR A;  1CK3 A;  1FSW A;  4R0Q A;  4E3K A;  3GR2 A;  2PU2 A;  1FR6 A;  3HUO A;  3ISG A;  4P6B A;  4RX3 A;  5FQI A;  5DVA A;  3TOI A;  3ZHH A;  4BLM A;  1WE4 A;  4WMC A;  3GVB A;  1PWD A;  2XGN A;  4S2I A;  3A3F A;  1ONG A;  4U3T A;  5EVI D;  2Q9M A;  2Y91 A;  3IWQ A;  3UE0 A;  3Q07 A;  2G2U A;  1W79 A;  5DTK A;  5CHU A;  5GLB A;  4JXW A;  3O3V A;  5U47 A;  3UPP A;  1AXB A;  4X55 A;  4S2K A;  4UA7 A;  3ZG8 B;  2XFS A;  5E2G A;  3VSL A;  2XD1 A;  3UDX A;  4B4X A;  5AQ9 A;  2J9O A;  1IYP A;  1MKI A;  3FV7 A;  4OPZ A;  4ZBE A;  5KSC A;  3OZH A;  4Y0T A;  1Q2Q A;  2ZQ7 A;  2Y2K A;  2XFT A;  4WM9 A;  5TR7 A;  3SH8 A;  4ZDX A;  3HVF A;  3MXS A;  4LEN A;  4EBP A;  1TDG A;  1BLS A;  1PWC A;  5HW3 A;  1MXO A;  2I72 A;  3OPL A;  5FAP A;  4D2O A;  3OC2 A;  5L2F A;  3A3D A;  1YLZ A;  3FKV A;  4RA7 A;  5F83 A;  3GV9 A;  1PYY A;  2XR0 A;  5CGS A;  2WK0 A;  3BRM A;  3IQA A;  5HX9 A;  1E25 A;  1K25 A;  4OQ0 A;  4QJG A;  3WRZ A;  4RVA A;  1IYO A;  4KZA A;  3G2Z A;  2ZC5 B;  1KGF A;  1K57 C;  3CMZ A;  5CXW A;  4F94 A;  5FI7 A;  5EVI C;  1YLW A;  4B88 A;  5FDH A;  5EVL A;  3HL9 A;  3UY6 A;  5F1F A;  1DJC A;  3BFE A;  3ZVW A;  3W4O A;  3ITA A;  1YLY A;  4KQQ A;  2R9X A;  3W4Q A;  4MBH A;  1FSY A;  3G31 A;  5FQM A;  5FQQ A;  2PBY A;  3VFF A;  2XDM A;  2VGJ A;  1ONH A;  4ZJ2 A;  3NCK A;  2VGK A;  3A3I A;  5BOH A;  5AQB A;  1GA0 A;  1Z6F A;  1L0E A;  4PPR A;  4QY5 A;  4YIN A;  4BJP A;  1OME A;  3HLW A;  4OON A;  3ITB A;  1XA1 A;  5CHM A;  4LV3 A;  2UWX A;  3VP3 A;  2Y2J A;  4WBG A;  4HEF A;  4WEJ A;  4GNU A;  2J7V A;  1CI9 A;  4KZ6 A;  3LO7 A;  3RXW A;  4S2O A;  3RXX A;  3G4P A;  2XLN A;  2WKH A;  3LCE A;  4N1H A;  4R4R A;  3FKW A;  2JC7 A;  1IYS A;  3GTC A;  5GLA A;  1K57 A;  3Q81 A;  1YLP A;  2ZM8 A;  4IVK A;  3V50 A;  3IHB A;  3N8R A;  3IWI A;  5EVI A;  4OH0 A;  3AGD A;  5FQJ A;  4PM5 A;  4P87 A;  1FQG A;  3VOY A;  1YMS A;  5GHX A;  2XQZ A;  5GHZ A;  5HAP A;  1ES3 A;  2ZC7 A;  4LV2 A;  2WYX A;  1SCW A;  2OLU A;  4KZ7 A;  2HDR A;  4S2N C;  1HTZ A;  1L2S A;  3M2J A;  3DWK A;  2HP6 A;  4QY6 A;  3VP1 A;  4E3I A;  3G34 A;  4EBN A;  5CRF A;  1GCE A;  2JBF A;  1SDE A;  4WEL A;  1XA7 A;  2Y2O A;  1S6R A;  2Y2Q A;  3M6H A;  1W8Q A;  2WKE A;  1XP4 A;  4PM6 A;  2C6W B;  3C4P A;  3IT9 A;  2OLV A;  1FCN A;  4E3J A;  4M3K A;  2ZC4 B;  4OQH A;  4KZ3 A;  4WZ5 C;  4CJN A;  1I2W A;  1ZG4 A;  4PM8 A;  4MBF A;  2JCH A;  3MKE A;  4KG5 A;  4R4S A;  2G2W A;  3VFH A;  5CED A;  2H0T A;  1ES4 A;  5E2H A;  4E3L A;  4K0X A;  2Y2N A;  3UDI A;  2WUQ A;  4S2N A;  2E8I A;  2Y2M A;  3BLS A;  4R1G A;  3IHA A;  4WEK A;  1CEG A;  3BEC A;  3S4X A;  2WKI A;  3PBR A;  2FFY A;  4YFM A;  3N8S A;  3VP4 A;  1I2S A;  1ZC2 A;  5GL9 A;  1LHY A;  3VSK A;  1L0F A;  4NET A;  4ZTK A;  4QHC A;  4Q8I A;  2EX2 A;  1SKF A;  5A91 A;  1XGI A;  3MKF A;  1GHI A;  2Y2H A;  4S2J A;  1LL5 A;  1HVB A;  1NYM A;  3MZF A;  4OLD A;  4ZJ3 A;  2HPB A;  4WZ5 A;  3Q7Z A;  2QPN A;  1FOF A;  5TFQ A;  4ZAM A;  4N92 A;  3N7W A;  3V5M A;  1TEM A;  5F1G A;  1FCM A;  3HLB A;  4R3J A;  3MZD A;  3VOZ A;  2HDQ A;  3PBT A;  4OOM A;  4JF4 A;  1GHP A;  4QU3 A;  4IBX A;  4C75 A;  3LY3 A;  1RGY A;  1G6A A;  5CEC A;  4PM9 A;  4DE3 A;  1JTG A;  1MWT A;  3IWO A;  4UAA A;  2P9V A;  3SS3 A;  4JXG A;  3UPO A;  2A3U A;  1S0W A;  4OQI A;  3M6B A;  3PBS A;  4S2M A;  5M1A A;  5CTN A;  3TG9 A;  5KZH A;  3E2K A;  1H5X A;  1JTD A;  1LLB A;  4FH4 A;  3HUM A;  4GKU A;  4MLL A;  5GLC A;  1L0G A;  1PW8 A;  1IKI A;  3QNB A;  4U0T A;  5EOE A;  2Y55 A;  4DXC A;  3BM6 A;  2B5R A;  4EQI A;  5EOO A;  3E2L A;  1H8Z A;  4L0L A;  3PTE A;  5CER A;  2IWC A;  4DE0 A;  3IXH A;  3OCN A;  3G30 A;  2EX9 A;  5FQK A;  1XPB A;  5HAQ A;  1FCO A;  5E2E A;  3MFD A;  2ZQC A;  4LCM A;  5HAI A;  4K0W A;  4XUZ A;  5DF9 A;  1IKG A;  1K55 C;  4OOL A;  1TVF A;  1MPL A;  4X53 A;  3VP0 A;  4S2L A;  1PI5 A;  2Y4A A;  3SOI A;  1TDL A;  5DTS A;  1KDW A;  3WS5 A;  1HZO A;  3OPP A;  1MBL A;  4FSF A;  4OPR A;  2V2F F;  1YLJ A;  2EFX A;  1C3B A;  2Q9N A;  3ZFZ A;  1KDS A;  2J9P A;  3N8L A;  1IEM A;  1RCJ A;  2EFU A;  1KVL A;  3EQV A;  5AQ7 A;  3FWL A;  3ZG0 A;  4DRT A;  5E2F A;  3ZG7 B;  2WGI A;  2ZQ9 A;  4QB8 A;  5J8X A;  1Q2P A;  2DRW A;  2WAF A;  3NIA A;  3BEB A;  5AQA A;  2EX6 A;  4IED A;  4BEN A;  4KQR A;  4NK3 A;  1JWV A;  2Y2L A;  3N6I A;  4LV1 A;  3CZD A;  4BD0 A;  3QHY A;  2HP5 A;  5IHV A;  3ZCZ A;  2ZQ8 A;  4JPM A;  5TGF A;  1SDN A;  3QNC A;  4X6T A;  4RX2 A;  4KZ9 A;  4JXV A;  4PMA A;  4EUZ A;  4WMC D;  3Q1F A;  4JXS A;  1K55 A;  2X02 A;  1DJB A;  2ZMA A;  4N9L A;  1YLT A;  2HP9 A;  4OQG A;  1DJA A;  1RGZ A;  4Y0U A;  2FFF B;  1J9M A;  5EVI B;  4KQO A;  3UE3 A;  3WS4 A;  1K6S A;  3IXG A;  2PU4 A;  2P74 A;  4KZ4 A;  5EEC A;  3SH9 A;  2GDN A;  3DTM A;  3MZE A;  1MWU A;  1I5Q A;  1MWR A;  3PBN A;  2ZQA A;  1M6K A;  1XKZ A;  3DWZ A;  3SS5 A;  1ESU A;  2H10 A;  3HBR A;  4N9K A;  3P09 A;  4OP8 A;  1BLH A;  1BTL A;  1KE3 A;  4JLF A;  4XXR A;  3HLG A;  5EE8 A;  4KG6 A;  3MXR A;  2Y2P A;  4C6Y A;  5G18 A;  1NJ4 A;  1H8Y A;  2X71 A;  4OKP A;  1ALQ A;  1PZP A;  1JWP A;  3A3J A;  1QME A;  4GZB A;  5FAT A;  4BD1 A;  3IH8 A;  4JF5 A;  3Q7V A;  3V39 A;  4EBL A;  1JWZ A;  4JF6 A;  3UNW A;  4JKT A;  3D4F A;  5CHJ A;  3BFD A;  4KZ8 A;  3PAE A;  1K56 D;  1L0D A;  2CC1 A;  2ZQD A;  4MEZ A;  2JE5 A;  5CTM A;  4E3N A;  1BZA A;  4R3B A;  3WRT A;  1SHV A;  4GD8 A;  1KVM A;  1K4F A;  3HLD A;  2WAE A;  4IBR A;  3W4P A;  1K54 C;  3Q7V B;  5JYO A;  3HLE A;  4OPY A;  1PIO A;  3WS2 A;  4WZ4 A;  5M19 A;  2ZM0 A;  4RYE A;  1W8Y A;  2WAD A;  3W8K A;  5M18 A;  1LI0 A;  3HLC A;  4K91 A;  4KG2 A;  3UN7 A;  2EX8 A;  4PM7 A;  3NDG A;  3IH9 A;  3UPN A;  5FAS A;  1BSG A;  4S2P A;  2DCF A;  2Z2L B;  3LY4 A;  2Y59 A;  3V3R A;  1WYC A;  2C5W B;  3C7V A;  3UE1 A;  3GMW A;  5GLD A;  4CPK A;  5CGW A;  3ZGA B;  1LI9 A;  4KZ5 A;  1NRF A;  4Y7P A;  2XH9 A;  3WS0 A;  1K38 A;  1JVJ A;  5KSH A; 
#chains in the Genus database with same CATH topology
 4II7 A;  3T1R A;  3RTY A;  3NY4 A;  4MN5 A;  4BL3 A;  2J8Y A;  1NZU A;  1ZHH B;  2A2L A;  2HJ9 C;  4LGW A;  3UME A;  4X69 A;  1ZG6 A;  4CLC E;  4DKI A;  1HLU P;  4OOY A;  3WS1 A;  1NXY A;  1YSP A;  4FD8 A;  3FYZ A;  2AVX A;  1KE4 A;  4OPQ A;  1IYQ A;  4JBF A;  2JKR M;  3CJM A;  3EGX C;  3ZG9 B;  1ES5 A;  3P98 A;  3O86 A;  1N4O A;  5FEF A;  1HD8 A;  1OTE A;  2KOI A;  1O07 A;  1ZKJ A;  5DTT A;  5DJT A;  3BYD A;  4EV4 A;  4GDN A;  3MBZ A;  4PKY G;  1PI4 A;  1YAX A;  2WKQ A;  1XJ4 A;  3S7P A;  1D7E A;  2MJ6 A;  3LIC A;  2V1B A;  4GOG A;  3OCL A;  3DW0 A;  4KEN B;  4UA9 A;  2H0Y A;  3BQ8 A;  3DTK A;  3OPR A;  3MQ0 A;  2M7V A;  1S1Y A;  1E3U A;  3A3E A;  1E4D A;  5FI2 A;  4MDZ A;  2YKF A;  5FI6 A;  3L7H A;  3HUN A;  3IF6 A;  3LR0 A;  2VA0 A;  1P0Z A;  1ERM A;  1GSV A;  4FOF A;  4UHU A;  1BUE A;  3NBL A;  3IF6 B;  4WN5 A;  3S22 A;  4IVI A;  1BUL A;  3UDF A;  1F98 A;  3GR2 A;  1FR6 A;  3HUO A;  3ISG A;  5FQI A;  3O5Y A;  5DVA A;  1WE4 A;  1YKD A;  3GVB A;  5EVI D;  3A3F A;  3IWQ A;  2ZOH A;  3O3V A;  1S1Z A;  1AXB A;  1V9Z A;  4LFU A;  5E2G A;  3IX4 A;  3FV7 A;  2ZQ7 A;  4WM9 A;  1LSW A;  4RQ9 A;  4ZDX A;  3T4T A;  3MXS A;  3MXQ A;  3DTI A;  5HW3 A;  3OPL A;  2I72 A;  4RA7 A;  3B47 A;  4I3I A;  1STZ A;  1IYO A;  4KZA A;  3L9K A;  5J3W A;  2W0N A;  5EVI C;  4UQI M;  1DP9 A;  5F1F A;  1DJC A;  3BFE A;  4ARZ B;  4MBH A;  3NOT C;  2VGJ A;  1ONH A;  4EES A;  4CQH A;  1Z6F A;  4OON A;  1XA1 A;  4F3L B;  4LV3 A;  3S7N A;  2GZA A;  4GNU A;  2W3D A;  3IBR A;  4GJ4 A;  3G4P A;  4R4R A;  2JC7 A;  1IYS A;  5GLA A;  3Q81 A;  1YLP A;  3IHB A;  3EWK A;  4OH0 A;  1LSV A;  4JGO A;  4PM5 A;  1FQG A;  1IOU A;  4LV2 A;  4KZ7 A;  2HDR A;  1L2S A;  3DWK A;  3VP1 A;  4EBN A;  1GCE A;  5K5B A;  4IUH A;  1XA7 A;  4IUK A;  2Y2O A;  4BBV A;  1G6O A;  1EW0 A;  3M6H A;  1W8Q A;  1XP4 A;  5HDS A;  4ME4 A;  1LT0 A;  2JHE A;  4M3K A;  2ZC4 B;  4GS9 A;  4OQH A;  3T4O A;  2JCH A;  4R4S A;  5CED A;  3V67 A;  1OT6 A;  2W27 A;  2PAV P;  4K0X A;  3UDI A;  2WUQ A;  4WEK A;  2VGL M;  2WKI A;  3UE6 A;  1I2S A;  4L9F A;  4Y13 A;  5GL9 A;  3VSK A;  2VV6 A;  2EX2 A;  4R3A A;  4Y2F A;  1NYM A;  1GSX A;  2XRN A;  4NKP A;  3MZD A;  3LR5 A;  1XJ2 A;  4UAA A;  2P9V A;  5TBM B;  1SKO A;  1N9N A;  3R4K A;  1S0W A;  5HWW A;  4L9G A;  3PBS A;  5M1A A;  1IFQ A;  3TG9 A;  5KZH A;  2QKP A;  3B42 A;  3E2K A;  5EFW A;  4MLL A;  2M1C A;  4GLQ A;  4U0T A;  3D9Y A;  3LYX A;  3K2N A;  1SKO B;  4L0L A;  2IWC A;  4GCZ A;  3S7Q A;  5FQK A;  3P7N A;  1FCO A;  2QHK A;  1DRM A;  5HAI A;  3RFB A;  4KUK A;  3H9W A;  1IKG A;  1MPL A;  1PI5 A;  2Y4A A;  1TDL A;  1HZO A;  3OPP A;  4OPR A;  2V2F F;  2Q9N A;  3ZFZ A;  2W3H A;  3H82 A;  5AQ7 A;  1IEM A;  1RCJ A;  1KVL A;  3EQV A;  3FWL A;  3A0S A;  2WGI A;  5J8X A;  2DRW A;  2WAF A;  1FIK A;  2EX6 A;  4IED A;  3QHY A;  4JPM A;  3H82 B;  4RX2 A;  4KZ9 A;  4PMA A;  2X02 A;  4HQA A;  1DJB A;  2V1A A;  1DJA A;  1RGZ A;  3LIA A;  3UE3 A;  3IXG A;  1KOU A;  2PU4 A;  4KZ4 A;  5EEC A;  3SH9 A;  4HJ4 A;  3MZE A;  3T1Q B;  1MWU A;  1P9R A;  2H10 A;  3VE3 A;  4LLO B;  5F5Y A;  2XSS A;  4XXR A;  3T12 B;  3NJA A;  5EE8 A;  1A0K A;  2HF6 A;  2EWW A;  2G7U A;  3A3J A;  2EA9 A;  4JKT A;  2B18 A;  3PAE A;  1L0D A;  2BTF P;  3LIF A;  2Z6D A;  1BZA A;  4GD8 A;  5EV0 A;  4EEU A;  4YOF A;  3WS2 A;  4WZ4 A;  5M18 A;  2OWH A;  3UB6 A;  1VEU A;  2JKG A;  2PR6 A;  2DCF A;  3BWL A;  2Z2L B;  3ZGA B;  3F1N B;  1LI9 A;  4Z1W A;  3H7W A;  3WS0 A;  4HNB A;  1K38 A;  2H5S A;  1PWG A;  3GSG A;  3CPT B;  3E0Y A;  4X68 A;  1K54 A;  5HDC A;  4MNR A;  5FQ9 A;  2W3E A;  3H7W B;  5JYP A;  2INW A;  3BQA A;  2BLS A;  5DF8 A;  4MMN A;  3F1P A;  2IWD A;  1QMF A;  2A24 A;  1NLZ A;  3K3C A;  2XF3 A;  4PHT A;  1BLP A;  3V3S A;  3JYI A;  3VP2 A;  3GRJ A;  3G35 A;  1VHM A;  4LRY C;  1FR1 A;  4E6X A;  5DFY A;  4ETZ A;  5IT5 A;  1NYY A;  2A24 B;  3C5A A;  1RP5 A;  2NUP C;  3NDE A;  3T4L A;  4X25 A;  3KYZ A;  4EW7 A;  2ZC3 B;  5HFO A;  4BL2 A;  3NHQ A;  1K56 A;  4U0X A;  4E3O A;  3KSF A;  2JN7 A;  4A5R A;  1T19 A;  1GHM A;  2EXB A;  1S4S A;  2WZZ A;  5IS1 A;  4HBU A;  4OVD A;  5FA7 A;  2PD7 A;  2QZ6 A;  2O9B A;  5CGX A;  4P6Z S;  3BFC A;  3PBO A;  4D60 A;  4AFI A;  1NZO A;  2OSU A;  4P85 A;  2J80 A;  2BG1 A;  3OPH A;  2ZMF A;  3RJU A;  5E43 A;  2V1Z A;  4O7D A;  3PYP A;  5FAO A;  4XUX A;  4GHI A;  4GN2 A;  4EQ1 A;  3HLF A;  4EUV A;  3GQZ A;  1CEF A;  3NI9 A;  1MY8 A;  5D3O A;  3ZNY A;  2XRO A;  4GHI B;  5EPH A;  1O7E A;  2ZC6 B;  2VZW A;  3S1Y A;  3TSG A;  2WZX A;  3HRE A;  4FTX A;  1XFQ A;  1UWP X;  2HDU A;  4EET B;  3FG8 A;  2D02 A;  1K4E A;  1ES2 A;  3PBQ A;  3CI6 A;  4Y0O A;  4UA6 A;  2Z2M B;  1BT5 A;  2ZD8 A;  1DP6 A;  4EER A;  4H8R A;  2EXA A;  4Z9Q A;  3CG5 A;  4N1X A;  2IWB A;  4DN0 A;  3BFF A;  5FSR A;  4P6B A;  3ZHH A;  4BLM A;  4WMC A;  1ONG A;  1AWI A;  3UE0 A;  3F1O A;  3Q07 A;  5U47 A;  3UPP A;  2XFS A;  3UDX A;  4B4X A;  5AQ9 A;  1MKI A;  3F1O B;  2OAQ 1;  5TR7 A;  4KQD A;  3SH8 A;  1S67 L;  1F2K A;  3ZYT A;  3HVF A;  4EBP A;  3LFV A;  1PWC A;  3A3D A;  3EOI A;  1YLZ A;  4DJ2 A;  3BRM A;  5HX9 A;  4JGQ A;  1K25 A;  3G2Z A;  1WA9 A;  1K57 C;  4XT2 A;  3NOU C;  5EVL A;  3W4O A;  1YLY A;  1FSY A;  2GJ3 A;  2PBY A;  3QP4 A;  2XDM A;  4MN6 A;  2K31 A;  5BOH A;  4HP9 A;  2VEA A;  4PPR A;  4BJP A;  1OME A;  3HLW A;  5CHM A;  4HEF A;  3GEC A;  3RXW A;  2V0W A;  4HP4 A;  4JGP A;  2WKH A;  5G4Z A;  4N1H A;  4IVK A;  5FQJ A;  4P87 A;  2JKF A;  2WYX A;  4E3I A;  5CRF A;  3T1S A;  2V9A A;  2Y2Q A;  4G3W A;  2WKE A;  1G5U A;  3CUE C;  3UB5 P;  5L10 A;  2C6W B;  5L07 A;  3KX0 X;  4E3J A;  4KZ3 A;  5AVE A;  4CJN A;  5TJJ A;  4PM8 A;  1ZG4 A;  4MBF A;  3MKE A;  4KG5 A;  3LEQ A;  3BY9 A;  1P97 A;  5HSQ A;  3LI8 A;  2V0U A;  2Y2N A;  4DMZ A;  2QYB A;  4S2N A;  5EVE A;  3S4X A;  3PBR A;  2FFY A;  4YFM A;  3N8S A;  4IJG A;  4CLC A;  1SKF A;  4M4X A;  2XA7 M;  3MKF A;  4I39 A;  4X1M A;  5HD5 A;  4ZJ3 A;  2PT7 A;  4DJ3 A;  4WZ5 A;  2VV7 A;  4ZAM A;  4HHD A;  1TEM A;  3HLB A;  2HDQ A;  3PBT A;  3TE8 A;  4C75 A;  3LY3 A;  1G6A A;  1TD5 A;  1JTG A;  3P01 A;  3QP6 A;  4JXG A;  3M6B A;  1H5X A;  4FH4 A;  2BAS A;  2Q0O A;  3QNB A;  3BM6 A;  2B5R A;  4EQI A;  3E2L A;  3PTE A;  4DE0 A;  4JGR A;  2EX9 A;  1XPB A;  3D72 A;  3MFD A;  3KYE A;  4XUZ A;  1T18 A;  3CIT A;  4X53 A;  2W3F A;  5DTS A;  2EWV A;  1YLJ A;  1C3B A;  1KDS A;  3N8L A;  4DRT A;  5E2F A;  4KQR A;  2HP5 A;  2ZQ8 A;  1W63 M;  4HOI A;  4R70 A;  4WL9 A;  1OJG A;  2J3W A;  4EU0 A;  4WMC D;  1K55 A;  4EXO A;  2ZMA A;  4N9L A;  2HP9 A;  3D3O A;  4KQO A;  2I9V A;  1N9L A;  2VK3 A;  3WS4 A;  1X0O A;  3E4Q A;  1P9W A;  3PBN A;  3DWZ A;  3S7O A;  3SS5 A;  3HBR A;  3P09 A;  4OP8 A;  1BTL A;  4JLF A;  3HLG A;  1ACF A;  3HJK A;  2WKP A;  5FAT A;  4BD1 A;  3IH8 A;  4EBL A;  3V39 A;  3UNW A;  1OPX A;  4GS9 B;  2ZQD A;  2CC1 A;  4MEZ A;  2JE5 A;  3C38 A;  5F69 A;  2KX6 A;  3MS6 A;  4R3B A;  3WRT A;  1KVM A;  3EEA A;  1XJ3 A;  4IBR A;  4OPY A;  3T4K A;  4K91 A;  5AVF A;  4PM7 A;  3IH9 A;  5FAS A;  5J7E A;  4S2P A;  2P04 A;  3U4L P;  1UGU A;  2Y59 A;  1WYC A;  5GLD A;  2VX8 A;  5CGW A;  4Y17 A;  2VJW A;  5KSH A;  4G3K A;  4HBT A;  3UB8 A;  5EUA A;  1SZV A;  2A49 A;  1E3U D;  3SS4 A;  5A93 A;  2P9V B;  3MFX A;  1K6R A;  1ESI A;  3LR3 A;  3SH7 A;  3O87 A;  4LCL A;  3E4P A;  1KGG A;  1YT4 A;  3JVV A;  5F6A A;  3G2Y A;  3ZDJ A;  1W7F A;  2RCX A;  1EWZ A;  3C4O A;  5AJG A;  4PAU A;  1FIL A;  1N9B A;  1YSQ A;  2KLI A;  4H6J A;  1CQA A;  4ID4 A;  4WUJ A;  1U60 A;  1BLC A;  3K3D A;  2IA2 A;  2UV0 E;  4H6J B;  2ZJ9 A;  3UO9 A;  2R9W A;  2JKT I;  3MQO A;  4O8G A;  1T1B A;  1T1A A;  4QD4 A;  3PAG A;  1WYB A;  3PXP A;  4I5S A;  4BBU A;  3LR4 A;  3ZQ5 A;  2V8F A;  3IF6 C;  1YMX A;  5FL3 A;  2V20 A;  3WWX A;  4LRZ E;  5DKL A;  4KZB A;  1XXM A;  4R23 A;  3BFG A;  1M40 A;  4C3Q A;  3ZG5 A;  3T4Q A;  3LI9 A;  5A92 A;  4Q0H A;  3NOP C;  1YM1 A;  3M2K A;  5I94 A;  5KMW A;  1XX2 A;  4DDY A;  4EEP A;  5FDS A;  2XEP A;  3QP8 A;  2WGV A;  3HJI A;  2JKR I;  4X56 A;  1LL9 A;  1VM1 A;  4DDS A;  3MSH A;  1TS7 A;  3IXB A;  1GA9 A;  2XK1 A;  2RL3 A;  3IX3 A;  3ZNT A;  4EWF A;  1OJ5 A;  4B4Z A;  3NC8 A;  4GDB A;  1F5M A;  1H3Q A;  1CK3 A;  1FSW A;  4R0Q A;  3TOI A;  1VEU B;  4S2I A;  4U3T A;  2Q9M A;  1S66 L;  4NXG A;  1W79 A;  5DTK A;  5GLB A;  1MZU A;  4JXW A;  4X55 A;  4UA7 A;  3VSL A;  3LID A;  4OPZ A;  4ZBE A;  5KSC A;  4BMW A;  2L0W A;  2Y2K A;  3ULF A;  1H0M A;  4NEE D;  2Y79 A;  2B02 A;  2VLG A;  3OLO A;  1MXO A;  5L8M A;  4D2O A;  3F1P B;  4HH2 A;  3OC2 A;  5L2F A;  2K7S A;  3FKV A;  2W3G A;  2V8C A;  3GV9 A;  1PYY A;  5CGS A;  2WK0 A;  4Y15 A;  3IQA A;  4OQ0 A;  4RVA A;  2ZC5 B;  1KGF A;  4F94 A;  1YLW A;  3HL9 A;  2CMN A;  3UY6 A;  3ZVW A;  3ITA A;  2HGV A;  4ZRR A;  5FQM A;  4ZJ2 A;  3T4J A;  3A3I A;  3MJQ A;  4QY5 A;  3VP3 A;  2UWX A;  1MKM A;  4WBG A;  4ESP A;  3A0R A;  2ZOI A;  3RXX A;  2XLN A;  1K0K A;  3FKW A;  2ZM8 A;  3V50 A;  3IS2 A;  3N8R A;  5EVI A;  2QJ5 A;  4MCW A;  4NXF A;  5C5K A;  3CHW P;  3BW6 A;  3OOV A;  5HAP A;  1ES3 A;  2L4R A;  1HTZ A;  2HP6 A;  3FC7 A;  3VV4 A;  5HWV A;  1JNU A;  3IS2 B;  5HPI A;  4WEL A;  1SDE A;  4Q0J A;  1S6R A;  4O01 A;  3LIB A;  1NWZ A;  1FCN A;  1PRQ A;  3R7W A;  4UQI S;  3EGD C;  2G2W A;  2H0T A;  2PD8 A;  5J4E A;  5E2H A;  2HV1 A;  3BLS A;  4WLA A;  3R7W B;  1CEG A;  3BEC A;  2KDK A;  3JVU A;  4HIA A;  2M7U A;  1LHY A;  3KSH A;  4ZTK A;  4QHC A;  5A91 A;  1XGI A;  2Y2H A;  1CJF A;  4S2J A;  1HVB A;  3HCY A;  2HPB A;  3Q7Z A;  2QPN A;  3KSI A;  3N7W A;  5L09 A;  3VOZ A;  4HY8 A;  4WF0 A;  4IBX A;  1RGY A;  2E8J A;  5CEC A;  4PM9 A;  1BYW A;  3IWO A;  1MC0 A;  3TJZ C;  3SS3 A;  2Z6C A;  3JPU A;  1ZTU A;  4OQI A;  5CTN A;  3MF0 A;  1JTD A;  1LLB A;  3HUM A;  4DXC A;  4Y3I A;  4NXB A;  2HZ5 A;  5CER A;  3OCN A;  3G30 A;  3KSG A;  1D06 A;  2VGL S;  2ZQC A;  4R6L A;  2GNX A;  3T4S A;  4K0W A;  5DF9 A;  4HH3 A;  1D1J A;  4XT2 B;  1KDW A;  5HWT A;  3WS5 A;  4FSF A;  2EFX A;  2J9P A;  2EFU A;  5HL6 A;  2ZQ9 A;  3NIA A;  3BEB A;  5AQA A;  1JWV A;  2Y2L A;  3N6I A;  4LV1 A;  4BD0 A;  1UWN X;  5IHV A;  3W2Z A;  3FPV A;  5HZH A;  1L3L A;  4X6T A;  4HJ3 A;  4JXV A;  4EUZ A;  3Q1F A;  1YLT A;  4Y0U A;  4L9E A;  2FFF B;  1J9M A;  1K6S A;  1LSX A;  1ODV A;  1T1C A;  2GDN A;  3DTM A;  1MWR A;  2ZQA A;  1XKZ A;  4ETX A;  3PHY A;  2LB9 A;  4UEY A;  4G3V A;  2DMW A;  3BJN A;  4BBT A;  4I3A A;  4KG6 A;  3MXR A;  4C6Y A;  2P7J A;  5G18 A;  2X71 A;  4OKP A;  1ALQ A;  2O9A A;  2QWS A;  2VKS A;  4GZB A;  1N9O A;  1VB6 A;  4JF5 A;  3Q7V A;  4JF6 A;  5CHJ A;  3BFD A;  2P08 A;  4KZ8 A;  3NEC A;  1K56 D;  5CTM A;  5HDD A;  4K08 A;  1K4F A;  3HLD A;  2WAE A;  3E98 A;  1Y28 A;  2LB5 A;  1K54 C;  3Q7V B;  5FEG A;  3HLE A;  1CF0 A;  5HD3 A;  5A8B A;  5M19 A;  2ZM0 A;  5EM1 A;  1W8Y A;  2YKH A;  3NUL A;  3SZT A;  4KG2 A;  3UN7 A;  4CLC B;  3NDG A;  3UPN A;  1NRJ A;  4QWO A;  3ICY A;  2PDR A;  3V3R A;  3UE1 A;  3GMW A;  3LGO A;  4CPK A;  4KZ5 A;  3QP5 A;  5LBR A;  3KO6 A;  2WGW A;  4MBK A;  4P6Z M;  5HL1 A;  5CX7 A;  2Y2I A;  1PW1 A;  1TS8 A;  4OP5 A;  5F68 A;  1G68 A;  1XGJ A;  5KIZ A;  1KE0 A;  2PYR A;  3IXD A;  3I7J A;  3AGE A;  2W1T A;  2WGW B;  4P0M A;  2NUT C;  1PZO A;  1NY0 A;  3UB7 A;  2R78 A;  1MWS A;  4HES A;  3LEZ A;  5DF7 A;  3FZC A;  2XD5 A;  1TS6 A;  2OV5 A;  2W1T B;  4DE1 A;  1DY6 A;  3C7U A;  1EI5 A;  2DNS A;  3EQU A;  4ARZ A;  3O88 A;  3QP1 A;  2ZLY A;  2J3T D;  3Q82 A;  3OBF A;  1IEL A;  1KGE A;  1YQS A;  1OTI A;  4F3L A;  3BLM A;  3LIE A;  4DF6 A;  3VMA A;  4FCF A;  4GB7 A;  4LRX C;  3G32 A;  2ZM2 A;  4E6W A;  2O0Y A;  5DJU A;  5A90 A;  5CEB A;  1CI8 A;  3ZVT A;  4YWZ A;  2PRF A;  2J3T C;  3IF5 A;  5IU1 A;  1ERQ A;  1W5D A;  3PR6 A;  2QMI A;  4I38 A;  4E3M A;  2H28 A;  1ERO A;  4BQM A;  3B33 A;  5F82 A;  4DXB A;  1VQQ A;  2Y2G A;  3AGF A;  4I3J A;  3N4I A;  4HJ6 A;  5GHY A;  2HDS A;  5HAR A;  4OLG A;  1Y54 A;  2VV8 A;  1GSW A;  1TS0 A;  4DE2 A;  4FH2 A;  5FAQ A;  1YPR A;  4LV0 A;  1OTB A;  4GD6 A;  4WYY A;  4LPZ A;  4ZJ1 A;  2X01 A;  3B3X A;  4E3K A;  2PU2 A;  4RX3 A;  2FZ0 A;  1PWD A;  3MR0 A;  2XGN A;  3IX8 A;  2Y91 A;  4GW9 A;  4NG2 A;  2G2U A;  4YNR A;  3GDI A;  5CHU A;  5TBM A;  4S2K A;  3ZG8 B;  1OTA A;  2XD1 A;  2PYP A;  2J9O A;  1IYP A;  4O0P A;  3OZH A;  3VE4 A;  4Y0T A;  1PNE A;  1Q2Q A;  2XFT A;  4BWI A;  3CAX A;  4LEN A;  1TDG A;  1BLS A;  2D01 A;  5FAP A;  3MQQ A;  5F83 A;  2XR0 A;  2FH5 A;  1E25 A;  4QJG A;  3WRZ A;  3CMZ A;  5CXW A;  1TF1 A;  5FI7 A;  4Q0I A;  4B88 A;  3SW1 A;  5FDH A;  3T1X A;  2OOL A;  4KQQ A;  2R9X A;  3W4Q A;  3E4O A;  3G31 A;  4NXE A;  3TRC A;  5FQQ A;  3VFF A;  4HI4 A;  3NCK A;  4CLC D;  2VGK A;  5AQB A;  1GA0 A;  4YIN A;  1L0E A;  4PKY A;  3ITB A;  3RH8 B;  2Y2J A;  5DKK A;  4WEJ A;  5I5L A;  2J7V A;  1CI9 A;  4KZ6 A;  3LO7 A;  3UB9 A;  3UMD A;  4S2O A;  1LL8 A;  3LCE A;  3GTC A;  1K57 A;  1OT9 A;  1DP8 A;  3IWI A;  1VET A;  3DAV A;  3AGD A;  2PR5 A;  1G28 A;  3VOY A;  3VOL A;  1YMS A;  5GHX A;  2XQZ A;  3CWF A;  5GHZ A;  3KYQ A;  2ZC7 A;  1SCW A;  2OLU A;  2O9C A;  4S2N C;  3M2J A;  4QY6 A;  4MN7 A;  3G34 A;  2JBF A;  1VET B;  3LUQ A;  4FUW A;  2OAP 1;  4CLC C;  1NLY A;  1XJ6 A;  4PM6 A;  2ZMV A;  2ZBB A;  3C4P A;  3IT9 A;  2OLV A;  4WZ5 C;  1I2W A;  5MC7 A;  3VFH A;  1ES4 A;  4E3L A;  4KUO A;  5G4Y A;  2ZL1 A;  2E8I A;  2Y2M A;  4R1G A;  3IHA A;  3VP4 A;  1ZC2 A;  1L0F A;  4NET A;  4Q8I A;  2ZL1 B;  3CUE A;  1XFN A;  1GHI A;  1W63 Q;  2B95 A;  1LL5 A;  3MZF A;  4OLD A;  3T50 A;  1Y4O A;  2OWJ A;  3F1N A;  3QP2 A;  1FOF A;  5TFQ A;  3C2W A;  4N92 A;  3U2A A;  3V5M A;  5F1G A;  1PFL A;  4B93 A;  1FCM A;  4R3J A;  3CPT A;  4OOM A;  4JF4 A;  3EEH A;  1J3W A;  1GHP A;  4QU3 A;  4DE3 A;  1MWT A;  3UPO A;  2A3U A;  4S2M A;  2PHY A;  1F9I A;  2W1R A;  2L1M A;  3A0V A;  3G6O A;  4GKU A;  5GLC A;  1L0G A;  1PW8 A;  1IKI A;  2ACG A;  5EOE A;  2Y55 A;  5EOO A;  1H8Z A;  1OTD A;  5HPF A;  3IXH A;  5HAQ A;  1V9Y A;  5E2E A;  1H8M A;  4LCM A;  4OOL A;  1K55 C;  1TVF A;  3DTE A;  3C8C A;  2XA7 S;  4S2L A;  3VP0 A;  3SOI A;  2Y8H A;  1MBL A;  2WKR A;  3FPW A;  3ZG0 A;  5EM0 A;  3ZG7 B;  4QB8 A;  4IHQ A;  1Q2P A;  4BEN A;  4NK3 A;  3CZD A;  3ZCZ A;  5TGF A;  1SDN A;  3QNC A;  4R38 A;  4JXS A;  4E04 A;  4Y5F A;  4OQG A;  5EVI B;  2HJE A;  2P74 A;  5DFX A;  1I5Q A;  1M6K A;  3DBA A;  1ESU A;  2GX5 A;  4N9K A;  4X1L A;  1BLH A;  1KE3 A;  3TW8 A;  2Y2P A;  1NJ4 A;  1H8Y A;  1Z09 A;  1PZP A;  1JWP A;  1QME A;  3MMH A;  1S4R A;  1JWZ A;  3D4F A;  4B9O A;  3BY8 A;  3IBJ A;  3CLO A;  4E3N A;  2O99 A;  2K2N A;  1SHV A;  3W4P A;  5JYO A;  1PIO A;  4RYE A;  2WAD A;  3W8K A;  1LI0 A;  4QPR A;  3HLC A;  2EX8 A;  2QJ7 A;  1BSG A;  3LY4 A;  2C5W B;  3C30 A;  3C7V A;  2JKT M;  1NRF A;  4Y7P A;  2XH9 A;  2PBD P;  1JVJ A; 
#chains in the Genus database with same CATH homology
 2WGW A;  4HBT A;  2H5S A;  4MBK A;  5HL1 A;  2Y2I A;  1PW1 A;  1PWG A;  3GSG A;  4OP5 A;  3NY4 A;  4X68 A;  1K54 A;  1G68 A;  5EUA A;  2J8Y A;  1NZU A;  1XGJ A;  2A49 A;  1KE0 A;  4MNR A;  4BL3 A;  5FQ9 A;  3IXD A;  1E3U D;  3SS4 A;  5JYP A;  3I7J A;  5A93 A;  3AGE A;  2BLS A;  2P9V B;  4X69 A;  1K6R A;  2WGW B;  4P0M A;  2IWD A;  5DF8 A;  1PZO A;  1ESI A;  1QMF A;  1ZG6 A;  4DKI A;  1NY0 A;  2XF3 A;  3SH7 A;  1BLP A;  3O87 A;  3V3S A;  3JYI A;  4LCL A;  1KGG A;  1YT4 A;  3VP2 A;  3GRJ A;  3G2Y A;  3G35 A;  1MWS A;  3ZDJ A;  4HES A;  1W7F A;  3LEZ A;  5DF7 A;  4OOY A;  3FZC A;  2RCX A;  2XD5 A;  3WS1 A;  1EWZ A;  3C4O A;  1FR1 A;  2OV5 A;  4DE1 A;  1NXY A;  4E6X A;  1N9B A;  1DY6 A;  1NYY A;  1EI5 A;  1RP5 A;  3C5A A;  3C7U A;  4FD8 A;  2DNS A;  3EQU A;  3NDE A;  3O88 A;  3FYZ A;  2ZC3 B;  4ID4 A;  1U60 A;  5HFO A;  4BL2 A;  1KE4 A;  1K56 A;  2ZLY A;  3Q82 A;  1IYQ A;  4OPQ A;  4U0X A;  1IEL A;  4E3O A;  4A5R A;  1BLC A;  1KGE A;  1YQS A;  4JBF A;  1GHM A;  3CJM A;  2EXB A;  3BLM A;  4DF6 A;  3ZG9 B;  1ES5 A;  3P98 A;  2WZZ A;  2ZJ9 A;  3VMA A;  3O86 A;  1N4O A;  3UO9 A;  1HD8 A;  4HBU A;  2R9W A;  4OVD A;  1O07 A;  4FCF A;  5FA7 A;  1ZKJ A;  4GB7 A;  2QZ6 A;  5DTT A;  5CGX A;  3G32 A;  2ZM2 A;  4E6W A;  4QD4 A;  3PAG A;  3BYD A;  4EV4 A;  3BFC A;  3PBO A;  1WYB A;  4GDN A;  3MBZ A;  5A90 A;  1NZO A;  2OSU A;  4P85 A;  5CEB A;  2BG1 A;  1PI4 A;  3OPH A;  1CI8 A;  3ZVT A;  3RJU A;  5E43 A;  3IF6 C;  1YMX A;  2V1Z A;  4O7D A;  4GOG A;  2V20 A;  3OCL A;  3DW0 A;  4KEN B;  4UA9 A;  5FAO A;  2H0Y A;  3WWX A;  4XUX A;  3IF5 A;  3OPR A;  4GN2 A;  4KZB A;  1E3U A;  1ERQ A;  3A3E A;  1XXM A;  4R23 A;  1W5D A;  3HLF A;  2QMI A;  3GQZ A;  3BFG A;  1M40 A;  4C3Q A;  3ZG5 A;  1CEF A;  1E4D A;  3NI9 A;  5FI2 A;  1MY8 A;  5D3O A;  3ZNY A;  5A92 A;  4E3M A;  1YM1 A;  1ERO A;  4BQM A;  5EPH A;  1O7E A;  3M2K A;  5F82 A;  5I94 A;  2ZC6 B;  5FI6 A;  3S1Y A;  3TSG A;  2WZX A;  1XX2 A;  4DXB A;  5KMW A;  1VQQ A;  3HRE A;  2Y2G A;  4DDY A;  3AGF A;  3HUN A;  3N4I A;  2HDU A;  5GHY A;  2XEP A;  2HDS A;  2WGV A;  3IF6 A;  5HAR A;  1K4E A;  4OLG A;  1Y54 A;  1ES2 A;  3PBQ A;  4X56 A;  1LL9 A;  4Y0O A;  1ERM A;  4DE2 A;  1VM1 A;  4FH2 A;  2Z2M B;  4UA6 A;  1BT5 A;  2ZD8 A;  5FAQ A;  4DDS A;  4H8R A;  2EXA A;  4Z9Q A;  3IXB A;  4LV0 A;  3CG5 A;  1GA9 A;  2XK1 A;  2RL3 A;  4GD6 A;  1BUE A;  4N1X A;  4UHU A;  3ZNT A;  3NBL A;  4WYY A;  3IF6 B;  4EWF A;  4ZJ1 A;  2X01 A;  2IWB A;  4B4Z A;  3NC8 A;  3S22 A;  4IVI A;  1BUL A;  3B3X A;  3UDF A;  4GDB A;  3BFF A;  5FSR A;  1CK3 A;  1FSW A;  4R0Q A;  4E3K A;  3GR2 A;  2PU2 A;  1FR6 A;  3HUO A;  3ISG A;  4P6B A;  4RX3 A;  5FQI A;  5DVA A;  3TOI A;  3ZHH A;  4BLM A;  1WE4 A;  4WMC A;  3GVB A;  1PWD A;  2XGN A;  4S2I A;  3A3F A;  1ONG A;  4U3T A;  5EVI D;  2Q9M A;  2Y91 A;  3IWQ A;  3UE0 A;  3Q07 A;  2G2U A;  1W79 A;  5DTK A;  5CHU A;  5GLB A;  4JXW A;  3O3V A;  5U47 A;  3UPP A;  1AXB A;  4X55 A;  4S2K A;  4UA7 A;  3ZG8 B;  2XFS A;  5E2G A;  3VSL A;  2XD1 A;  3UDX A;  4B4X A;  5AQ9 A;  2J9O A;  1IYP A;  1MKI A;  3FV7 A;  4OPZ A;  4ZBE A;  5KSC A;  3OZH A;  4Y0T A;  1Q2Q A;  2ZQ7 A;  2Y2K A;  2XFT A;  4WM9 A;  5TR7 A;  3SH8 A;  4ZDX A;  3HVF A;  3MXS A;  4LEN A;  4EBP A;  1TDG A;  1BLS A;  1PWC A;  5HW3 A;  1MXO A;  2I72 A;  3OPL A;  5FAP A;  4D2O A;  3OC2 A;  5L2F A;  3A3D A;  1YLZ A;  3FKV A;  4RA7 A;  5F83 A;  3GV9 A;  1PYY A;  2XR0 A;  5CGS A;  2WK0 A;  3BRM A;  3IQA A;  5HX9 A;  1E25 A;  1K25 A;  4OQ0 A;  4QJG A;  3WRZ A;  4RVA A;  1IYO A;  4KZA A;  3G2Z A;  2ZC5 B;  1KGF A;  1K57 C;  3CMZ A;  5CXW A;  4F94 A;  5FI7 A;  5EVI C;  1YLW A;  4B88 A;  5FDH A;  5EVL A;  3HL9 A;  3UY6 A;  5F1F A;  1DJC A;  3BFE A;  3ZVW A;  3W4O A;  3ITA A;  1YLY A;  4KQQ A;  2R9X A;  3W4Q A;  4MBH A;  1FSY A;  3G31 A;  5FQM A;  5FQQ A;  2PBY A;  3VFF A;  2XDM A;  2VGJ A;  1ONH A;  4ZJ2 A;  3NCK A;  2VGK A;  3A3I A;  5BOH A;  5AQB A;  1GA0 A;  1Z6F A;  1L0E A;  4PPR A;  4QY5 A;  4YIN A;  4BJP A;  1OME A;  3HLW A;  4OON A;  3ITB A;  1XA1 A;  5CHM A;  4LV3 A;  2UWX A;  3VP3 A;  2Y2J A;  4WBG A;  4HEF A;  4WEJ A;  4GNU A;  2J7V A;  1CI9 A;  4KZ6 A;  3LO7 A;  3RXW A;  4S2O A;  3RXX A;  3G4P A;  2XLN A;  2WKH A;  3LCE A;  4N1H A;  4R4R A;  3FKW A;  2JC7 A;  1IYS A;  3GTC A;  5GLA A;  1K57 A;  3Q81 A;  1YLP A;  2ZM8 A;  4IVK A;  3V50 A;  3IHB A;  3N8R A;  3IWI A;  5EVI A;  4OH0 A;  3AGD A;  5FQJ A;  4PM5 A;  4P87 A;  1FQG A;  3VOY A;  1YMS A;  5GHX A;  2XQZ A;  5GHZ A;  5HAP A;  1ES3 A;  2ZC7 A;  4LV2 A;  2WYX A;  1SCW A;  2OLU A;  4KZ7 A;  2HDR A;  4S2N C;  1HTZ A;  1L2S A;  3M2J A;  3DWK A;  2HP6 A;  4QY6 A;  3VP1 A;  4E3I A;  3G34 A;  4EBN A;  5CRF A;  1GCE A;  2JBF A;  1SDE A;  4WEL A;  1XA7 A;  2Y2O A;  1S6R A;  2Y2Q A;  3M6H A;  1W8Q A;  2WKE A;  1XP4 A;  4PM6 A;  2C6W B;  3C4P A;  3IT9 A;  2OLV A;  1FCN A;  4E3J A;  4M3K A;  2ZC4 B;  4OQH A;  4KZ3 A;  4WZ5 C;  4CJN A;  1I2W A;  1ZG4 A;  4PM8 A;  4MBF A;  2JCH A;  3MKE A;  4KG5 A;  4R4S A;  2G2W A;  3VFH A;  5CED A;  2H0T A;  1ES4 A;  5E2H A;  4E3L A;  4K0X A;  2Y2N A;  3UDI A;  2WUQ A;  4S2N A;  2E8I A;  2Y2M A;  3BLS A;  4R1G A;  3IHA A;  4WEK A;  1CEG A;  3BEC A;  3S4X A;  2WKI A;  3PBR A;  2FFY A;  4YFM A;  3N8S A;  3VP4 A;  1I2S A;  1ZC2 A;  5GL9 A;  1LHY A;  3VSK A;  1L0F A;  4NET A;  4ZTK A;  4QHC A;  4Q8I A;  2EX2 A;  1SKF A;  5A91 A;  1XGI A;  3MKF A;  1GHI A;  2Y2H A;  4S2J A;  1LL5 A;  1HVB A;  1NYM A;  3MZF A;  4OLD A;  4ZJ3 A;  2HPB A;  4WZ5 A;  3Q7Z A;  2QPN A;  1FOF A;  5TFQ A;  4ZAM A;  4N92 A;  3N7W A;  3V5M A;  1TEM A;  5F1G A;  1FCM A;  3HLB A;  4R3J A;  3MZD A;  3VOZ A;  2HDQ A;  3PBT A;  4OOM A;  4JF4 A;  1GHP A;  4QU3 A;  4IBX A;  4C75 A;  3LY3 A;  1RGY A;  1G6A A;  5CEC A;  4PM9 A;  4DE3 A;  1JTG A;  1MWT A;  3IWO A;  4UAA A;  2P9V A;  3SS3 A;  4JXG A;  3UPO A;  2A3U A;  1S0W A;  4OQI A;  3M6B A;  3PBS A;  4S2M A;  5M1A A;  5CTN A;  3TG9 A;  5KZH A;  3E2K A;  1H5X A;  1JTD A;  1LLB A;  4FH4 A;  3HUM A;  4GKU A;  4MLL A;  5GLC A;  1L0G A;  1PW8 A;  1IKI A;  3QNB A;  4U0T A;  5EOE A;  2Y55 A;  4DXC A;  3BM6 A;  2B5R A;  4EQI A;  5EOO A;  3E2L A;  1H8Z A;  4L0L A;  3PTE A;  5CER A;  2IWC A;  4DE0 A;  3IXH A;  3OCN A;  3G30 A;  2EX9 A;  5FQK A;  1XPB A;  5HAQ A;  1FCO A;  5E2E A;  3MFD A;  2ZQC A;  4LCM A;  5HAI A;  4K0W A;  4XUZ A;  5DF9 A;  1IKG A;  1K55 C;  4OOL A;  1TVF A;  1MPL A;  4X53 A;  3VP0 A;  4S2L A;  1PI5 A;  2Y4A A;  3SOI A;  1TDL A;  5DTS A;  1KDW A;  3WS5 A;  1HZO A;  3OPP A;  1MBL A;  4FSF A;  4OPR A;  2V2F F;  1YLJ A;  2EFX A;  1C3B A;  2Q9N A;  3ZFZ A;  1KDS A;  2J9P A;  3N8L A;  1IEM A;  1RCJ A;  2EFU A;  1KVL A;  3EQV A;  5AQ7 A;  3FWL A;  3ZG0 A;  4DRT A;  5E2F A;  3ZG7 B;  2WGI A;  2ZQ9 A;  4QB8 A;  5J8X A;  1Q2P A;  2DRW A;  2WAF A;  3NIA A;  3BEB A;  5AQA A;  2EX6 A;  4IED A;  4BEN A;  4KQR A;  4NK3 A;  1JWV A;  2Y2L A;  3N6I A;  4LV1 A;  3CZD A;  4BD0 A;  3QHY A;  2HP5 A;  5IHV A;  3ZCZ A;  2ZQ8 A;  4JPM A;  5TGF A;  1SDN A;  3QNC A;  4X6T A;  4RX2 A;  4KZ9 A;  4JXV A;  4PMA A;  4EUZ A;  4WMC D;  3Q1F A;  4JXS A;  1K55 A;  2X02 A;  1DJB A;  2ZMA A;  4N9L A;  1YLT A;  2HP9 A;  4OQG A;  1DJA A;  1RGZ A;  4Y0U A;  2FFF B;  1J9M A;  5EVI B;  4KQO A;  3UE3 A;  3WS4 A;  1K6S A;  3IXG A;  2PU4 A;  2P74 A;  4KZ4 A;  5EEC A;  3SH9 A;  2GDN A;  3DTM A;  3MZE A;  1MWU A;  1I5Q A;  1MWR A;  3PBN A;  2ZQA A;  1M6K A;  1XKZ A;  3DWZ A;  3SS5 A;  1ESU A;  2H10 A;  3HBR A;  4N9K A;  3P09 A;  4OP8 A;  1BLH A;  1BTL A;  1KE3 A;  4JLF A;  4XXR A;  3HLG A;  5EE8 A;  4KG6 A;  3MXR A;  2Y2P A;  4C6Y A;  5G18 A;  1NJ4 A;  1H8Y A;  2X71 A;  4OKP A;  1ALQ A;  1PZP A;  1JWP A;  3A3J A;  1QME A;  4GZB A;  5FAT A;  4BD1 A;  3IH8 A;  4JF5 A;  3Q7V A;  3V39 A;  4EBL A;  1JWZ A;  4JF6 A;  3UNW A;  4JKT A;  3D4F A;  5CHJ A;  3BFD A;  4KZ8 A;  3PAE A;  1K56 D;  1L0D A;  2CC1 A;  2ZQD A;  4MEZ A;  2JE5 A;  5CTM A;  4E3N A;  1BZA A;  4R3B A;  3WRT A;  1SHV A;  4GD8 A;  1KVM A;  1K4F A;  3HLD A;  2WAE A;  4IBR A;  3W4P A;  1K54 C;  3Q7V B;  5JYO A;  3HLE A;  4OPY A;  1PIO A;  3WS2 A;  4WZ4 A;  5M19 A;  2ZM0 A;  4RYE A;  1W8Y A;  2WAD A;  3W8K A;  5M18 A;  1LI0 A;  3HLC A;  4K91 A;  4KG2 A;  3UN7 A;  2EX8 A;  4PM7 A;  3NDG A;  3IH9 A;  3UPN A;  5FAS A;  1BSG A;  4S2P A;  2DCF A;  2Z2L B;  3LY4 A;  2Y59 A;  3V3R A;  1WYC A;  2C5W B;  3C7V A;  3UE1 A;  3GMW A;  5GLD A;  4CPK A;  5CGW A;  3ZGA B;  1LI9 A;  4KZ5 A;  1NRF A;  4Y7P A;  2XH9 A;  3WS0 A;  1K38 A;  1JVJ A;  5KSH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...