5BOHA

Crystal structure of oxa-58 with the substrate-binding cleft in a closed state
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
237
structure length
236
Chain Sequence
VQALFNEISADAVFVTYDGQNIKKYGTHLDRAKTAYIPASTFIANALIGLENHKATSTEIFKWDGKPRFFKAWDKDFTLGEAMQASTVPVYQELARRIGPSLMQSELQRIGYGNMQIGTEVDQFWLKGPLTITPIQEVKFVYDLAQGQLPFKPEVQQQVKEMLYVERRGENRLYAKSGWGMAVDPQVGWYVGFVEKADGQVVAFALNMQMKAGDDIALRKQLSLDVLDKLGVFHYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase
publication title Crystal Structure of OXA-58 with the Substrate-Binding Cleft in a Closed State: Insights into the Mobility and Stability of the OXA-58 Structure
pubmed doi rcsb
source organism Acinetobacter baumannii
total genus 73
structure length 236
sequence length 237
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-05-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5bohA00
3GR2A 3FKWA 4ID4A 3ITAA 3IXBA 2ZM2A 3GVBA 2Y2NA 3RXWA 1TVFA 1MWTA 2Z2LB 4O7DA 4OPZA 2XF3A 3MFDA 2DNSA 3IWIA 3WS1A 5GL9A 3HLCA 2XFSA 1KE4A 5GHXA 1PIOA 1IELA 3ZVTA 3RXXA 3C7VA 4WELA 2ZM0A 2B5RA 4DXCA 4WEKA 1M40A 3NCKA 3HLFA 4S2OA 4UHUA 1ES5A 3Q7VA 4C3QA 4RYEA 5EUAA 1NY0A 3VP0A 2EX2A 2WYXA 3A3FA 3HUNA 1WYBA 3NY4A 4MEZA 5FDHA 2DCFA 4Y0OA 4R0QA 4S2LA 2UWXA 2PU4A 5CEBA 2RCXA 5CTNA 3G2ZA 2JBFA 4JXVA 4E3KA 4OONA 3WWXA 4X53A 3MXSA 5HFOA 2EX6A 4P87A 4QY5A 1HVBA 1HTZA 1K57C 2ZC5B 4DRTA 2ZQ8A 4QY6A 3SOIA 2WKHA 4KZ3A 4IBRA 5DF7A 4BQMA 3DW0A 4IEDA 4X69A 1FSWA 2V20A 1GCEA 4KZ6A 5FQJA 1TEMA 4CJNA 1LLBA 1K56D 2WAFA 3N6IA 5EVIC 2JC7A 4XXRA 3WRZA 4X56A 3PAEA 3PTEA 1CK3A 2H5SA 3OC2A 3CZDA 4BL2A 1FR1A 1EWZA 1ZG6A 3LEZA 1Q2QA 1BLCA 3V3SA 4JF4A 3UY6A 2H0YA 2Y91A 3BFFA 3IH9A 3HLBA 2WZXA 3NBLA 4WMCD 3HUMA 1MY8A 4X68A 3AGFA 3C7UA 1GHPA 3PBRA 4FH4A 1K4EA 1SHVA 3BECA 2EX8A 3O88A 1W8QA 4OPYA 5IHVA 2ZQDA 4NETA 1W8YA 4P85A 3PBOA 5FSRA 3GRJA 4JF5A 4JBFA 4GB7A 4GD8A 1IKGA 1PW1A 3SS3A 1ERMA 2WGIA 1ESUA 3GV9A 3NC8A 5CGWA 4UA9A 4QJGA 3FWLA 1K57A 1YM1A 4OQHA 4S2MA 3SS4A 3UPNA 3ZG0A 3ZFZA 1DJAA 2XR0A 4DE2A 5CECA 3G31A 4U0XA 5A93A 1Z6FA 5CXWA 3FKVA 5FATA 1SDEA 2HP9A 3VSKA 5DTSA 3HLEA 2X02A 5EVIA 4DXBA 1C3BA 2ZC7A 4K0XA 1S6RA 4PPRA 3UN7A 2IWDA 3QNCA 4CPKA 2ZQ9A 4OH0A 1M6KA 1YLTA 2Y2KA 1XKZA 3DWKA 2C6WB 1BLSA 2ZC4B 2G2UA 3IF6B 4QB8A 3UE1A 5TGFA 1HD8A 1ES3A 1MWSA 5F1GA 2QMIA 4EBNA 3W4OA 2Y2JA 1MWRA 3ZCZA 4EQIA 2ZLYA 2XFTA 4OOLA 4ZBEA 1W79A 2P74A 5E2FA 2WUQA 4ZJ1A 3WRTA 1ESIA 4P6BA 3G4PA 1HZOA 4R4RA 3UO9A 4A5RA 3JYIA 5FA7A 5GHYA 3A3DA 3ZNTA 2VGJA 3BM6A 1E4DA 4U0TA 4EUZA 1GHIA 2EFUA 4WEJA 1TDLA 3Q7ZA 3GQZA 3M6HA 2OLUA 4IBXA 1FQGA 3IHBA 4EWFA 1XXMA 3LCEA 1YLYA 2ZMAA 3HL9A 2Y2QA 4GDBA 4KZ9A 4KZ8A 4RX2A 4BL3A 1TDGA 2Y2GA 5AQBA 2JCHA 3FZCA 5FAOA 3G35A 4E3JA 4N1HA 4RVAA 2J9OA 2H0TA 5L2FA 2XD5A 4GKUA 5GLBA 4N92A 3MKFA 1CI9A 4OQGA 3CG5A 4E3OA 4EBPA 1ES4A 3BLSA 1XA7A 5CHMA 4PMAA 2VGKA 3SH9A 1MWUA 1S0WA 2R9XA 3UE3A 1ALQA 5FQKA 1ZKJA 2Y2IA 2WGWA 1IYSA 1ZC2A 5GLCA 2XDMA 3V50A 1H5XA 2PU2A 1CI8A 1H8ZA 3N7WA 3SS5A 2V1ZA 4RX3A 5EPHA 4GD6A 5A90A 1LL5A 3BLMA 5FI2A 4ZJ3A 5EVIB 4OOYA 1XPBA 5E2EA 1NJ4A 1MKIA 1OMEA 5HL1A 2ZD8A 3A3IA 3G30A 4KZ5A 4RA7A 1IKIA 1FCNA 5JYPA 4LV3A 5FAQA 1JWPA 1YMXA 1BZAA 5F82A 2V2FF 3IWQA 1XA1A 3IF6A 1JTDA 3LY4A 2WKEA 5TR7A 2Q9MA 2RL3A 4MBHA 3V5MA 1YT4A 3QHYA 4Y0TA 4Y7PA 1RGYA 4KZ7A 5EOOA 5I94A 1ZG4A 3GMWA 1I2SA 5D3OA 1E3UA 5FQIA 4GZBA 5HAQA 3HUOA 5CGSA 2OLVA 1BSGA 4U3TA 1Q2PA 1LI9A 2E8IA 5DF9A 5E43A 3P09A 3M6BA 2EX9A 1IEMA 1KVMA 2XD1A 3E2KA 1SDNA 3ZVWA 3C4OA 5KSHA 5F83A 1N4OA 4OKPA 1VQQA 4LCLA 4QD4A 4B4ZA 3A3JA 3N4IA 3W8KA 1XX2A 3PBSA 1LHYA 4ZAMA 3HVFA 2ZC3B 3M2KA 3GTCA 3Q81A 4S2NC 2ZJ9A 4K91A 2HDQA 2WGVA 1BUEA 2A3UA 2XGNA 3HLGA 2FFYA 2H10A 3C4PA 1E25A 3EQUA 2EFXA 2ZQAA 4KZAA 3ZGAB 4JF6A 5DVAA 3VP3A 4KQQA 2Y2HA 3VMAA 5JYOA 2WGWB 1GA0A 3V3RA 4S2IA 1JWZA 5FQ9A 3IWOA 1K38A 3MXRA 3UE0A 4D2OA 4R23A 4KG2A 1W7FA 3BFGA 3BFCA 1BULA 1RGZA 1WE4A 1I5QA 4MLLA 2P9VA 5AQAA 5FASA 4BLMA 4BD1A 1JTGA 4PM9A 4X55A 4R3BA 1BT5A 4JXSA 2HDSA 1AXBA 1JWVA 3O87A 1N9BA 4S2KA 4MBFA 5CERA 1DJBA 3B3XA 4PM5A 1FOFA 4R1GA 3FV7A 1G68A 5CTMA 4WZ4A 1L0DA 1KDSA 4FSFA 3WS2A 4HBTA 3VOZA 5M19A 5FQQA 3WS4A 1KVLA 4OP5A 3VP1A 2HPBA 1L0FA 4PM6A 4E3LA 5U47A 2Y2MA 5HARA 3S22A 1KDWA 1QMEA 1RCJA 2XLNA 3IQAA 1O07A 4NK3A 5EE8A 4WZ5C 4LENA 5EVID 4DDYA 1KGGA 3IHAA 4R3JA 4GDNA 2PBYA 1FCMA 3O86A 3ZHHA 2GDNA 1U60A 1J9MA 1K54C 3Q07A 5HAIA 2EXAA 3BFEA 4K0WA 2HP5A 1L0GA 3OCNA 4OP8A 3SH8A 1DJCA 1PZPA 1K4FA 3LY3A 4E3IA 1PI4A 1MPLA 4IVKA 5EOEA 4E3NA 4HESA 3MZFA 1YLWA 4FD8A 4Y0UA 1PWDA 1YLJA 5DTKA 5M1AA 5A92A 3IH8A 5KSCA 3V39A 3OPLA 4BENA 4H8RA 1PYYA 3EQVA 3UPOA 4IVIA 5G18A 1Y54A 3Q1FA 4OLGA 4KG6A 3A3EA 4KENB 3DTMA 3S1YA 2P9VB 3VFHA 3CMZA 3ZDJA 2QZ6A 2Y2PA 5FQMA 4B88A 3IF5A 3N8LA 1EI5A 3UNWA 4C75A 1NZUA 2Y4AA 2Y2OA 4JXWA 3N8SA 4WZ5A 3TSGA 5CHJA 2WK0A 1ONGA 4UA7A 2XEPA 5DTTA 1ERQA 3IXGA 4FH2A 3OCLA 4GNUA 4ZTKA 2C5WB 3PBTA 3W4QA 3ZG5A 2J9PA 3W4PA 5HX9A 1K56A 1KGEA 1K54A 4Z9QA 4KZ4A 2X71A 1FSYA 1ONHA 1K6SA 3ZNYA 2BLSA 2HDUA 1PWGA 3OPRA 4L0LA 4UAAA 2EXBA 4N1XA 2IWBA 3OPPA 3FYZA 4KQRA 5AQ7A 1IYOA 3I7JA 1KGFA 4M3KA 5FI6A 4WMCA 4B4XA 3IT9A 4JXGA 3HLWA 4FCFA 5BOHA 2XH9A 4UA6A 3AGEA 4LV0A 1KE0A 4EV4A 1RP5A 2WZZA 3N8RA 5GLDA 5CEDA 4GOGA 3BFDA 2Y55A 1YLPA 2CC1A 3E2LA 3MBZA 3HLDA 2J7VA 1O7EA 5AQ9A 3VSLA 4F94A 3G2YA 5HAPA 1JVJA 1XP4A 4Q8IA 2JE5A 3NI9A 3VFFA 3BRMA 3OPHA 5CRFA 5GLAA 1CEGA 3G34A 4JLFA 3C5AA 5A91A 3RJUA 3BEBA 1SCWA 4WBGA 1DY6A 4S2JA 1E3UD 1K25A 1XGIA 1FR6A 1NRFA 2ZQ7A 3UDXA 3CJMA 5E2HA 3WS0A 4YFMA 3ZG8B 1BLPA 4ZJ2A 1FCOA 3HREA 3UPPA 2HP6A 3NDGA 3G32A 4N9KA 4OLDA 4WYYA 5CGXA 4XUXA 1CEFA 5GHZA 3OZHA 2IWCA 3TG9A 1I2WA 4QU3A 3NIAA 4QHCA 5F1FA 1BTLA 1PI5A 1W5DA 2HDRA 3ITBA 3QNBA 3WS5A 5FI7A 4KG5A 3S4XA 3VP4A 3LO7A 4P0MA 1PW8A 1K55C 1MBLA 5J8XA 2R9WA 1G6AA 1NXYA 3VP2A 5E2GA 5KZHA 1GA9A 4DDSA 1K6RA 5TFQA 2X01A 4C6YA 1LL9A 1NYYA 2BG1A 1EROA 3MKEA 4E6WA 5CHUA 4OQIA 4OQ0A 5DF8A 4DKIA 4R4SA 1YMSA 3AGDA 5EVLA 2A49A 4OOMA 4GN2A 1PWCA 1SKFA 4LCMA 3Q7VB 3UDFA 1L2SA 4PM7A 3IXHA 2ZM8A 1NZOA 3MZEA 4S2NA 1LI0A 4HEFA 3ISGA 5HW3A 2XQZA 1BLHA 4LV1A 1PZOA 2WADA 4LV2A 1YLZA 2ZC6B 5EECA 2Y59A 4KZBA 2Y2LA 1L0EA 2Z2MB 5KMWA 4OPQA 3D4FA 1VM1A 3BYDA 3IXDA 3O3VA 3GSGA 4WM9A 1KE3A 1IYQA 1NYMA 1MXOA 3UDIA 3ZG7B 1H8YA 2ZQCA 4MBKA 4DF6A 4S2PA 4DE0A 1K55A 2WAEA 4KQOA 1QMFA 3M2JA 3PAGA 4DE3A 1YQSA 3TOIA 4E6XA 4OVDA 3SH7A 1WYCA 5M18A 1XGJA 4ZDXA 3HBRA 4JKTA 4E3MA 3NDEA 3IF6C 3P98A 2G2WA 3VOYA 4DE1A 4BJPA 2I72A 4YINA 1ES2A 2OV5A 4BD0A 1GHMA 2Q9NA 3MZDA 4N9LA 1IYPA 3PBNA 4MNRA 2DRWA 2FFFB 4XUZA 4EBLA 3ZG9B 3PBQA 4JPMA 4PM8A 5FAPA 2WKIA 2OSUA 3DWZA 3Q82A 4HBUA 4OPRA 2J8YA 2XK1A 4X6TA 2QPNA
chains in the Genus database with same CATH superfamily
1VETB 2ZMVA 3CITA 2Y2NA 2Z2LB 4OPZA 2DNSA 3IWIA 4QWOA 1KE4A 4LRXC 4WELA 2ZM0A 3ZQ5A 3NCKA 3HLFA 3Q7VA 2WYXA 5FDHA 4Z1WA 4I5SA 4R0QA 5DFYA 3SW1A 4JXVA 2V1AA 2P7JA 4P87A 4QY5A 1HTZA 1BYWA 3SOIA 2WKHA 5EV0A 2VLGA 3FG8A 4PHTA 4IEDA 5MC7A 5FQJA 2W1TA 5HD3A 2V0WA 3U4LP 3WRZA 1T19A 3PTEA 3OC2A 3CZDA 3UY6A 1TF1A 1A0KA 3HLBA 2WZXA 3EEAA 3NHQA 1SHVA 3C38A 2EX8A 4UQIM 4M4XA 3MQOA 5IHVA 1AWIA 1W8YA 3GRJA 2GNXA 1GSXA 1ESUA 2BASA 4S2MA 3SS4A 4UQIS 4DE2A 3G31A 5A93A 1Z6FA 5CXWA 5DTSA 2X02A 2V8CA 3T4LA 3BQ8A 3QNCA 3T4KA 2ZQ9A 3IX8A 4OH0A 2Y2KA 3IF6B 4HQAA 1BLSA 2D01A 1HD8A 2ACGA 2Y2JA 2XFTA 4OOLA 4ZBEA 1W79A 3WRTA 4CQHA 1ESIA 4P6BA 1HZOA 4MCWA 3JYIA 3OLOA 2VGJA 3BM6A 4I39A 4EUZA 3E4QA 1TDLA 2YKFA 3Q7ZA 3M6HA 2OLUA 3IHBA 4BL3A 4KZ8A 2Y2QA 2A24B 1TDGA 4WL9A 3CI6A 5AQBA 2W0NA 4EEPA 3KSFA 2J9OA 2GJ3A 1CI9A 4E3OA 3CG5A 1ES4A 1MWUA 2R9XA 1ZC2A 2XDMA 1H5XA 1CI8A 4F3LA 2J3WA 3MQQA 2B18A 5A90A 3T1QB 5EVIB 4MDZA 1ACFA 5HL1A 4RA7A 2J3TC 5JYPA 5FAQA 2O99A 2V2FF 2WKEA 4JGRA 4MBHA 3V5MA 4NXEA 4Y0TA 2PR5A 4NG2A 1LSXA 1T1BA 4U3TA 2E8IA 5DF9A 2PYRA 2HV1A 3D72A 2ZMFA 3ZVWA 4QD4A 2YKHA 5K5BA 4ZAMA 2ZC3B 3M2KA 3Q81A 5FDSA 1LSVA 2EFXA 3ZGAB 4KQQA 5JYOA 2WGWB 3JPUA 5FQ9A 3H7WA 2GZAA 3BFGA 1BULA 4B93A 1WE4A 1H8MA 4BLMA 3A0VA 4PM9A 2HDSA 1AXBA 2I9VA 3O87A 1N9BA 3SZTA 4MBFA 1G68A 1J3WA 3F1OA 1L0DA 3PR6A 3BY9A 5FQQA 3R7WB 4HNBA 3LYXA 5HWVA 4ETXA 3MMHA 1QMEA 4NK3A 4WZ5C 1VEUB 3ZHHA 2GDNA 3F1PA 1J9MA 5HZHA 1K54C 3PYPA 3Q07A 3BFEA 4OP8A 1K4FA 4BBTA 3E98A 1L3LA 1YLWA 4K08A 1YLJA 5KSCA 5C5KA 3KSGA 4H8RA 3EQVA 3VE4A 5G18A 1Y54A 3Q1FA 4OLGA 3NULA 5HSQA 3T4SA 2V0UA 3RFBA 4I38A 3VFHA 3ZDJA 1CJFA 2WK0A 3L9KA 1FILA 4FH2A 3OCLA 2VX8A 3PBTA 1W63M 1G5UA 3W4PA 5DFXA 1KGEA 4Z9QA 1PWGA 2EXBA 4N1XA 3OPPA 5G4YA 4GHIB 3P7NA 3LGOA 5FI6A 4B4XA 4FCFA 4Q0HA 4EV4A 1RP5A 3MBZA 2CC1A 2J7VA 3ULFA 3G2YA 1JVJA 2V9AA 1TS6A 5CRFA 5GLAA 2ZL1A 4CLCB 3C5AA 5A91A 5A8BA 1SCWA 4WBGA 3QP2A 5L8MA 1K25A 1FR6A 5AVFA 2PD7A 3NDGA 3E4PA 4WYYA 4OLDA 1CEFA 2Y8HA 3TG9A 1I2WA 2W1RA 4QU3A 4QHCA 3QNBA 3ITBA 3UMDA 4I3AA 4HI4A 4P0MA 1MBLA 1G6AA 2O0YA 4NXGA 1NXYA 5KZHA 4PKYA 1GA9A 2X01A 3EGDC 1NYYA 2KLIA 5DF8A 4OQ0A 2PDRA 3IX4A 1MC0A 3JVUA 2A49A 4OOMA 3Q7VB 4PM7A 2W3FA 4HEFA 1NLZA 5HW3A 3GDIA 4LV1A 2WADA 2ZC6B 2W3DA 1VM1A 3O3VA 5CX7A 3GSGA 1OTIA 4YNRA 3T4QA 3KYEA 4DE0A 4DJ3A 2W1TB 1QMFA 3LEQA 4DE3A 5HWWA 3TOIA 3SH7A 4Y13A 1OT6A 1WYCA 5M18A 1OTEA 2G2WA 4BJPA 1S4RA 1ES2A 3MZDA 3DWZA 3Q82A 3UB6A 2JKFA 4X6TA 3GR2A 4ID4A 3ITAA 3T4OA 3GVBA 1TVFA 1MWTA 4O7DA 3WS1A 3K2NA 3MFDA 5GHXA 5G4ZA 3RXXA 3C7VA 4HOIA 3VV4A 4ESPA 4S2OA 4RYEA 1NY0A 2EX2A 1KOUA 4S2LA 2UWXA 4IJGA 3WWXA 4X25A 2K2NA 1IOUA 1HVBA 4DRTA 2ZQ8A 2P04A 3HCYA 4KZ3A 4IBRA 4HP4A 3DW0A 4HJ4A 4X69A 2V20A 1GCEA 5F68A 4I3IA 2H5SA 4BL2A 1ZG6A 3LEZA 1Q2QA 2L1MA 1BLCA 4MN5A 2H0YA 2PRFA 1SZVA 5FEFA 2WKQA 4HP9A 1GHPA 3IS2A 5FSRA 4JBFA 1F98A 4GD8A 1PW1A 1IKGA 5HD5A 4QJGA 5CGWA 4UA9A 3FWLA 1K57A 4OQHA 5HDCA 4F3LB 2XR0A 2WKRA 4U0XA 2VZWA 4BMWA 1SDEA 2HP9A 3HLEA 1D7EA 4Y15A 4II7A 1XKZA 3DWKA 4QB8A 4MN6A 1MWSA 3O5YA 3BJNA 3RH8B 4EBNA 2ZLYA 2P74A 2VJWA 4ZJ1A 3KSHA 3A3DA 3ZNTA 3LUQA 2M1CA 1GHIA 2ZBBA 3GQZA 4IBXA 3F1NA 1XXMA 2XSSA 1YLYA 2JKGA 3HL9A 3K3CA 3G35A 3KO6A 2VK3A 2H0TA 1H3QA 1UWPX 4GKUA 3EGXC 4LRZE 5CHMA 3P01A 3MF0A 3UE3A 1ZKJA 4WLAA 3V50A 4L9EA 2PU2A 3H7WB 1H8ZA 3N7WA 3PXPA 5EPHA 1LL5A 3CUEA 1NJ4A 3G30A 4G3VA 2W3HA 3D3OA 4LV3A 4HH2A 1JWPA 3LY4A 3F1OB 3LR0A 3QHYA 4Y7PA 1S1ZA 1RGYA 3UB9A 5EOOA 4EERA 4Q0JA 5D3OA 5J7EA 1E3UA 5FQIA 2OLVA 3FC7A 3KX0X 1LI9A 5E43A 3P09A 2OOLA 2Q0OA 3T12B 4X1MA 2VKSA 1N4OA 4OKPA 3F1PB 3W8KA 1LHYA 2ZJ9A 4EU0A 3HLGA 3C4PA 1SKOA 3QP5A 3VMAA 4JGPA 3NOUC 3IWOA 1K38A 3UE0A 4R23A 1OTDA 1RGZA 4MLLA 4X55A 1BT5A 4JXSA 1JWVA 5CERA 2QWSA 4R1GA 2V1BA 3C30A 3MFXA 4OP5A 4PM6A 4E3LA 5J3WA 5HARA 3T50A 3S22A 1RCJA 1O07A 3KYZA 5EE8A 1OTBA 2PBYA 2EXAA 1DJCA 1PI4A 2ZL1B 1MPLA 3DAVA 3MZFA 4Y0UA 1PWDA 3IH8A 1NLYA 3OPLA 4BENA 2JKTM 1PYYA 4JGOA 1UWNX 5I5LA 1N9NA 3R4KA 2P9VB 2QZ6A 2D02A 5HL6A 1OT9A 5EVEA 4JXWA 4IUKA 4UA7A 1ONGA 3IXGA 2DMWA 4KUKA 1VHMA 1PRQA 2J9PA 3T4TA 5HX9A 1K56A 4ARZA 1FSYA 1K0KA 2HDUA 3OPRA 4UAAA 5DKLA 2OAP1 1IYOA 1KGFA 4WMCA 3W2ZA 4JXGA 5BOHA 3AGEA 5CEDA 3N8RA 3BFDA 5L07A 5AQ9A 4Q8IA 2JE5A 3NI9A 3BRMA 3OPHA 3G34A 2HJEA 3UB7A 3EWKA 1E3UD 1XGIA 3UDXA 3CJMA 2HGVA 3WS0A 4YFMA 3ZG8B 4ZJ2A 1FCOA 3HREA 5CGXA 1XFNA 2K31A 4R38A 5F1FA 2HDRA 5FI7A 3S4XA 2M7UA 5J8XA 2XRNA 1K6RA 4I3JA 4PAUA 1YMSA 5F69A 4LPZA 5EVLA 4GN2A 4LCMA 1NRJA 1L2SA 2ZM8A 2Z6DA 2XQZA 1W63Q 1PZOA 5EECA 1OPXA 2VGLS 3BYDA 1KE3A 5EFWA 1IYQA 1NYMA 1MXOA 3UDIA 3ZG7B 2WAEA 1OJGA 4E6XA 4OVDA 1WA9A 3NDEA 3P98A 3VOYA 4DE1A 2XA7M 2I72A 2OV5A 1GHMA 2NUPC 3OOVA 3PBNA 4MNRA 2FFFB 4EBLA 2B95A 3ZG9B 3K3DA 4JPMA 2R78A 5FAPA 2WKIA 1HLUP 2OSUA 4GS9A 2KDKA 4WF0A 2XA7S 3FKWA 3IS2B 2ZM2A 3HLCA 2XFSA 3ZVTA 3LR3A 2B5RA 4DXCA 3LR5A 4WEKA 4UHUA 2LB5A 5EUAA 4ZRRA 3A3FA 3VP0A 4MEZA 2DCFA 2PU4A 3G2ZA 3LFVA 4LGWA 2PAVP 1Y28A 1EW0A 1K57C 2HJ9C 2ZC5B 4LLOB 2PBDP 3EOIA 3OBFA 5HWTA 3ICYA 3BWLA 1FSWA 4Y5FA 1TEMA 4CJNA 1K56D 3CWFA 3N6IA 4HY8A 4XXRA 4X56A 3VOLA 3PAEA 3S7OA 1EWZA 3V3SA 3F1NB 5IS1A 3NBLA 4WMCD 5DKKA 1MY8A 4X68A 3C7UA 3BECA 1W8QA 4OPYA 4NETA 5L09A 1DP9A 4GB7A 1ERMA 2WGIA 1YM1A 3UPNA 3D9YA 2O9BA 3ZFZA 5CECA 3DTEA 3GECA 5EVIA 3S7NA 2ZC7A 1S6RA 4KUOA 4PPRA 3DTIA 1STZA 2LB9A 3LR4A 4CPKA 1M6KA 1YLTA 2C6WB 3UE1A 5TGFA 2OAQ1 1ES3A 4Y3IA 3W4OA 1MWRA 4BWIA 3LI8A 5E2FA 2OWJA 3UO9A 3CUEC 4R4RA 5FA7A 5GHYA 3RTYA 4U0TA 2EFUA 3CAXA 4QPRA 1FQGA 3LCEA 4RX2A 4KZ9A 4GDBA 3UMEA 2Y2GA 4PKYG 5FAOA 3IBRA 4E3JA 4AFIA 2VA0A 4N1HA 4RVAA 2E8JA 1TS8A 1DRMA 2XD5A 5GLBA 2VGKA 3SH9A 3NECA 5IT5A 1S0WA 1SKOB 1ALQA 5FQKA 2WGWA 4XT2A 1XJ6A 3BLMA 5FI2A 4ZJ3A 4NEED 4OOYA 1XPBA 4UEYA 1OMEA 2ZD8A 3A3IA 1F5MA 1IKIA 1FCNA 5F82A 3IWQA 3BQAA 5TR7A 2RL3A 4EUVA 1S4SA 2QJ7A 4KQDA 1JNUA 4EESA 1CF0A 4P6ZM 4GZBA 2W3GA 3HUOA 5CGSA 3A0SA 2VEAA 2CMNA 2EX9A 1IEMA 1KVMA 2XD1A 1D06A 1SDNA 4P6ZS 5KSHA 5F83A 2VV7A 1VQQA 4LCLA 3A3JA 1XX2A 2QHKA 3PBSA 3HVFA 3NOTC 3MJQA 3GTCA 4K91A 2WGVA 2P08A 2FFYA 2H10A 3BY8A 3EQUA 4KZAA 5DVAA 5L10A 3VP3A 3V3RA 1JWZA 4D2OA 3MXRA 4KG2A 1I5QA 3U2AA 2QJ5A 5AQAA 5FASA 1VB6A 4YWZA 4DJ2A 1DJBA 3B3XA 4GCZA 4PM5A 4GW9A 3DBAA 4R3AA 4FSFA 2W27A 1LL8A 1L0FA 2HPBA 5U47A 2OWHA 4IHQA 1KDWA 2L0WA 2W3EA 5EVID 4DDYA 1KGGA 3IHAA 4R3JA 1FCMA 3O86A 3JVVA 1U60A 2PR6A 1YSPA 5HAIA 2JKTI 4K0WA 2HP5A 2O9CA 1L0GA 2Z6CA 3LY3A 4E3IA 4E3NA 4HESA 4FD8A 5DTKA 5A92A 5M1AA 2B02A 2WKPA 5KIZA 4GJ4A 3TW8A 4IVIA 4KG6A 3A3EA 3LIDA 3CMZA 4EW7A 5FQMA 2Y2PA 1EI5A 1NZUA 3N8SA 3TSGA 5CHJA 3H82A 2XEPA 1ERQA 4E04A 4O8GA 2JN7A 2C5WB 3W4QA 1ZTUA 3LIFA 2X71A 1K6SA 3T1RA 2BLSA 4L0LA 4H6JA 3FYZA 2HZ5A 5AQ7A 5HPFA 3C2WA 3IT9A 2XH9A 5IU1A 4LV0A 1KE0A 4HJ6A 1YLPA 3E2LA 3VSLA 1ZHHB 2JKRM 3NJAA 5HAPA 1XP4A 3CLOA 4HJ3A 1FIKA 4WN5A 1CEGA 2NUTC 4JLFA 3BEBA 3LIEA 4DN0A 4S2JA 1GSWA 3UPPA 2HP6A 3G32A 4N9KA 4XUXA 3OZHA 3NIAA 1OTAA 2MJ6A 2QKPA 4KG5A 1MKMA 4GS9B 2V8FA 1PW8A 4HHDA 3VP2A 4DDSA 3S7QA 1D1JA 3LIAA 5TFQA 4C6YA 1LL9A 4E6WA 1N9LA 5CHUA 5TBMA 2KOIA 4DKIA 3LI9A 4R4SA 3AGDA 5LBRA 3LICA 1SKFA 2QYBA 1S67L 3UDFA 2K7SA 3IXHA 1LI0A 3ISGA 2EWWA 2INWA 4BBVA 1YLZA 2EWVA 2Y2LA 2Z2MB 3ZYTA 5KMWA 2O9AA 1V9YA 4LFUA 4MMNA 5HPIA 1H8YA 2ZQCA 4MBKA 1K55A 4KQOA 3M2JA 3PAGA 3CPTA 1DP8A 4EXOA 2ZOHA 3HBRA 4ZDXA 3S7PA 4E3MA 3IF6C 4G3KA 3KYQA 4FUWA 3QP1A 2Q9NA 1IYPA 4FTXA 4XUZA 2DRWA 3PBQA 4ME4A 2XROA 1P9WA 4OPRA 2J8YA 2XK1A 2QPNA 3IXBA 3RXWA 3MS6A 2XF3A 2JHEA 4CLCD 5GL9A 1MZUA 1H0MA 1PIOA 1IELA 4HIAA 5TJJA 3CHWP 3EEHA 1M40A 1ES5A 4C3QA 1Y4OA 3NY4A 3HUNA 1WYBA 2UV0E 4Y0OA 4X1LA 5CEBA 2RCXA 5CTNA 2JBFA 4E3KA 4OONA 4X53A 3MXSA 5HFOA 2EX6A 4Y17A 3V67A 2GX5A 3FPWA 4QY6A 5DF7A 4BQMA 4KZ6A 2VV8A 1LLBA 5EVIC 2WAFA 2JC7A 1CK3A 2PYPA 4RQ9A 1FR1A 3VE3A 4JF4A 2Y91A 3BFFA 3IH9A 4Y2FA 3HUMA 4R6LA 3AGFA 3PBRA 4FH4A 1K4EA 3O88A 2ZQDA 2BTFP 1VETA 4P85A 3PBOA 1P97A 3T1SA 4JF5A 1G6OA 3SS3A 3GV9A 3NC8A 4Q0IA 3ZG0A 1DJAA 2VGLM 4XT2B 3FKVA 5FATA 3VSKA 4DXBA 3T1XA 1C3BA 4K0XA 4FOFA 3UN7A 2IWDA 5F5YA 3TRCA 4NKPA 1GSVA 2ZC4B 2G2UA 3MXQA 4JGQA 5F1GA 2QMIA 1XJ4A 4EQIA 3ZCZA 5AVEA 4WUJA 2WUQA 1TS0A 3G4PA 4A5RA 2AVXA 1E4DA 4WEJA 3MSHA 1T1CA 4EWFA 2ZMAA 3NOPC 2JCHA 2PT7A 3FZCA 1PNEA 5L2FA 2PD8A 4D60A 2H28A 3MKFA 4N92A 4OQGA 3HJKA 4EBPA 3UB5P 3BLSA 1XA7A 4LRYC 4PMAA 5DJTA 2KX6A 2Y2IA 1IYSA 1F9IA 3DTKA 5GLCA 3SS5A 2V1ZA 1YKDA 4RX3A 4GD6A 3B47A 1YPRA 1CQAA 3LIBA 4O01A 4CLCE 5E2EA 1MKIA 4KZ5A 1YMXA 1BZAA 2M7VA 5FEGA 1XA1A 3IF6A 1JTDA 2Q9MA 1YT4A 4KZ7A 5I94A 1ZG4A 3GMWA 1I2SA 3C8CA 4R70A 5HAQA 1BSGA 1Q2PA 1T18A 3TE8A 3M6BA 1XJ3A 3E2KA 4EQ1A 3C4OA 1XFQA 2A24A 1UGUA 4B4ZA 3N4IA 2FH5A 1LT0A 1TS7A 2EA9A 4S2NC 1BUEA 2HDQA 2A3UA 2XGNA 5EM0A 3A0RA 1E25A 2ZQAA 4JF6A 2Y2HA 1GA0A 4S2IA 1W7FA 3BFCA 2P9VA 4IUHA 5AJGA 2HF6A 4BD1A 1JTGA 4CLCC 4R3BA 4S2KA 3T4JA 3H82B 1FOFA 3FV7A 4NXFA 1LSWA 5CTMA 4WZ4A 1KDSA 3WS2A 4HBTA 2G7UA 3VOZA 5M19A 3WS4A 1YAXA 1KVLA 3VP1A 3G6OA 2Y2MA 3TJZC 4H6JB 1G28A 1ODVA 2XLNA 3IQAA 4LENA 4EEUA 4GDNA 1P9RA 1DP6A 3OCNA 3SH8A 1PZPA 4IVKA 5EOEA 1IFQA 3V39A 1X0OA 3UPOA 1TD5A 2FZ0A 4KENB 3DTMA 4HH3A 3S1YA 3IBJA 1N9OA 4B88A 3IF5A 3N8LA 3UNWA 4C75A 2Y4AA 3UE6A 4GLQA 2Y2OA 3H9WA 5J4EA 4WZ5A 5DTTA 4GNUA 1S1YA 4ZTKA 2ZOIA 3ZG5A 5TBMB 1K54A 4KZ4A 3R7WA 3E0YA 1ONHA 3ZNYA 2IWBA 3E4OA 2JKRI 5FL3A 4KQRA 3I7JA 2IA2A 4M3KA 1VEUA 3BW6A 3HLWA 5EM1A 4UA6A 5GLDA 2WZZA 4GOGA 2Y55A 3HLDA 3MQ0A 1O7EA 4F94A 4EETB 4B9OA 3QP6A 1V9ZA 2Y79A 3VFFA 1S66L 3RJUA 3CPTB 1DY6A 2ZQ7A 1NRFA 5E2HA 1BLPA 3QP4A 2L4RA 3PHYA 5GHZA 2IWCA 3HJIA 1BTLA 1PI5A 1W5DA 4O0PA 3WS5A 5HDSA 3VP4A 3LO7A 4YOFA 1K55C 1P0ZA 2R9WA 2PHYA 5E2GA 2VV6A 5DJUA 2A2LA 1T1AA 3IX3A 3B42A 2BG1A 5F6AA 1EROA 3MKEA 4OQIA 2J3TD 2J80A 1OJ5A 4MN7A 4ETZA 4ARZB 1PWCA 1NZOA 3MZEA 4S2NA 4L9FA 4GHIA 1BLHA 4LV2A 4NXBA 2Y59A 1YSQA 4KZBA 1L0EA 3UB8A 4OPQA 4L9GA 3D4FA 3IXDA 1PFLA 4WM9A 1F2KA 3L7HA 3MR0A 3QP8A 4S2PA 4DF6A 4CLCA 1Z09A 1YQSA 3FPVA 1NWZA 1XGJA 4JKTA 4YINA 4BD0A 4N9LA 3B33A 4PM8A 4DMZA 3KSIA 1XJ2A 5HDDA 4G3WA 4HBUA 4BBUA
chains in the Genus database with same CATH topology
3GR2A 3FKWA 4ID4A 3ITAA 3IXBA 2ZM2A 3GVBA 2Y2NA 3RXWA 1TVFA 1MWTA 2Z2LB 4O7DA 4OPZA 2XF3A 3MFDA 2DNSA 3IWIA 3WS1A 5GL9A 3HLCA 2XFSA 1KE4A 5GHXA 1PIOA 1IELA 3ZVTA 3RXXA 3C7VA 4WELA 2ZM0A 2B5RA 4DXCA 4WEKA 1M40A 3NCKA 3HLFA 4S2OA 4UHUA 1ES5A 3Q7VA 4C3QA 4RYEA 5EUAA 1NY0A 3VP0A 2EX2A 2WYXA 3A3FA 3HUNA 1WYBA 3NY4A 4MEZA 5FDHA 2DCFA 4Y0OA 4R0QA 4S2LA 2UWXA 2PU4A 5CEBA 2RCXA 5CTNA 3G2ZA 2JBFA 4JXVA 4E3KA 4OONA 3WWXA 4X53A 3MXSA 5HFOA 2EX6A 4P87A 4QY5A 1HVBA 1HTZA 1K57C 2ZC5B 4DRTA 2ZQ8A 4QY6A 3SOIA 2WKHA 4KZ3A 4IBRA 5DF7A 4BQMA 3DW0A 4IEDA 4X69A 1FSWA 2V20A 1GCEA 4KZ6A 5FQJA 1TEMA 4CJNA 1LLBA 1K56D 2WAFA 3N6IA 5EVIC 2JC7A 4XXRA 3WRZA 4X56A 3PAEA 3PTEA 1CK3A 2H5SA 3OC2A 3CZDA 4BL2A 1FR1A 1EWZA 1ZG6A 3LEZA 1Q2QA 1BLCA 3V3SA 4JF4A 3UY6A 2H0YA 2Y91A 3BFFA 3IH9A 3HLBA 2WZXA 3NBLA 4WMCD 3HUMA 1MY8A 4X68A 3AGFA 3C7UA 1GHPA 3PBRA 4FH4A 1K4EA 1SHVA 3BECA 2EX8A 3O88A 1W8QA 4OPYA 5IHVA 2ZQDA 4NETA 1W8YA 4P85A 3PBOA 5FSRA 3GRJA 4JF5A 4JBFA 4GB7A 4GD8A 1IKGA 1PW1A 3SS3A 1ERMA 2WGIA 1ESUA 3GV9A 3NC8A 5CGWA 4UA9A 4QJGA 3FWLA 1K57A 1YM1A 4OQHA 4S2MA 3SS4A 3UPNA 3ZG0A 3ZFZA 1DJAA 2XR0A 4DE2A 5CECA 3G31A 4U0XA 5A93A 1Z6FA 5CXWA 3FKVA 5FATA 1SDEA 2HP9A 3VSKA 5DTSA 3HLEA 2X02A 5EVIA 4DXBA 1C3BA 2ZC7A 4K0XA 1S6RA 4PPRA 3UN7A 2IWDA 3QNCA 4CPKA 2ZQ9A 4OH0A 1M6KA 1YLTA 2Y2KA 1XKZA 3DWKA 2C6WB 1BLSA 2ZC4B 2G2UA 3IF6B 4QB8A 3UE1A 5TGFA 1HD8A 1ES3A 1MWSA 5F1GA 2QMIA 4EBNA 3W4OA 2Y2JA 1MWRA 3ZCZA 4EQIA 2ZLYA 2XFTA 4OOLA 4ZBEA 1W79A 2P74A 5E2FA 2WUQA 4ZJ1A 3WRTA 1ESIA 4P6BA 3G4PA 1HZOA 4R4RA 3UO9A 4A5RA 3JYIA 5FA7A 5GHYA 3A3DA 3ZNTA 2VGJA 3BM6A 1E4DA 4U0TA 4EUZA 1GHIA 2EFUA 4WEJA 1TDLA 3Q7ZA 3GQZA 3M6HA 2OLUA 4IBXA 1FQGA 3IHBA 4EWFA 1XXMA 3LCEA 1YLYA 2ZMAA 3HL9A 2Y2QA 4GDBA 4KZ9A 4KZ8A 4RX2A 4BL3A 1TDGA 2Y2GA 5AQBA 2JCHA 3FZCA 5FAOA 3G35A 4E3JA 4N1HA 4RVAA 2J9OA 2H0TA 5L2FA 2XD5A 4GKUA 5GLBA 4N92A 3MKFA 1CI9A 4OQGA 3CG5A 4E3OA 4EBPA 1ES4A 3BLSA 1XA7A 5CHMA 4PMAA 2VGKA 3SH9A 1MWUA 1S0WA 2R9XA 3UE3A 1ALQA 5FQKA 1ZKJA 2Y2IA 2WGWA 1IYSA 1ZC2A 5GLCA 2XDMA 3V50A 1H5XA 2PU2A 1CI8A 1H8ZA 3N7WA 3SS5A 2V1ZA 4RX3A 5EPHA 4GD6A 5A90A 1LL5A 3BLMA 5FI2A 4ZJ3A 5EVIB 4OOYA 1XPBA 5E2EA 1NJ4A 1MKIA 1OMEA 5HL1A 2ZD8A 3A3IA 3G30A 4KZ5A 4RA7A 1IKIA 1FCNA 5JYPA 4LV3A 5FAQA 1JWPA 1YMXA 1BZAA 5F82A 2V2FF 3IWQA 1XA1A 3IF6A 1JTDA 3LY4A 2WKEA 5TR7A 2Q9MA 2RL3A 4MBHA 3V5MA 1YT4A 3QHYA 4Y0TA 4Y7PA 1RGYA 4KZ7A 5EOOA 5I94A 1ZG4A 3GMWA 1I2SA 5D3OA 1E3UA 5FQIA 4GZBA 5HAQA 3HUOA 5CGSA 2OLVA 1BSGA 4U3TA 1Q2PA 1LI9A 2E8IA 5DF9A 5E43A 3P09A 3M6BA 2EX9A 1IEMA 1KVMA 2XD1A 3E2KA 1SDNA 3ZVWA 3C4OA 5KSHA 5F83A 1N4OA 4OKPA 1VQQA 4LCLA 4QD4A 4B4ZA 3A3JA 3N4IA 3W8KA 1XX2A 3PBSA 1LHYA 4ZAMA 3HVFA 2ZC3B 3M2KA 3GTCA 3Q81A 4S2NC 2ZJ9A 4K91A 2HDQA 2WGVA 1BUEA 2A3UA 2XGNA 3HLGA 2FFYA 2H10A 3C4PA 1E25A 3EQUA 2EFXA 2ZQAA 4KZAA 3ZGAB 4JF6A 5DVAA 3VP3A 4KQQA 2Y2HA 3VMAA 5JYOA 2WGWB 1GA0A 3V3RA 4S2IA 1JWZA 5FQ9A 3IWOA 1K38A 3MXRA 3UE0A 4D2OA 4R23A 4KG2A 1W7FA 3BFGA 3BFCA 1BULA 1RGZA 1WE4A 1I5QA 4MLLA 2P9VA 5AQAA 5FASA 4BLMA 4BD1A 1JTGA 4PM9A 4X55A 4R3BA 1BT5A 4JXSA 2HDSA 1AXBA 1JWVA 3O87A 1N9BA 4S2KA 4MBFA 5CERA 1DJBA 3B3XA 4PM5A 1FOFA 4R1GA 3FV7A 1G68A 5CTMA 4WZ4A 1L0DA 1KDSA 4FSFA 3WS2A 4HBTA 3VOZA 5M19A 5FQQA 3WS4A 1KVLA 4OP5A 3VP1A 2HPBA 1L0FA 4PM6A 4E3LA 5U47A 2Y2MA 5HARA 3S22A 1KDWA 1QMEA 1RCJA 2XLNA 3IQAA 1O07A 4NK3A 5EE8A 4WZ5C 4LENA 5EVID 4DDYA 1KGGA 3IHAA 4R3JA 4GDNA 2PBYA 1FCMA 3O86A 3ZHHA 2GDNA 1U60A 1J9MA 1K54C 3Q07A 5HAIA 2EXAA 3BFEA 4K0WA 2HP5A 1L0GA 3OCNA 4OP8A 3SH8A 1DJCA 1PZPA 1K4FA 3LY3A 4E3IA 1PI4A 1MPLA 4IVKA 5EOEA 4E3NA 4HESA 3MZFA 1YLWA 4FD8A 4Y0UA 1PWDA 1YLJA 5DTKA 5M1AA 5A92A 3IH8A 5KSCA 3V39A 3OPLA 4BENA 4H8RA 1PYYA 3EQVA 3UPOA 4IVIA 5G18A 1Y54A 3Q1FA 4OLGA 4KG6A 3A3EA 4KENB 3DTMA 3S1YA 2P9VB 3VFHA 3CMZA 3ZDJA 2QZ6A 2Y2PA 5FQMA 4B88A 3IF5A 3N8LA 1EI5A 3UNWA 4C75A 1NZUA 2Y4AA 2Y2OA 4JXWA 3N8SA 4WZ5A 3TSGA 5CHJA 2WK0A 1ONGA 4UA7A 2XEPA 5DTTA 1ERQA 3IXGA 4FH2A 3OCLA 4GNUA 4ZTKA 2C5WB 3PBTA 3W4QA 3ZG5A 2J9PA 3W4PA 5HX9A 1K56A 1KGEA 1K54A 4Z9QA 4KZ4A 2X71A 1FSYA 1ONHA 1K6SA 3ZNYA 2BLSA 2HDUA 1PWGA 3OPRA 4L0LA 4UAAA 2EXBA 4N1XA 2IWBA 3OPPA 3FYZA 4KQRA 5AQ7A 1IYOA 3I7JA 1KGFA 4M3KA 5FI6A 4WMCA 4B4XA 3IT9A 4JXGA 3HLWA 4FCFA 5BOHA 2XH9A 4UA6A 3AGEA 4LV0A 1KE0A 4EV4A 1RP5A 2WZZA 3N8RA 5GLDA 5CEDA 4GOGA 3BFDA 2Y55A 1YLPA 2CC1A 3E2LA 3MBZA 3HLDA 2J7VA 1O7EA 5AQ9A 3VSLA 4F94A 3G2YA 5HAPA 1JVJA 1XP4A 4Q8IA 2JE5A 3NI9A 3VFFA 3BRMA 3OPHA 5CRFA 5GLAA 1CEGA 3G34A 4JLFA 3C5AA 5A91A 3RJUA 3BEBA 1SCWA 4WBGA 1DY6A 4S2JA 1E3UD 1K25A 1XGIA 1FR6A 1NRFA 2ZQ7A 3UDXA 3CJMA 5E2HA 3WS0A 4YFMA 3ZG8B 1BLPA 4ZJ2A 1FCOA 3HREA 3UPPA 2HP6A 3NDGA 3G32A 4N9KA 4OLDA 4WYYA 5CGXA 4XUXA 1CEFA 5GHZA 3OZHA 2IWCA 3TG9A 1I2WA 4QU3A 3NIAA 4QHCA 5F1FA 1BTLA 1PI5A 1W5DA 2HDRA 3ITBA 3QNBA 3WS5A 5FI7A 4KG5A 3S4XA 3VP4A 3LO7A 4P0MA 1PW8A 1K55C 1MBLA 5J8XA 2R9WA 1G6AA 1NXYA 3VP2A 5E2GA 5KZHA 1GA9A 4DDSA 1K6RA 5TFQA 2X01A 4C6YA 1LL9A 1NYYA 2BG1A 1EROA 3MKEA 4E6WA 5CHUA 4OQIA 4OQ0A 5DF8A 4DKIA 4R4SA 1YMSA 3AGDA 5EVLA 2A49A 4OOMA 4GN2A 1PWCA 1SKFA 4LCMA 3Q7VB 3UDFA 1L2SA 4PM7A 3IXHA 2ZM8A 1NZOA 3MZEA 4S2NA 1LI0A 4HEFA 3ISGA 5HW3A 2XQZA 1BLHA 4LV1A 1PZOA 2WADA 4LV2A 1YLZA 2ZC6B 5EECA 2Y59A 4KZBA 2Y2LA 1L0EA 2Z2MB 5KMWA 4OPQA 3D4FA 1VM1A 3BYDA 3IXDA 3O3VA 3GSGA 4WM9A 1KE3A 1IYQA 1NYMA 1MXOA 3UDIA 3ZG7B 1H8YA 2ZQCA 4MBKA 4DF6A 4S2PA 4DE0A 1K55A 2WAEA 4KQOA 1QMFA 3M2JA 3PAGA 4DE3A 1YQSA 3TOIA 4E6XA 4OVDA 3SH7A 1WYCA 5M18A 1XGJA 4ZDXA 3HBRA 4JKTA 4E3MA 3NDEA 3IF6C 3P98A 2G2WA 3VOYA 4DE1A 4BJPA 2I72A 4YINA 1ES2A 2OV5A 4BD0A 1GHMA 2Q9NA 3MZDA 4N9LA 1IYPA 3PBNA 4MNRA 2DRWA 2FFFB 4XUZA 4EBLA 3ZG9B 3PBQA 4JPMA 4PM8A 5FAPA 2WKIA 2OSUA 3DWZA 3Q82A 4HBUA 4OPRA 2J8YA 2XK1A 4X6TA 2QPNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GR2 A;  3FKW A;  4ID4 A;  3ITA A;  3IXB A;  2ZM2 A;  3GVB A;  2Y2N A;  3RXW A;  1TVF A;  1MWT A;  2Z2L B;  4O7D A;  4OPZ A;  2XF3 A;  3MFD A;  2DNS A;  3IWI A;  3WS1 A;  5GL9 A;  3HLC A;  2XFS A;  1KE4 A;  5GHX A;  1PIO A;  1IEL A;  3ZVT A;  3RXX A;  3C7V A;  4WEL A;  2ZM0 A;  2B5R A;  4DXC A;  4WEK A;  1M40 A;  3NCK A;  3HLF A;  4S2O A;  4UHU A;  1ES5 A;  3Q7V A;  4C3Q A;  4RYE A;  5EUA A;  1NY0 A;  3VP0 A;  2EX2 A;  2WYX A;  3A3F A;  3HUN A;  1WYB A;  3NY4 A;  4MEZ A;  5FDH A;  2DCF A;  4Y0O A;  4R0Q A;  4S2L A;  2UWX A;  2PU4 A;  5CEB A;  2RCX A;  5CTN A;  3G2Z A;  2JBF A;  4JXV A;  4E3K A;  4OON A;  3WWX A;  4X53 A;  3MXS A;  5HFO A;  2EX6 A;  4P87 A;  4QY5 A;  1HVB A;  1HTZ A;  1K57 C;  2ZC5 B;  4DRT A;  2ZQ8 A;  4QY6 A;  3SOI A;  2WKH A;  4KZ3 A;  4IBR A;  5DF7 A;  4BQM A;  3DW0 A;  4IED A;  4X69 A;  1FSW A;  2V20 A;  1GCE A;  4KZ6 A;  5FQJ A;  1TEM A;  4CJN A;  1LLB A;  1K56 D;  2WAF A;  3N6I A;  5EVI C;  2JC7 A;  4XXR A;  3WRZ A;  4X56 A;  3PAE A;  3PTE A;  1CK3 A;  2H5S A;  3OC2 A;  3CZD A;  4BL2 A;  1FR1 A;  1EWZ A;  1ZG6 A;  3LEZ A;  1Q2Q A;  1BLC A;  3V3S A;  4JF4 A;  3UY6 A;  2H0Y A;  2Y91 A;  3BFF A;  3IH9 A;  3HLB A;  2WZX A;  3NBL A;  4WMC D;  3HUM A;  1MY8 A;  4X68 A;  3AGF A;  3C7U A;  1GHP A;  3PBR A;  4FH4 A;  1K4E A;  1SHV A;  3BEC A;  2EX8 A;  3O88 A;  1W8Q A;  4OPY A;  5IHV A;  2ZQD A;  4NET A;  1W8Y A;  4P85 A;  3PBO A;  5FSR A;  3GRJ A;  4JF5 A;  4JBF A;  4GB7 A;  4GD8 A;  1IKG A;  1PW1 A;  3SS3 A;  1ERM A;  2WGI A;  1ESU A;  3GV9 A;  3NC8 A;  5CGW A;  4UA9 A;  4QJG A;  3FWL A;  1K57 A;  1YM1 A;  4OQH A;  4S2M A;  3SS4 A;  3UPN A;  3ZG0 A;  3ZFZ A;  1DJA A;  2XR0 A;  4DE2 A;  5CEC A;  3G31 A;  4U0X A;  5A93 A;  1Z6F A;  5CXW A;  3FKV A;  5FAT A;  1SDE A;  2HP9 A;  3VSK A;  5DTS A;  3HLE A;  2X02 A;  5EVI A;  4DXB A;  1C3B A;  2ZC7 A;  4K0X A;  1S6R A;  4PPR A;  3UN7 A;  2IWD A;  3QNC A;  4CPK A;  2ZQ9 A;  4OH0 A;  1M6K A;  1YLT A;  2Y2K A;  1XKZ A;  3DWK A;  2C6W B;  1BLS A;  2ZC4 B;  2G2U A;  3IF6 B;  4QB8 A;  3UE1 A;  5TGF A;  1HD8 A;  1ES3 A;  1MWS A;  5F1G A;  2QMI A;  4EBN A;  3W4O A;  2Y2J A;  1MWR A;  3ZCZ A;  4EQI A;  2ZLY A;  2XFT A;  4OOL A;  4ZBE A;  1W79 A;  2P74 A;  5E2F A;  2WUQ A;  4ZJ1 A;  3WRT A;  1ESI A;  4P6B A;  3G4P A;  1HZO A;  4R4R A;  3UO9 A;  4A5R A;  3JYI A;  5FA7 A;  5GHY A;  3A3D A;  3ZNT A;  2VGJ A;  3BM6 A;  1E4D A;  4U0T A;  4EUZ A;  1GHI A;  2EFU A;  4WEJ A;  1TDL A;  3Q7Z A;  3GQZ A;  3M6H A;  2OLU A;  4IBX A;  1FQG A;  3IHB A;  4EWF A;  1XXM A;  3LCE A;  1YLY A;  2ZMA A;  3HL9 A;  2Y2Q A;  4GDB A;  4KZ9 A;  4KZ8 A;  4RX2 A;  4BL3 A;  1TDG A;  2Y2G A;  5AQB A;  2JCH A;  3FZC A;  5FAO A;  3G35 A;  4E3J A;  4N1H A;  4RVA A;  2J9O A;  2H0T A;  5L2F A;  2XD5 A;  4GKU A;  5GLB A;  4N92 A;  3MKF A;  1CI9 A;  4OQG A;  3CG5 A;  4E3O A;  4EBP A;  1ES4 A;  3BLS A;  1XA7 A;  5CHM A;  4PMA A;  2VGK A;  3SH9 A;  1MWU A;  1S0W A;  2R9X A;  3UE3 A;  1ALQ A;  5FQK A;  1ZKJ A;  2Y2I A;  2WGW A;  1IYS A;  1ZC2 A;  5GLC A;  2XDM A;  3V50 A;  1H5X A;  2PU2 A;  1CI8 A;  1H8Z A;  3N7W A;  3SS5 A;  2V1Z A;  4RX3 A;  5EPH A;  4GD6 A;  5A90 A;  1LL5 A;  3BLM A;  5FI2 A;  4ZJ3 A;  5EVI B;  4OOY A;  1XPB A;  5E2E A;  1NJ4 A;  1MKI A;  1OME A;  5HL1 A;  2ZD8 A;  3A3I A;  3G30 A;  4KZ5 A;  4RA7 A;  1IKI A;  1FCN A;  5JYP A;  4LV3 A;  5FAQ A;  1JWP A;  1YMX A;  1BZA A;  5F82 A;  2V2F F;  3IWQ A;  1XA1 A;  3IF6 A;  1JTD A;  3LY4 A;  2WKE A;  5TR7 A;  2Q9M A;  2RL3 A;  4MBH A;  3V5M A;  1YT4 A;  3QHY A;  4Y0T A;  4Y7P A;  1RGY A;  4KZ7 A;  5EOO A;  5I94 A;  1ZG4 A;  3GMW A;  1I2S A;  5D3O A;  1E3U A;  5FQI A;  4GZB A;  5HAQ A;  3HUO A;  5CGS A;  2OLV A;  1BSG A;  4U3T A;  1Q2P A;  1LI9 A;  2E8I A;  5DF9 A;  5E43 A;  3P09 A;  3M6B A;  2EX9 A;  1IEM A;  1KVM A;  2XD1 A;  3E2K A;  1SDN A;  3ZVW A;  3C4O A;  5KSH A;  5F83 A;  1N4O A;  4OKP A;  1VQQ A;  4LCL A;  4QD4 A;  4B4Z A;  3A3J A;  3N4I A;  3W8K A;  1XX2 A;  3PBS A;  1LHY A;  4ZAM A;  3HVF A;  2ZC3 B;  3M2K A;  3GTC A;  3Q81 A;  4S2N C;  2ZJ9 A;  4K91 A;  2HDQ A;  2WGV A;  1BUE A;  2A3U A;  2XGN A;  3HLG A;  2FFY A;  2H10 A;  3C4P A;  1E25 A;  3EQU A;  2EFX A;  2ZQA A;  4KZA A;  3ZGA B;  4JF6 A;  5DVA A;  3VP3 A;  4KQQ A;  2Y2H A;  3VMA A;  5JYO A;  2WGW B;  1GA0 A;  3V3R A;  4S2I A;  1JWZ A;  5FQ9 A;  3IWO A;  1K38 A;  3MXR A;  3UE0 A;  4D2O A;  4R23 A;  4KG2 A;  1W7F A;  3BFG A;  3BFC A;  1BUL A;  1RGZ A;  1WE4 A;  1I5Q A;  4MLL A;  2P9V A;  5AQA A;  5FAS A;  4BLM A;  4BD1 A;  1JTG A;  4PM9 A;  4X55 A;  4R3B A;  1BT5 A;  4JXS A;  2HDS A;  1AXB A;  1JWV A;  3O87 A;  1N9B A;  4S2K A;  4MBF A;  5CER A;  1DJB A;  3B3X A;  4PM5 A;  1FOF A;  4R1G A;  3FV7 A;  1G68 A;  5CTM A;  4WZ4 A;  1L0D A;  1KDS A;  4FSF A;  3WS2 A;  4HBT A;  3VOZ A;  5M19 A;  5FQQ A;  3WS4 A;  1KVL A;  4OP5 A;  3VP1 A;  2HPB A;  1L0F A;  4PM6 A;  4E3L A;  5U47 A;  2Y2M A;  5HAR A;  3S22 A;  1KDW A;  1QME A;  1RCJ A;  2XLN A;  3IQA A;  1O07 A;  4NK3 A;  5EE8 A;  4WZ5 C;  4LEN A;  5EVI D;  4DDY A;  1KGG A;  3IHA A;  4R3J A;  4GDN A;  2PBY A;  1FCM A;  3O86 A;  3ZHH A;  2GDN A;  1U60 A;  1J9M A;  1K54 C;  3Q07 A;  5HAI A;  2EXA A;  3BFE A;  4K0W A;  2HP5 A;  1L0G A;  3OCN A;  4OP8 A;  3SH8 A;  1DJC A;  1PZP A;  1K4F A;  3LY3 A;  4E3I A;  1PI4 A;  1MPL A;  4IVK A;  5EOE A;  4E3N A;  4HES A;  3MZF A;  1YLW A;  4FD8 A;  4Y0U A;  1PWD A;  1YLJ A;  5DTK A;  5M1A A;  5A92 A;  3IH8 A;  5KSC A;  3V39 A;  3OPL A;  4BEN A;  4H8R A;  1PYY A;  3EQV A;  3UPO A;  4IVI A;  5G18 A;  1Y54 A;  3Q1F A;  4OLG A;  4KG6 A;  3A3E A;  4KEN B;  3DTM A;  3S1Y A;  2P9V B;  3VFH A;  3CMZ A;  3ZDJ A;  2QZ6 A;  2Y2P A;  5FQM A;  4B88 A;  3IF5 A;  3N8L A;  1EI5 A;  3UNW A;  4C75 A;  1NZU A;  2Y4A A;  2Y2O A;  4JXW A;  3N8S A;  4WZ5 A;  3TSG A;  5CHJ A;  2WK0 A;  1ONG A;  4UA7 A;  2XEP A;  5DTT A;  1ERQ A;  3IXG A;  4FH2 A;  3OCL A;  4GNU A;  4ZTK A;  2C5W B;  3PBT A;  3W4Q A;  3ZG5 A;  2J9P A;  3W4P A;  5HX9 A;  1K56 A;  1KGE A;  1K54 A;  4Z9Q A;  4KZ4 A;  2X71 A;  1FSY A;  1ONH A;  1K6S A;  3ZNY A;  2BLS A;  2HDU A;  1PWG A;  3OPR A;  4L0L A;  4UAA A;  2EXB A;  4N1X A;  2IWB A;  3OPP A;  3FYZ A;  4KQR A;  5AQ7 A;  1IYO A;  3I7J A;  1KGF A;  4M3K A;  5FI6 A;  4WMC A;  4B4X A;  3IT9 A;  4JXG A;  3HLW A;  4FCF A;  5BOH A;  2XH9 A;  4UA6 A;  3AGE A;  4LV0 A;  1KE0 A;  4EV4 A;  1RP5 A;  2WZZ A;  3N8R A;  5GLD A;  5CED A;  4GOG A;  3BFD A;  2Y55 A;  1YLP A;  2CC1 A;  3E2L A;  3MBZ A;  3HLD A;  2J7V A;  1O7E A;  5AQ9 A;  3VSL A;  4F94 A;  3G2Y A;  5HAP A;  1JVJ A;  1XP4 A;  4Q8I A;  2JE5 A;  3NI9 A;  3VFF A;  3BRM A;  3OPH A;  5CRF A;  5GLA A;  1CEG A;  3G34 A;  4JLF A;  3C5A A;  5A91 A;  3RJU A;  3BEB A;  1SCW A;  4WBG A;  1DY6 A;  4S2J A;  1E3U D;  1K25 A;  1XGI A;  1FR6 A;  1NRF A;  2ZQ7 A;  3UDX A;  3CJM A;  5E2H A;  3WS0 A;  4YFM A;  3ZG8 B;  1BLP A;  4ZJ2 A;  1FCO A;  3HRE A;  3UPP A;  2HP6 A;  3NDG A;  3G32 A;  4N9K A;  4OLD A;  4WYY A;  5CGX A;  4XUX A;  1CEF A;  5GHZ A;  3OZH A;  2IWC A;  3TG9 A;  1I2W A;  4QU3 A;  3NIA A;  4QHC A;  5F1F A;  1BTL A;  1PI5 A;  1W5D A;  2HDR A;  3ITB A;  3QNB A;  3WS5 A;  5FI7 A;  4KG5 A;  3S4X A;  3VP4 A;  3LO7 A;  4P0M A;  1PW8 A;  1K55 C;  1MBL A;  5J8X A;  2R9W A;  1G6A A;  1NXY A;  3VP2 A;  5E2G A;  5KZH A;  1GA9 A;  4DDS A;  1K6R A;  5TFQ A;  2X01 A;  4C6Y A;  1LL9 A;  1NYY A;  2BG1 A;  1ERO A;  3MKE A;  4E6W A;  5CHU A;  4OQI A;  4OQ0 A;  5DF8 A;  4DKI A;  4R4S A;  1YMS A;  3AGD A;  5EVL A;  2A49 A;  4OOM A;  4GN2 A;  1PWC A;  1SKF A;  4LCM A;  3Q7V B;  3UDF A;  1L2S A;  4PM7 A;  3IXH A;  2ZM8 A;  1NZO A;  3MZE A;  4S2N A;  1LI0 A;  4HEF A;  3ISG A;  5HW3 A;  2XQZ A;  1BLH A;  4LV1 A;  1PZO A;  2WAD A;  4LV2 A;  1YLZ A;  2ZC6 B;  5EEC A;  2Y59 A;  4KZB A;  2Y2L A;  1L0E A;  2Z2M B;  5KMW A;  4OPQ A;  3D4F A;  1VM1 A;  3BYD A;  3IXD A;  3O3V A;  3GSG A;  4WM9 A;  1KE3 A;  1IYQ A;  1NYM A;  1MXO A;  3UDI A;  3ZG7 B;  1H8Y A;  2ZQC A;  4MBK A;  4DF6 A;  4S2P A;  4DE0 A;  1K55 A;  2WAE A;  4KQO A;  1QMF A;  3M2J A;  3PAG A;  4DE3 A;  1YQS A;  3TOI A;  4E6X A;  4OVD A;  3SH7 A;  1WYC A;  5M18 A;  1XGJ A;  4ZDX A;  3HBR A;  4JKT A;  4E3M A;  3NDE A;  3IF6 C;  3P98 A;  2G2W A;  3VOY A;  4DE1 A;  4BJP A;  2I72 A;  4YIN A;  1ES2 A;  2OV5 A;  4BD0 A;  1GHM A;  2Q9N A;  3MZD A;  4N9L A;  1IYP A;  3PBN A;  4MNR A;  2DRW A;  2FFF B;  4XUZ A;  4EBL A;  3ZG9 B;  3PBQ A;  4JPM A;  4PM8 A;  5FAP A;  2WKI A;  2OSU A;  3DWZ A;  3Q82 A;  4HBU A;  4OPR A;  2J8Y A;  2XK1 A;  4X6T A;  2QPN A; 
#chains in the Genus database with same CATH topology
 1VET B;  2ZMV A;  3CIT A;  2Y2N A;  2Z2L B;  4OPZ A;  2DNS A;  3IWI A;  4QWO A;  1KE4 A;  4LRX C;  4WEL A;  2ZM0 A;  3ZQ5 A;  3NCK A;  3HLF A;  3Q7V A;  2WYX A;  5FDH A;  4Z1W A;  4I5S A;  4R0Q A;  5DFY A;  3SW1 A;  4JXV A;  2V1A A;  2P7J A;  4P87 A;  4QY5 A;  1HTZ A;  1BYW A;  3SOI A;  2WKH A;  5EV0 A;  2VLG A;  3FG8 A;  4PHT A;  4IED A;  5MC7 A;  5FQJ A;  2W1T A;  5HD3 A;  2V0W A;  3U4L P;  3WRZ A;  1T19 A;  3PTE A;  3OC2 A;  3CZD A;  3UY6 A;  1TF1 A;  1A0K A;  3HLB A;  2WZX A;  3EEA A;  3NHQ A;  1SHV A;  3C38 A;  2EX8 A;  4UQI M;  4M4X A;  3MQO A;  5IHV A;  1AWI A;  1W8Y A;  3GRJ A;  2GNX A;  1GSX A;  1ESU A;  2BAS A;  4S2M A;  3SS4 A;  4UQI S;  4DE2 A;  3G31 A;  5A93 A;  1Z6F A;  5CXW A;  5DTS A;  2X02 A;  2V8C A;  3T4L A;  3BQ8 A;  3QNC A;  3T4K A;  2ZQ9 A;  3IX8 A;  4OH0 A;  2Y2K A;  3IF6 B;  4HQA A;  1BLS A;  2D01 A;  1HD8 A;  2ACG A;  2Y2J A;  2XFT A;  4OOL A;  4ZBE A;  1W79 A;  3WRT A;  4CQH A;  1ESI A;  4P6B A;  1HZO A;  4MCW A;  3JYI A;  3OLO A;  2VGJ A;  3BM6 A;  4I39 A;  4EUZ A;  3E4Q A;  1TDL A;  2YKF A;  3Q7Z A;  3M6H A;  2OLU A;  3IHB A;  4BL3 A;  4KZ8 A;  2Y2Q A;  2A24 B;  1TDG A;  4WL9 A;  3CI6 A;  5AQB A;  2W0N A;  4EEP A;  3KSF A;  2J9O A;  2GJ3 A;  1CI9 A;  4E3O A;  3CG5 A;  1ES4 A;  1MWU A;  2R9X A;  1ZC2 A;  2XDM A;  1H5X A;  1CI8 A;  4F3L A;  2J3W A;  3MQQ A;  2B18 A;  5A90 A;  3T1Q B;  5EVI B;  4MDZ A;  1ACF A;  5HL1 A;  4RA7 A;  2J3T C;  5JYP A;  5FAQ A;  2O99 A;  2V2F F;  2WKE A;  4JGR A;  4MBH A;  3V5M A;  4NXE A;  4Y0T A;  2PR5 A;  4NG2 A;  1LSX A;  1T1B A;  4U3T A;  2E8I A;  5DF9 A;  2PYR A;  2HV1 A;  3D72 A;  2ZMF A;  3ZVW A;  4QD4 A;  2YKH A;  5K5B A;  4ZAM A;  2ZC3 B;  3M2K A;  3Q81 A;  5FDS A;  1LSV A;  2EFX A;  3ZGA B;  4KQQ A;  5JYO A;  2WGW B;  3JPU A;  5FQ9 A;  3H7W A;  2GZA A;  3BFG A;  1BUL A;  4B93 A;  1WE4 A;  1H8M A;  4BLM A;  3A0V A;  4PM9 A;  2HDS A;  1AXB A;  2I9V A;  3O87 A;  1N9B A;  3SZT A;  4MBF A;  1G68 A;  1J3W A;  3F1O A;  1L0D A;  3PR6 A;  3BY9 A;  5FQQ A;  3R7W B;  4HNB A;  3LYX A;  5HWV A;  4ETX A;  3MMH A;  1QME A;  4NK3 A;  4WZ5 C;  1VEU B;  3ZHH A;  2GDN A;  3F1P A;  1J9M A;  5HZH A;  1K54 C;  3PYP A;  3Q07 A;  3BFE A;  4OP8 A;  1K4F A;  4BBT A;  3E98 A;  1L3L A;  1YLW A;  4K08 A;  1YLJ A;  5KSC A;  5C5K A;  3KSG A;  4H8R A;  3EQV A;  3VE4 A;  5G18 A;  1Y54 A;  3Q1F A;  4OLG A;  3NUL A;  5HSQ A;  3T4S A;  2V0U A;  3RFB A;  4I38 A;  3VFH A;  3ZDJ A;  1CJF A;  2WK0 A;  3L9K A;  1FIL A;  4FH2 A;  3OCL A;  2VX8 A;  3PBT A;  1W63 M;  1G5U A;  3W4P A;  5DFX A;  1KGE A;  4Z9Q A;  1PWG A;  2EXB A;  4N1X A;  3OPP A;  5G4Y A;  4GHI B;  3P7N A;  3LGO A;  5FI6 A;  4B4X A;  4FCF A;  4Q0H A;  4EV4 A;  1RP5 A;  3MBZ A;  2CC1 A;  2J7V A;  3ULF A;  3G2Y A;  1JVJ A;  2V9A A;  1TS6 A;  5CRF A;  5GLA A;  2ZL1 A;  4CLC B;  3C5A A;  5A91 A;  5A8B A;  1SCW A;  4WBG A;  3QP2 A;  5L8M A;  1K25 A;  1FR6 A;  5AVF A;  2PD7 A;  3NDG A;  3E4P A;  4WYY A;  4OLD A;  1CEF A;  2Y8H A;  3TG9 A;  1I2W A;  2W1R A;  4QU3 A;  4QHC A;  3QNB A;  3ITB A;  3UMD A;  4I3A A;  4HI4 A;  4P0M A;  1MBL A;  1G6A A;  2O0Y A;  4NXG A;  1NXY A;  5KZH A;  4PKY A;  1GA9 A;  2X01 A;  3EGD C;  1NYY A;  2KLI A;  5DF8 A;  4OQ0 A;  2PDR A;  3IX4 A;  1MC0 A;  3JVU A;  2A49 A;  4OOM A;  3Q7V B;  4PM7 A;  2W3F A;  4HEF A;  1NLZ A;  5HW3 A;  3GDI A;  4LV1 A;  2WAD A;  2ZC6 B;  2W3D A;  1VM1 A;  3O3V A;  5CX7 A;  3GSG A;  1OTI A;  4YNR A;  3T4Q A;  3KYE A;  4DE0 A;  4DJ3 A;  2W1T B;  1QMF A;  3LEQ A;  4DE3 A;  5HWW A;  3TOI A;  3SH7 A;  4Y13 A;  1OT6 A;  1WYC A;  5M18 A;  1OTE A;  2G2W A;  4BJP A;  1S4R A;  1ES2 A;  3MZD A;  3DWZ A;  3Q82 A;  3UB6 A;  2JKF A;  4X6T A;  3GR2 A;  4ID4 A;  3ITA A;  3T4O A;  3GVB A;  1TVF A;  1MWT A;  4O7D A;  3WS1 A;  3K2N A;  3MFD A;  5GHX A;  5G4Z A;  3RXX A;  3C7V A;  4HOI A;  3VV4 A;  4ESP A;  4S2O A;  4RYE A;  1NY0 A;  2EX2 A;  1KOU A;  4S2L A;  2UWX A;  4IJG A;  3WWX A;  4X25 A;  2K2N A;  1IOU A;  1HVB A;  4DRT A;  2ZQ8 A;  2P04 A;  3HCY A;  4KZ3 A;  4IBR A;  4HP4 A;  3DW0 A;  4HJ4 A;  4X69 A;  2V20 A;  1GCE A;  5F68 A;  4I3I A;  2H5S A;  4BL2 A;  1ZG6 A;  3LEZ A;  1Q2Q A;  2L1M A;  1BLC A;  4MN5 A;  2H0Y A;  2PRF A;  1SZV A;  5FEF A;  2WKQ A;  4HP9 A;  1GHP A;  3IS2 A;  5FSR A;  4JBF A;  1F98 A;  4GD8 A;  1PW1 A;  1IKG A;  5HD5 A;  4QJG A;  5CGW A;  4UA9 A;  3FWL A;  1K57 A;  4OQH A;  5HDC A;  4F3L B;  2XR0 A;  2WKR A;  4U0X A;  2VZW A;  4BMW A;  1SDE A;  2HP9 A;  3HLE A;  1D7E A;  4Y15 A;  4II7 A;  1XKZ A;  3DWK A;  4QB8 A;  4MN6 A;  1MWS A;  3O5Y A;  3BJN A;  3RH8 B;  4EBN A;  2ZLY A;  2P74 A;  2VJW A;  4ZJ1 A;  3KSH A;  3A3D A;  3ZNT A;  3LUQ A;  2M1C A;  1GHI A;  2ZBB A;  3GQZ A;  4IBX A;  3F1N A;  1XXM A;  2XSS A;  1YLY A;  2JKG A;  3HL9 A;  3K3C A;  3G35 A;  3KO6 A;  2VK3 A;  2H0T A;  1H3Q A;  1UWP X;  4GKU A;  3EGX C;  4LRZ E;  5CHM A;  3P01 A;  3MF0 A;  3UE3 A;  1ZKJ A;  4WLA A;  3V50 A;  4L9E A;  2PU2 A;  3H7W B;  1H8Z A;  3N7W A;  3PXP A;  5EPH A;  1LL5 A;  3CUE A;  1NJ4 A;  3G30 A;  4G3V A;  2W3H A;  3D3O A;  4LV3 A;  4HH2 A;  1JWP A;  3LY4 A;  3F1O B;  3LR0 A;  3QHY A;  4Y7P A;  1S1Z A;  1RGY A;  3UB9 A;  5EOO A;  4EER A;  4Q0J A;  5D3O A;  5J7E A;  1E3U A;  5FQI A;  2OLV A;  3FC7 A;  3KX0 X;  1LI9 A;  5E43 A;  3P09 A;  2OOL A;  2Q0O A;  3T12 B;  4X1M A;  2VKS A;  1N4O A;  4OKP A;  3F1P B;  3W8K A;  1LHY A;  2ZJ9 A;  4EU0 A;  3HLG A;  3C4P A;  1SKO A;  3QP5 A;  3VMA A;  4JGP A;  3NOU C;  3IWO A;  1K38 A;  3UE0 A;  4R23 A;  1OTD A;  1RGZ A;  4MLL A;  4X55 A;  1BT5 A;  4JXS A;  1JWV A;  5CER A;  2QWS A;  4R1G A;  2V1B A;  3C30 A;  3MFX A;  4OP5 A;  4PM6 A;  4E3L A;  5J3W A;  5HAR A;  3T50 A;  3S22 A;  1RCJ A;  1O07 A;  3KYZ A;  5EE8 A;  1OTB A;  2PBY A;  2EXA A;  1DJC A;  1PI4 A;  2ZL1 B;  1MPL A;  3DAV A;  3MZF A;  4Y0U A;  1PWD A;  3IH8 A;  1NLY A;  3OPL A;  4BEN A;  2JKT M;  1PYY A;  4JGO A;  1UWN X;  5I5L A;  1N9N A;  3R4K A;  2P9V B;  2QZ6 A;  2D02 A;  5HL6 A;  1OT9 A;  5EVE A;  4JXW A;  4IUK A;  4UA7 A;  1ONG A;  3IXG A;  2DMW A;  4KUK A;  1VHM A;  1PRQ A;  2J9P A;  3T4T A;  5HX9 A;  1K56 A;  4ARZ A;  1FSY A;  1K0K A;  2HDU A;  3OPR A;  4UAA A;  5DKL A;  2OAP 1;  1IYO A;  1KGF A;  4WMC A;  3W2Z A;  4JXG A;  5BOH A;  3AGE A;  5CED A;  3N8R A;  3BFD A;  5L07 A;  5AQ9 A;  4Q8I A;  2JE5 A;  3NI9 A;  3BRM A;  3OPH A;  3G34 A;  2HJE A;  3UB7 A;  3EWK A;  1E3U D;  1XGI A;  3UDX A;  3CJM A;  2HGV A;  3WS0 A;  4YFM A;  3ZG8 B;  4ZJ2 A;  1FCO A;  3HRE A;  5CGX A;  1XFN A;  2K31 A;  4R38 A;  5F1F A;  2HDR A;  5FI7 A;  3S4X A;  2M7U A;  5J8X A;  2XRN A;  1K6R A;  4I3J A;  4PAU A;  1YMS A;  5F69 A;  4LPZ A;  5EVL A;  4GN2 A;  4LCM A;  1NRJ A;  1L2S A;  2ZM8 A;  2Z6D A;  2XQZ A;  1W63 Q;  1PZO A;  5EEC A;  1OPX A;  2VGL S;  3BYD A;  1KE3 A;  5EFW A;  1IYQ A;  1NYM A;  1MXO A;  3UDI A;  3ZG7 B;  2WAE A;  1OJG A;  4E6X A;  4OVD A;  1WA9 A;  3NDE A;  3P98 A;  3VOY A;  4DE1 A;  2XA7 M;  2I72 A;  2OV5 A;  1GHM A;  2NUP C;  3OOV A;  3PBN A;  4MNR A;  2FFF B;  4EBL A;  2B95 A;  3ZG9 B;  3K3D A;  4JPM A;  2R78 A;  5FAP A;  2WKI A;  1HLU P;  2OSU A;  4GS9 A;  2KDK A;  4WF0 A;  2XA7 S;  3FKW A;  3IS2 B;  2ZM2 A;  3HLC A;  2XFS A;  3ZVT A;  3LR3 A;  2B5R A;  4DXC A;  3LR5 A;  4WEK A;  4UHU A;  2LB5 A;  5EUA A;  4ZRR A;  3A3F A;  3VP0 A;  4MEZ A;  2DCF A;  2PU4 A;  3G2Z A;  3LFV A;  4LGW A;  2PAV P;  1Y28 A;  1EW0 A;  1K57 C;  2HJ9 C;  2ZC5 B;  4LLO B;  2PBD P;  3EOI A;  3OBF A;  5HWT A;  3ICY A;  3BWL A;  1FSW A;  4Y5F A;  1TEM A;  4CJN A;  1K56 D;  3CWF A;  3N6I A;  4HY8 A;  4XXR A;  4X56 A;  3VOL A;  3PAE A;  3S7O A;  1EWZ A;  3V3S A;  3F1N B;  5IS1 A;  3NBL A;  4WMC D;  5DKK A;  1MY8 A;  4X68 A;  3C7U A;  3BEC A;  1W8Q A;  4OPY A;  4NET A;  5L09 A;  1DP9 A;  4GB7 A;  1ERM A;  2WGI A;  1YM1 A;  3UPN A;  3D9Y A;  2O9B A;  3ZFZ A;  5CEC A;  3DTE A;  3GEC A;  5EVI A;  3S7N A;  2ZC7 A;  1S6R A;  4KUO A;  4PPR A;  3DTI A;  1STZ A;  2LB9 A;  3LR4 A;  4CPK A;  1M6K A;  1YLT A;  2C6W B;  3UE1 A;  5TGF A;  2OAQ 1;  1ES3 A;  4Y3I A;  3W4O A;  1MWR A;  4BWI A;  3LI8 A;  5E2F A;  2OWJ A;  3UO9 A;  3CUE C;  4R4R A;  5FA7 A;  5GHY A;  3RTY A;  4U0T A;  2EFU A;  3CAX A;  4QPR A;  1FQG A;  3LCE A;  4RX2 A;  4KZ9 A;  4GDB A;  3UME A;  2Y2G A;  4PKY G;  5FAO A;  3IBR A;  4E3J A;  4AFI A;  2VA0 A;  4N1H A;  4RVA A;  2E8J A;  1TS8 A;  1DRM A;  2XD5 A;  5GLB A;  2VGK A;  3SH9 A;  3NEC A;  5IT5 A;  1S0W A;  1SKO B;  1ALQ A;  5FQK A;  2WGW A;  4XT2 A;  1XJ6 A;  3BLM A;  5FI2 A;  4ZJ3 A;  4NEE D;  4OOY A;  1XPB A;  4UEY A;  1OME A;  2ZD8 A;  3A3I A;  1F5M A;  1IKI A;  1FCN A;  5F82 A;  3IWQ A;  3BQA A;  5TR7 A;  2RL3 A;  4EUV A;  1S4S A;  2QJ7 A;  4KQD A;  1JNU A;  4EES A;  1CF0 A;  4P6Z M;  4GZB A;  2W3G A;  3HUO A;  5CGS A;  3A0S A;  2VEA A;  2CMN A;  2EX9 A;  1IEM A;  1KVM A;  2XD1 A;  1D06 A;  1SDN A;  4P6Z S;  5KSH A;  5F83 A;  2VV7 A;  1VQQ A;  4LCL A;  3A3J A;  1XX2 A;  2QHK A;  3PBS A;  3HVF A;  3NOT C;  3MJQ A;  3GTC A;  4K91 A;  2WGV A;  2P08 A;  2FFY A;  2H10 A;  3BY8 A;  3EQU A;  4KZA A;  5DVA A;  5L10 A;  3VP3 A;  3V3R A;  1JWZ A;  4D2O A;  3MXR A;  4KG2 A;  1I5Q A;  3U2A A;  2QJ5 A;  5AQA A;  5FAS A;  1VB6 A;  4YWZ A;  4DJ2 A;  1DJB A;  3B3X A;  4GCZ A;  4PM5 A;  4GW9 A;  3DBA A;  4R3A A;  4FSF A;  2W27 A;  1LL8 A;  1L0F A;  2HPB A;  5U47 A;  2OWH A;  4IHQ A;  1KDW A;  2L0W A;  2W3E A;  5EVI D;  4DDY A;  1KGG A;  3IHA A;  4R3J A;  1FCM A;  3O86 A;  3JVV A;  1U60 A;  2PR6 A;  1YSP A;  5HAI A;  2JKT I;  4K0W A;  2HP5 A;  2O9C A;  1L0G A;  2Z6C A;  3LY3 A;  4E3I A;  4E3N A;  4HES A;  4FD8 A;  5DTK A;  5A92 A;  5M1A A;  2B02 A;  2WKP A;  5KIZ A;  4GJ4 A;  3TW8 A;  4IVI A;  4KG6 A;  3A3E A;  3LID A;  3CMZ A;  4EW7 A;  5FQM A;  2Y2P A;  1EI5 A;  1NZU A;  3N8S A;  3TSG A;  5CHJ A;  3H82 A;  2XEP A;  1ERQ A;  4E04 A;  4O8G A;  2JN7 A;  2C5W B;  3W4Q A;  1ZTU A;  3LIF A;  2X71 A;  1K6S A;  3T1R A;  2BLS A;  4L0L A;  4H6J A;  3FYZ A;  2HZ5 A;  5AQ7 A;  5HPF A;  3C2W A;  3IT9 A;  2XH9 A;  5IU1 A;  4LV0 A;  1KE0 A;  4HJ6 A;  1YLP A;  3E2L A;  3VSL A;  1ZHH B;  2JKR M;  3NJA A;  5HAP A;  1XP4 A;  3CLO A;  4HJ3 A;  1FIK A;  4WN5 A;  1CEG A;  2NUT C;  4JLF A;  3BEB A;  3LIE A;  4DN0 A;  4S2J A;  1GSW A;  3UPP A;  2HP6 A;  3G32 A;  4N9K A;  4XUX A;  3OZH A;  3NIA A;  1OTA A;  2MJ6 A;  2QKP A;  4KG5 A;  1MKM A;  4GS9 B;  2V8F A;  1PW8 A;  4HHD A;  3VP2 A;  4DDS A;  3S7Q A;  1D1J A;  3LIA A;  5TFQ A;  4C6Y A;  1LL9 A;  4E6W A;  1N9L A;  5CHU A;  5TBM A;  2KOI A;  4DKI A;  3LI9 A;  4R4S A;  3AGD A;  5LBR A;  3LIC A;  1SKF A;  2QYB A;  1S67 L;  3UDF A;  2K7S A;  3IXH A;  1LI0 A;  3ISG A;  2EWW A;  2INW A;  4BBV A;  1YLZ A;  2EWV A;  2Y2L A;  2Z2M B;  3ZYT A;  5KMW A;  2O9A A;  1V9Y A;  4LFU A;  4MMN A;  5HPI A;  1H8Y A;  2ZQC A;  4MBK A;  1K55 A;  4KQO A;  3M2J A;  3PAG A;  3CPT A;  1DP8 A;  4EXO A;  2ZOH A;  3HBR A;  4ZDX A;  3S7P A;  4E3M A;  3IF6 C;  4G3K A;  3KYQ A;  4FUW A;  3QP1 A;  2Q9N A;  1IYP A;  4FTX A;  4XUZ A;  2DRW A;  3PBQ A;  4ME4 A;  2XRO A;  1P9W A;  4OPR A;  2J8Y A;  2XK1 A;  2QPN A;  3IXB A;  3RXW A;  3MS6 A;  2XF3 A;  2JHE A;  4CLC D;  5GL9 A;  1MZU A;  1H0M A;  1PIO A;  1IEL A;  4HIA A;  5TJJ A;  3CHW P;  3EEH A;  1M40 A;  1ES5 A;  4C3Q A;  1Y4O A;  3NY4 A;  3HUN A;  1WYB A;  2UV0 E;  4Y0O A;  4X1L A;  5CEB A;  2RCX A;  5CTN A;  2JBF A;  4E3K A;  4OON A;  4X53 A;  3MXS A;  5HFO A;  2EX6 A;  4Y17 A;  3V67 A;  2GX5 A;  3FPW A;  4QY6 A;  5DF7 A;  4BQM A;  4KZ6 A;  2VV8 A;  1LLB A;  5EVI C;  2WAF A;  2JC7 A;  1CK3 A;  2PYP A;  4RQ9 A;  1FR1 A;  3VE3 A;  4JF4 A;  2Y91 A;  3BFF A;  3IH9 A;  4Y2F A;  3HUM A;  4R6L A;  3AGF A;  3PBR A;  4FH4 A;  1K4E A;  3O88 A;  2ZQD A;  2BTF P;  1VET A;  4P85 A;  3PBO A;  1P97 A;  3T1S A;  4JF5 A;  1G6O A;  3SS3 A;  3GV9 A;  3NC8 A;  4Q0I A;  3ZG0 A;  1DJA A;  2VGL M;  4XT2 B;  3FKV A;  5FAT A;  3VSK A;  4DXB A;  3T1X A;  1C3B A;  4K0X A;  4FOF A;  3UN7 A;  2IWD A;  5F5Y A;  3TRC A;  4NKP A;  1GSV A;  2ZC4 B;  2G2U A;  3MXQ A;  4JGQ A;  5F1G A;  2QMI A;  1XJ4 A;  4EQI A;  3ZCZ A;  5AVE A;  4WUJ A;  2WUQ A;  1TS0 A;  3G4P A;  4A5R A;  2AVX A;  1E4D A;  4WEJ A;  3MSH A;  1T1C A;  4EWF A;  2ZMA A;  3NOP C;  2JCH A;  2PT7 A;  3FZC A;  1PNE A;  5L2F A;  2PD8 A;  4D60 A;  2H28 A;  3MKF A;  4N92 A;  4OQG A;  3HJK A;  4EBP A;  3UB5 P;  3BLS A;  1XA7 A;  4LRY C;  4PMA A;  5DJT A;  2KX6 A;  2Y2I A;  1IYS A;  1F9I A;  3DTK A;  5GLC A;  3SS5 A;  2V1Z A;  1YKD A;  4RX3 A;  4GD6 A;  3B47 A;  1YPR A;  1CQA A;  3LIB A;  4O01 A;  4CLC E;  5E2E A;  1MKI A;  4KZ5 A;  1YMX A;  1BZA A;  2M7V A;  5FEG A;  1XA1 A;  3IF6 A;  1JTD A;  2Q9M A;  1YT4 A;  4KZ7 A;  5I94 A;  1ZG4 A;  3GMW A;  1I2S A;  3C8C A;  4R70 A;  5HAQ A;  1BSG A;  1Q2P A;  1T18 A;  3TE8 A;  3M6B A;  1XJ3 A;  3E2K A;  4EQ1 A;  3C4O A;  1XFQ A;  2A24 A;  1UGU A;  4B4Z A;  3N4I A;  2FH5 A;  1LT0 A;  1TS7 A;  2EA9 A;  4S2N C;  1BUE A;  2HDQ A;  2A3U A;  2XGN A;  5EM0 A;  3A0R A;  1E25 A;  2ZQA A;  4JF6 A;  2Y2H A;  1GA0 A;  4S2I A;  1W7F A;  3BFC A;  2P9V A;  4IUH A;  5AJG A;  2HF6 A;  4BD1 A;  1JTG A;  4CLC C;  4R3B A;  4S2K A;  3T4J A;  3H82 B;  1FOF A;  3FV7 A;  4NXF A;  1LSW A;  5CTM A;  4WZ4 A;  1KDS A;  3WS2 A;  4HBT A;  2G7U A;  3VOZ A;  5M19 A;  3WS4 A;  1YAX A;  1KVL A;  3VP1 A;  3G6O A;  2Y2M A;  3TJZ C;  4H6J B;  1G28 A;  1ODV A;  2XLN A;  3IQA A;  4LEN A;  4EEU A;  4GDN A;  1P9R A;  1DP6 A;  3OCN A;  3SH8 A;  1PZP A;  4IVK A;  5EOE A;  1IFQ A;  3V39 A;  1X0O A;  3UPO A;  1TD5 A;  2FZ0 A;  4KEN B;  3DTM A;  4HH3 A;  3S1Y A;  3IBJ A;  1N9O A;  4B88 A;  3IF5 A;  3N8L A;  3UNW A;  4C75 A;  2Y4A A;  3UE6 A;  4GLQ A;  2Y2O A;  3H9W A;  5J4E A;  4WZ5 A;  5DTT A;  4GNU A;  1S1Y A;  4ZTK A;  2ZOI A;  3ZG5 A;  5TBM B;  1K54 A;  4KZ4 A;  3R7W A;  3E0Y A;  1ONH A;  3ZNY A;  2IWB A;  3E4O A;  2JKR I;  5FL3 A;  4KQR A;  3I7J A;  2IA2 A;  4M3K A;  1VEU A;  3BW6 A;  3HLW A;  5EM1 A;  4UA6 A;  5GLD A;  2WZZ A;  4GOG A;  2Y55 A;  3HLD A;  3MQ0 A;  1O7E A;  4F94 A;  4EET B;  4B9O A;  3QP6 A;  1V9Z A;  2Y79 A;  3VFF A;  1S66 L;  3RJU A;  3CPT B;  1DY6 A;  2ZQ7 A;  1NRF A;  5E2H A;  1BLP A;  3QP4 A;  2L4R A;  3PHY A;  5GHZ A;  2IWC A;  3HJI A;  1BTL A;  1PI5 A;  1W5D A;  4O0P A;  3WS5 A;  5HDS A;  3VP4 A;  3LO7 A;  4YOF A;  1K55 C;  1P0Z A;  2R9W A;  2PHY A;  5E2G A;  2VV6 A;  5DJU A;  2A2L A;  1T1A A;  3IX3 A;  3B42 A;  2BG1 A;  5F6A A;  1ERO A;  3MKE A;  4OQI A;  2J3T D;  2J80 A;  1OJ5 A;  4MN7 A;  4ETZ A;  4ARZ B;  1PWC A;  1NZO A;  3MZE A;  4S2N A;  4L9F A;  4GHI A;  1BLH A;  4LV2 A;  4NXB A;  2Y59 A;  1YSQ A;  4KZB A;  1L0E A;  3UB8 A;  4OPQ A;  4L9G A;  3D4F A;  3IXD A;  1PFL A;  4WM9 A;  1F2K A;  3L7H A;  3MR0 A;  3QP8 A;  4S2P A;  4DF6 A;  4CLC A;  1Z09 A;  1YQS A;  3FPV A;  1NWZ A;  1XGJ A;  4JKT A;  4YIN A;  4BD0 A;  4N9L A;  3B33 A;  4PM8 A;  4DMZ A;  3KSI A;  1XJ2 A;  5HDD A;  4G3W A;  4HBU A;  4BBU A; 
#chains in the Genus database with same CATH homology
 3GR2 A;  3FKW A;  4ID4 A;  3ITA A;  3IXB A;  2ZM2 A;  3GVB A;  2Y2N A;  3RXW A;  1TVF A;  1MWT A;  2Z2L B;  4O7D A;  4OPZ A;  2XF3 A;  3MFD A;  2DNS A;  3IWI A;  3WS1 A;  5GL9 A;  3HLC A;  2XFS A;  1KE4 A;  5GHX A;  1PIO A;  1IEL A;  3ZVT A;  3RXX A;  3C7V A;  4WEL A;  2ZM0 A;  2B5R A;  4DXC A;  4WEK A;  1M40 A;  3NCK A;  3HLF A;  4S2O A;  4UHU A;  1ES5 A;  3Q7V A;  4C3Q A;  4RYE A;  5EUA A;  1NY0 A;  3VP0 A;  2EX2 A;  2WYX A;  3A3F A;  3HUN A;  1WYB A;  3NY4 A;  4MEZ A;  5FDH A;  2DCF A;  4Y0O A;  4R0Q A;  4S2L A;  2UWX A;  2PU4 A;  5CEB A;  2RCX A;  5CTN A;  3G2Z A;  2JBF A;  4JXV A;  4E3K A;  4OON A;  3WWX A;  4X53 A;  3MXS A;  5HFO A;  2EX6 A;  4P87 A;  4QY5 A;  1HVB A;  1HTZ A;  1K57 C;  2ZC5 B;  4DRT A;  2ZQ8 A;  4QY6 A;  3SOI A;  2WKH A;  4KZ3 A;  4IBR A;  5DF7 A;  4BQM A;  3DW0 A;  4IED A;  4X69 A;  1FSW A;  2V20 A;  1GCE A;  4KZ6 A;  5FQJ A;  1TEM A;  4CJN A;  1LLB A;  1K56 D;  2WAF A;  3N6I A;  5EVI C;  2JC7 A;  4XXR A;  3WRZ A;  4X56 A;  3PAE A;  3PTE A;  1CK3 A;  2H5S A;  3OC2 A;  3CZD A;  4BL2 A;  1FR1 A;  1EWZ A;  1ZG6 A;  3LEZ A;  1Q2Q A;  1BLC A;  3V3S A;  4JF4 A;  3UY6 A;  2H0Y A;  2Y91 A;  3BFF A;  3IH9 A;  3HLB A;  2WZX A;  3NBL A;  4WMC D;  3HUM A;  1MY8 A;  4X68 A;  3AGF A;  3C7U A;  1GHP A;  3PBR A;  4FH4 A;  1K4E A;  1SHV A;  3BEC A;  2EX8 A;  3O88 A;  1W8Q A;  4OPY A;  5IHV A;  2ZQD A;  4NET A;  1W8Y A;  4P85 A;  3PBO A;  5FSR A;  3GRJ A;  4JF5 A;  4JBF A;  4GB7 A;  4GD8 A;  1IKG A;  1PW1 A;  3SS3 A;  1ERM A;  2WGI A;  1ESU A;  3GV9 A;  3NC8 A;  5CGW A;  4UA9 A;  4QJG A;  3FWL A;  1K57 A;  1YM1 A;  4OQH A;  4S2M A;  3SS4 A;  3UPN A;  3ZG0 A;  3ZFZ A;  1DJA A;  2XR0 A;  4DE2 A;  5CEC A;  3G31 A;  4U0X A;  5A93 A;  1Z6F A;  5CXW A;  3FKV A;  5FAT A;  1SDE A;  2HP9 A;  3VSK A;  5DTS A;  3HLE A;  2X02 A;  5EVI A;  4DXB A;  1C3B A;  2ZC7 A;  4K0X A;  1S6R A;  4PPR A;  3UN7 A;  2IWD A;  3QNC A;  4CPK A;  2ZQ9 A;  4OH0 A;  1M6K A;  1YLT A;  2Y2K A;  1XKZ A;  3DWK A;  2C6W B;  1BLS A;  2ZC4 B;  2G2U A;  3IF6 B;  4QB8 A;  3UE1 A;  5TGF A;  1HD8 A;  1ES3 A;  1MWS A;  5F1G A;  2QMI A;  4EBN A;  3W4O A;  2Y2J A;  1MWR A;  3ZCZ A;  4EQI A;  2ZLY A;  2XFT A;  4OOL A;  4ZBE A;  1W79 A;  2P74 A;  5E2F A;  2WUQ A;  4ZJ1 A;  3WRT A;  1ESI A;  4P6B A;  3G4P A;  1HZO A;  4R4R A;  3UO9 A;  4A5R A;  3JYI A;  5FA7 A;  5GHY A;  3A3D A;  3ZNT A;  2VGJ A;  3BM6 A;  1E4D A;  4U0T A;  4EUZ A;  1GHI A;  2EFU A;  4WEJ A;  1TDL A;  3Q7Z A;  3GQZ A;  3M6H A;  2OLU A;  4IBX A;  1FQG A;  3IHB A;  4EWF A;  1XXM A;  3LCE A;  1YLY A;  2ZMA A;  3HL9 A;  2Y2Q A;  4GDB A;  4KZ9 A;  4KZ8 A;  4RX2 A;  4BL3 A;  1TDG A;  2Y2G A;  5AQB A;  2JCH A;  3FZC A;  5FAO A;  3G35 A;  4E3J A;  4N1H A;  4RVA A;  2J9O A;  2H0T A;  5L2F A;  2XD5 A;  4GKU A;  5GLB A;  4N92 A;  3MKF A;  1CI9 A;  4OQG A;  3CG5 A;  4E3O A;  4EBP A;  1ES4 A;  3BLS A;  1XA7 A;  5CHM A;  4PMA A;  2VGK A;  3SH9 A;  1MWU A;  1S0W A;  2R9X A;  3UE3 A;  1ALQ A;  5FQK A;  1ZKJ A;  2Y2I A;  2WGW A;  1IYS A;  1ZC2 A;  5GLC A;  2XDM A;  3V50 A;  1H5X A;  2PU2 A;  1CI8 A;  1H8Z A;  3N7W A;  3SS5 A;  2V1Z A;  4RX3 A;  5EPH A;  4GD6 A;  5A90 A;  1LL5 A;  3BLM A;  5FI2 A;  4ZJ3 A;  5EVI B;  4OOY A;  1XPB A;  5E2E A;  1NJ4 A;  1MKI A;  1OME A;  5HL1 A;  2ZD8 A;  3A3I A;  3G30 A;  4KZ5 A;  4RA7 A;  1IKI A;  1FCN A;  5JYP A;  4LV3 A;  5FAQ A;  1JWP A;  1YMX A;  1BZA A;  5F82 A;  2V2F F;  3IWQ A;  1XA1 A;  3IF6 A;  1JTD A;  3LY4 A;  2WKE A;  5TR7 A;  2Q9M A;  2RL3 A;  4MBH A;  3V5M A;  1YT4 A;  3QHY A;  4Y0T A;  4Y7P A;  1RGY A;  4KZ7 A;  5EOO A;  5I94 A;  1ZG4 A;  3GMW A;  1I2S A;  5D3O A;  1E3U A;  5FQI A;  4GZB A;  5HAQ A;  3HUO A;  5CGS A;  2OLV A;  1BSG A;  4U3T A;  1Q2P A;  1LI9 A;  2E8I A;  5DF9 A;  5E43 A;  3P09 A;  3M6B A;  2EX9 A;  1IEM A;  1KVM A;  2XD1 A;  3E2K A;  1SDN A;  3ZVW A;  3C4O A;  5KSH A;  5F83 A;  1N4O A;  4OKP A;  1VQQ A;  4LCL A;  4QD4 A;  4B4Z A;  3A3J A;  3N4I A;  3W8K A;  1XX2 A;  3PBS A;  1LHY A;  4ZAM A;  3HVF A;  2ZC3 B;  3M2K A;  3GTC A;  3Q81 A;  4S2N C;  2ZJ9 A;  4K91 A;  2HDQ A;  2WGV A;  1BUE A;  2A3U A;  2XGN A;  3HLG A;  2FFY A;  2H10 A;  3C4P A;  1E25 A;  3EQU A;  2EFX A;  2ZQA A;  4KZA A;  3ZGA B;  4JF6 A;  5DVA A;  3VP3 A;  4KQQ A;  2Y2H A;  3VMA A;  5JYO A;  2WGW B;  1GA0 A;  3V3R A;  4S2I A;  1JWZ A;  5FQ9 A;  3IWO A;  1K38 A;  3MXR A;  3UE0 A;  4D2O A;  4R23 A;  4KG2 A;  1W7F A;  3BFG A;  3BFC A;  1BUL A;  1RGZ A;  1WE4 A;  1I5Q A;  4MLL A;  2P9V A;  5AQA A;  5FAS A;  4BLM A;  4BD1 A;  1JTG A;  4PM9 A;  4X55 A;  4R3B A;  1BT5 A;  4JXS A;  2HDS A;  1AXB A;  1JWV A;  3O87 A;  1N9B A;  4S2K A;  4MBF A;  5CER A;  1DJB A;  3B3X A;  4PM5 A;  1FOF A;  4R1G A;  3FV7 A;  1G68 A;  5CTM A;  4WZ4 A;  1L0D A;  1KDS A;  4FSF A;  3WS2 A;  4HBT A;  3VOZ A;  5M19 A;  5FQQ A;  3WS4 A;  1KVL A;  4OP5 A;  3VP1 A;  2HPB A;  1L0F A;  4PM6 A;  4E3L A;  5U47 A;  2Y2M A;  5HAR A;  3S22 A;  1KDW A;  1QME A;  1RCJ A;  2XLN A;  3IQA A;  1O07 A;  4NK3 A;  5EE8 A;  4WZ5 C;  4LEN A;  5EVI D;  4DDY A;  1KGG A;  3IHA A;  4R3J A;  4GDN A;  2PBY A;  1FCM A;  3O86 A;  3ZHH A;  2GDN A;  1U60 A;  1J9M A;  1K54 C;  3Q07 A;  5HAI A;  2EXA A;  3BFE A;  4K0W A;  2HP5 A;  1L0G A;  3OCN A;  4OP8 A;  3SH8 A;  1DJC A;  1PZP A;  1K4F A;  3LY3 A;  4E3I A;  1PI4 A;  1MPL A;  4IVK A;  5EOE A;  4E3N A;  4HES A;  3MZF A;  1YLW A;  4FD8 A;  4Y0U A;  1PWD A;  1YLJ A;  5DTK A;  5M1A A;  5A92 A;  3IH8 A;  5KSC A;  3V39 A;  3OPL A;  4BEN A;  4H8R A;  1PYY A;  3EQV A;  3UPO A;  4IVI A;  5G18 A;  1Y54 A;  3Q1F A;  4OLG A;  4KG6 A;  3A3E A;  4KEN B;  3DTM A;  3S1Y A;  2P9V B;  3VFH A;  3CMZ A;  3ZDJ A;  2QZ6 A;  2Y2P A;  5FQM A;  4B88 A;  3IF5 A;  3N8L A;  1EI5 A;  3UNW A;  4C75 A;  1NZU A;  2Y4A A;  2Y2O A;  4JXW A;  3N8S A;  4WZ5 A;  3TSG A;  5CHJ A;  2WK0 A;  1ONG A;  4UA7 A;  2XEP A;  5DTT A;  1ERQ A;  3IXG A;  4FH2 A;  3OCL A;  4GNU A;  4ZTK A;  2C5W B;  3PBT A;  3W4Q A;  3ZG5 A;  2J9P A;  3W4P A;  5HX9 A;  1K56 A;  1KGE A;  1K54 A;  4Z9Q A;  4KZ4 A;  2X71 A;  1FSY A;  1ONH A;  1K6S A;  3ZNY A;  2BLS A;  2HDU A;  1PWG A;  3OPR A;  4L0L A;  4UAA A;  2EXB A;  4N1X A;  2IWB A;  3OPP A;  3FYZ A;  4KQR A;  5AQ7 A;  1IYO A;  3I7J A;  1KGF A;  4M3K A;  5FI6 A;  4WMC A;  4B4X A;  3IT9 A;  4JXG A;  3HLW A;  4FCF A;  5BOH A;  2XH9 A;  4UA6 A;  3AGE A;  4LV0 A;  1KE0 A;  4EV4 A;  1RP5 A;  2WZZ A;  3N8R A;  5GLD A;  5CED A;  4GOG A;  3BFD A;  2Y55 A;  1YLP A;  2CC1 A;  3E2L A;  3MBZ A;  3HLD A;  2J7V A;  1O7E A;  5AQ9 A;  3VSL A;  4F94 A;  3G2Y A;  5HAP A;  1JVJ A;  1XP4 A;  4Q8I A;  2JE5 A;  3NI9 A;  3VFF A;  3BRM A;  3OPH A;  5CRF A;  5GLA A;  1CEG A;  3G34 A;  4JLF A;  3C5A A;  5A91 A;  3RJU A;  3BEB A;  1SCW A;  4WBG A;  1DY6 A;  4S2J A;  1E3U D;  1K25 A;  1XGI A;  1FR6 A;  1NRF A;  2ZQ7 A;  3UDX A;  3CJM A;  5E2H A;  3WS0 A;  4YFM A;  3ZG8 B;  1BLP A;  4ZJ2 A;  1FCO A;  3HRE A;  3UPP A;  2HP6 A;  3NDG A;  3G32 A;  4N9K A;  4OLD A;  4WYY A;  5CGX A;  4XUX A;  1CEF A;  5GHZ A;  3OZH A;  2IWC A;  3TG9 A;  1I2W A;  4QU3 A;  3NIA A;  4QHC A;  5F1F A;  1BTL A;  1PI5 A;  1W5D A;  2HDR A;  3ITB A;  3QNB A;  3WS5 A;  5FI7 A;  4KG5 A;  3S4X A;  3VP4 A;  3LO7 A;  4P0M A;  1PW8 A;  1K55 C;  1MBL A;  5J8X A;  2R9W A;  1G6A A;  1NXY A;  3VP2 A;  5E2G A;  5KZH A;  1GA9 A;  4DDS A;  1K6R A;  5TFQ A;  2X01 A;  4C6Y A;  1LL9 A;  1NYY A;  2BG1 A;  1ERO A;  3MKE A;  4E6W A;  5CHU A;  4OQI A;  4OQ0 A;  5DF8 A;  4DKI A;  4R4S A;  1YMS A;  3AGD A;  5EVL A;  2A49 A;  4OOM A;  4GN2 A;  1PWC A;  1SKF A;  4LCM A;  3Q7V B;  3UDF A;  1L2S A;  4PM7 A;  3IXH A;  2ZM8 A;  1NZO A;  3MZE A;  4S2N A;  1LI0 A;  4HEF A;  3ISG A;  5HW3 A;  2XQZ A;  1BLH A;  4LV1 A;  1PZO A;  2WAD A;  4LV2 A;  1YLZ A;  2ZC6 B;  5EEC A;  2Y59 A;  4KZB A;  2Y2L A;  1L0E A;  2Z2M B;  5KMW A;  4OPQ A;  3D4F A;  1VM1 A;  3BYD A;  3IXD A;  3O3V A;  3GSG A;  4WM9 A;  1KE3 A;  1IYQ A;  1NYM A;  1MXO A;  3UDI A;  3ZG7 B;  1H8Y A;  2ZQC A;  4MBK A;  4DF6 A;  4S2P A;  4DE0 A;  1K55 A;  2WAE A;  4KQO A;  1QMF A;  3M2J A;  3PAG A;  4DE3 A;  1YQS A;  3TOI A;  4E6X A;  4OVD A;  3SH7 A;  1WYC A;  5M18 A;  1XGJ A;  4ZDX A;  3HBR A;  4JKT A;  4E3M A;  3NDE A;  3IF6 C;  3P98 A;  2G2W A;  3VOY A;  4DE1 A;  4BJP A;  2I72 A;  4YIN A;  1ES2 A;  2OV5 A;  4BD0 A;  1GHM A;  2Q9N A;  3MZD A;  4N9L A;  1IYP A;  3PBN A;  4MNR A;  2DRW A;  2FFF B;  4XUZ A;  4EBL A;  3ZG9 B;  3PBQ A;  4JPM A;  4PM8 A;  5FAP A;  2WKI A;  2OSU A;  3DWZ A;  3Q82 A;  4HBU A;  4OPR A;  2J8Y A;  2XK1 A;  4X6T A;  2QPN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...