5FEFA

Crystal structure of the allergen profilin (zea m 12)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
132
structure length
132
Chain Sequence
GMSWQAYVDDHLLCDIEGQHLSAAAIVGHDGSVWAQSENFPELKPEEVAGMIKDFDEPGTLAPTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGIYDEPMTPGQCNMVVERLGDYLIEQGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Allergen
molecule keywords Profilin-5
publication title Structural insights into the IgE mediated responses induced by the allergens Hev b 8 and Zea m 12 in their dimeric forms.
pubmed doi rcsb
source organism Zea mays
total genus 35
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2015-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00235 Profilin Profilin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 5fefA00
3CPTA 5FDSA 1YPRA 5EM0A 3CPTB 1PRQA 4D60A 1D1JA 1F2KA 2ZL1B 1ACFA 2E8JA 3L7HA 1J3WA 3T1RA 5FEGA 3L9KA 4FUWA 3T12B 4ESPA 2VK3A 2PAVP 5EVEA 3T1XA 4X25A 4QWOA 1CF0A 2ZL1A 2BTFP 2JKGA 2JKFA 2HZ5A 3CHWP 3UB5P 1HLUP 1K0KA 3NECA 3MS6A 3LGOA 1PNEA 2V8FA 2ACGA 1A0KA 3T1SA 1SKOA 3MSHA 4X1LA 1SZVA 3KYEA 1VETB 1CJFA 2B95A 1FIKA 3T1QB 1CQAA 1SKOB 1PFLA 4X1MA 5EV0A 1Y4OA 1G5UA 2V8CA 2PRFA 1VEUB 3D9YA 3LEQA 2PBDP 1VETA 5EM1A 4FTXA 3U4LP 3NULA 1Z09A 5FEFA 1VEUA 1FILA 3DAVA 1AWIA
chains in the Genus database with same CATH superfamily
1LL8A 5DTSA 3T50A 2XR0A 2W0NA 4HY8A 2ZL1B 5CHUA 5AQ7A 1YT4A 1IEMA 1PWDA 2BLSA 3S7NA 4OVDA 3OZHA 3T1RA 2PD7A 3MZFA 1O07A 3Q7VB 5EOEA 5L2FA 1S1ZA 2ZQ9A 1NY0A 4EEUA 1WE4A 2W3EA 1H8YA 4JF4A 4EBNA 4RVAA 2HJEA 4XUZA 3V39A 3BJNA 5EVIA 3FKVA 5BOHA 3GSGA 1QMEA 3UO9A 3IF6B 5GLDA 3UPNA 5KZHA 4Q0JA 1XGJA 2X71A 5DTKA 3VOZA 1IKIA 4Y7PA 3N4IA 3Q82A 2ACGA 1ODVA 3RFBA 5EUAA 1PZOA 1SZVA 4CLCC 3UMEA 3T4JA 5CEDA 1NJ4A 1G28A 1YM1A 1DJAA 2K7SA 3GVBA 3ZG8B 2VGLM 5GL9A 1XP4A 2WKPA 4JXWA 2ZQ7A 3M2KA 3TOIA 2ZC6B 4NEED 1YLWA 3BW6A 1LLBA 4EQIA 1FQGA 3ZFZA 4KQRA 4LV0A 5F1FA 1CEFA 3BFGA 1NXYA 3AGDA 4EERA 5CGXA 4HP4A 1OTDA 4EXOA 1YSPA 2OAP1 1EI5A 3MKEA 5HZHA 1PRQA 3BLMA 3IWOA 4P6ZM 5DF7A 2Y2MA 2J3TC 3IBJA 1YLJA 3CLOA 3RTYA 1TVFA 1IYQA 4X56A 4WZ4A 2PAVP 3S7PA 4WBGA 2PBYA 5TBMA 3V3SA 2Y91A 4IVKA 2ZL1A 4BWIA 2QJ5A 2Y2KA 3IX3A 2DNSA 1NRJA 4OQHA 4IEDA 3UB5P 1VHMA 1HTZA 4O0PA 5JYOA 3BFFA 2EA9A 2XA7M 3CUEA 5CTNA 3MS6A 4GHIB 2ZJ9A 3GV9A 1PNEA 1T18A 1MWTA 2CC1A 3E98A 1KE0A 5FSRA 3MXQA 2VKSA 5F5YA 3G35A 2Q9NA 1FR1A 5HDCA 1K55C 5K5BA 3LR3A 3IF6A 4GW9A 1CJFA 4X55A 3UDFA 3QNBA 3BFEA 4YWZA 4S2NC 1PFLA 1ZTUA 5EECA 1GHPA 4HBUA 3P98A 3T4SA 3UMDA 2J80A 4NXEA 3A3EA 3HLCA 3WRTA 4E3MA 4MEZA 2WK0A 2O9BA 1WYCA 4UQIS 4AFIA 4OLGA 4LENA 4LRXC 2QZ6A 4MBKA 3ZYTA 1LI0A 1S4SA 2IWBA 4QY6A 4IUHA 3IT9A 3N8RA 4ZJ2A 3DWZA 3CZDA 3V3RA 1YKDA 2V9AA 2KOIA 3UDXA 2P04A 2OLUA 3PBNA 1OT9A 3NBLA 2JKRI 4WEJA 2WYXA 4R0QA 5TJJA 2QMIA 4S2PA 3C30A 2L0WA 5FAQA 2QPNA 2Y2GA 4N1HA 3NC8A 3HLDA 5AVFA 3V5MA 3IX4A 3MFDA 3T4TA 4KENB 1YQSA 4PPRA 4ZTKA 4F3LB 1W8YA 4BL2A 2FZ0A 3SW1A 2Y2JA 2B5RA 4PM9A 4HHDA 3D72A 5CGSA 3O87A 1TF1A 4S2OA 2PU2A 4ME4A 2Y2OA 4E3JA 2NUTC 2ZD8A 4GHIA 2V2FF 4DDSA 3V67A 2Y2IA 2A2LA 3KSGA 4JGPA 5FASA 2OV5A 3CMZA 2J8YA 4NK3A 4H8RA 1VEUB 2Y2NA 3D9YA 4NXFA 4R3JA 3Q7ZA 4FTXA 2I9VA 4WN5A 3PBSA 3Q81A 4E3NA 2IWCA 4JKTA 4CJNA 1CEGA 4KUKA 3ZVWA 4S2IA 4O8GA 1K6RA 2EWVA 1LHYA 1MC0A 1UWPX 4CLCB 4Y2FA 3MXSA 4IVIA 4HI4A 3N8LA 4HH2A 2EX2A 2W3DA 1FSWA 3NIAA 4OOMA 4R23A 3DWKA 3K3CA 5U47A 2JKRM 2VGLS 2WAEA 3AGFA 4MBHA 2H0TA 4YNRA 1MPLA 1P9RA 3WS4A 1K56A 3VSLA 5CX7A 3CUEC 4U0TA 4JBFA 4O01A 3CWFA 4LRYC 5C5KA 1DP9A 4XUXA 1VB6A 3W2ZA 5FL3A 1MKIA 1MWUA 1SHVA 4OP5A 1W63M 1ALQA 1KVMA 3CHWP 1KOUA 4EWFA 4LGWA 2Z6CA 4P6ZS 1ONGA 4QJGA 3CG5A 1YLTA 3HLGA 5KIZA 3SOIA 2WKQA 3HREA 1SKOA 4X1LA 3LEZA 1XGIA 5F83A 3BFDA 3RXWA 5HPFA 2ZMAA 3C2WA 3M6BA 3NDEA 1XFQA 2QHKA 1J9MA 3UE1A 1PI4A 3VP4A 5CTMA 1VM1A 2W3HA 2ZMVA 1CI9A 4GLQA 2PHYA 2XA7S 3SZTA 3PAEA 2Y8HA 2ZC7A 1KDWA 3U4LP 3V50A 2GNXA 2ZQAA 2EX6A 1YMSA 1OTAA 1ZKJA 3HUOA 5CERA 3WWXA 1VEUA 4QY5A 1FILA 1XPBA 3O88A 3DAVA 3IS2B 2H5SA 4R1GA 1MKMA 4YINA 1YPRA 4HJ6A 1BULA 3GMWA 3JPUA 1ONHA 2JKTM 4L0LA 4KQOA 4QU3A 4DXBA 5F68A 1TS8A 4CLCA 3TW8A 2VX8A 4R3BA 3ZG5A 4HQAA 1KGFA 4X53A 5FI6A 1KGGA 4H6JB 1XA1A 1J3WA 4WMCA 3WS2A 2XFSA 4ESPA 3GECA 1DP8A 2X02A 3SS5A 5DJUA 2Y59A 2QJ7A 4JLFA 1G6AA 3GDIA 1XFNA 2EXBA 1TDGA 3PXPA 1BYWA 3FV7A 1WA9A 3F1PB 1ES5A 1HLUP 3M6HA 2VZWA 1BLCA 1I2SA 1ERMA 2WGIA 4ETZA 1A0KA 2V0UA 4YOFA 3BLSA 4DRTA 2UV0E 5FQIA 3WRZA 1GSWA 1NLYA 3JVVA 4E3KA 2ZC5B 2LB5A 1G5UA 3HLEA 4OPYA 1S67L 3PBQA 3BWLA 2XEPA 3HCYA 3A0RA 5FDHA 1D7EA 1W8QA 5CECA 4KQDA 1O7EA 3K3DA 2D01A 5J8XA 1ZHHB 3ZHHA 3LO7A 3CJMA 3TRCA 3FG8A 2JHEA 2VJWA 3CPTA 4HJ3A 3LI8A 4U0XA 4Q0HA 3FKWA 1H8ZA 3PAGA 4RX2A 4GDNA 4D60A 3HUNA 5HD5A 3T4QA 3C8CA 1MBLA 2XQZA 1HZOA 4XT2A 2EFUA 2WKEA 4OQGA 2J9PA 2Z6DA 4S2NA 5FQQA 3IS2A 2XLNA 4OPZA 3UB9A 2VK3A 4Y13A 2HPBA 4CQHA 3PBRA 3UPPA 1H0MA 4EUVA 4N92A 2XD5A 5GLCA 2W27A 4QPRA 1ESIA 2Y4AA 5DFXA 1NWZA 5TBMB 4H6JA 5CGWA 2JKFA 2EWWA 4RYEA 3BM6A 4II7A 3UE6A 1N9OA 1F5MA 2ZQCA 4HNBA 1P0ZA 4PHTA 2Y2LA 1SKFA 1YLYA 3HLFA 2Z2MB 3O3VA 4R4RA 3LFVA 1N9NA 4WYYA 4JGRA 3N7WA 4UA9A 3T1SA 3F1PA 1L0EA 1VETB 3VMAA 3O86A 4EESA 1C3BA 5HAIA 3MFXA 3G4PA 5CEBA 1XJ6A 1UWNX 3B3XA 3C4PA 1MXOA 3SS3A 1LI9A 3KYQA 1Z09A 4KZ4A 5GHZA 2XH9A 3H7WB 4E3OA 1M40A 4JXGA 3BYDA 2G2WA 2UWXA 1S6RA 2HGVA 2J7VA 5CHJA 1V9ZA 2H0YA 3EQVA 4X6TA 3BEBA 5HPIA 2YKHA 3L9KA 3U2AA 1JTGA 1FSYA 3HBRA 3ZG7B 4DMZA 1T1CA 2HDUA 4DJ3A 3BFCA 4B88A 5HWTA 3BECA 4KUOA 3PR6A 1LL9A 3W8KA 4JF5A 2P9VB 2XD1A 4NXGA 3BY8A 4B9OA 1RCJA 2RL3A 4PM6A 4PM7A 3LIDA 3UB6A 1HVBA 1K0KA 4S2LA 4E6WA 1G68A 4DE0A 4BJPA 1WYBA 4C75A 1KDSA 1DY6A 2ZC4B 2IWDA 4GJ4A 3ULFA 3IWQA 3MBZA 1YLPA 4PMAA 5GHYA 3MKFA 2V8CA 5M19A 1XJ3A 2HV1A 3MJQA 4FH4A 1VETA 2X01A 1SDNA 3D4FA 3GR2A 3MQQA 3VP0A 3G2ZA 3IH8A 2R9XA 4M3KA 1S1YA 3T4OA 4I3AA 2Y55A 4FCFA 3FWLA 3VP2A 3ZVTA 1NLZA 1NYYA 1K57C 1LSXA 4DE1A 3B47A 5FDSA 1E3UD 2M7VA 3PTEA 2RCXA 4WEKA 3NOPC 4BL3A 4FD8A 2W1TB 2PR6A 5KSCA 2OWJA 4NG2A 1GCEA 4KZ9A 4GDBA 4U3TA 3SS4A 3H7WA 4B4ZA 4R70A 2ZMFA 3GRJA 5I94A 5CRFA 1K6SA 4R3AA 1M6KA 4UHUA 5HAPA 3O5YA 1GSVA 5DKLA 2V1BA 3RH8B 4BBVA 2EX8A 3SH8A 1XKZA 3ITBA 3N8SA 4BENA 3VE3A 4P0MA 3WS5A 3FPVA 2OLVA 2P9VA 5E2FA 1EROA 4IUKA 4MBFA 4IHQA 4L9FA 1NZOA 3WS1A 4KZ3A 1FIKA 5KMWA 5MC7A 5AQ9A 5D3OA 4RQ9A 1KE4A 1SKOB 2JCHA 3MR0A 4WF0A 3VP3A 4IBRA 4ZRRA 5HAQA 1JWVA 4UA7A 3AGEA 5F69A 4OPRA 5EVID 2PRFA 3SH7A 5E2HA 3OCLA 4BD0A 3QP4A 3UPOA 3NJAA 3EQUA 4ZAMA 4FH2A 3S1YA 3E4QA 2ZBBA 1P97A 4I39A 2BG1A 2H10A 3OC2A 2CMNA 3C4OA 2OSUA 4YFMA 4LLOB 4K91A 3IHBA 1ACFA 2Q9MA 3UDIA 3ZNYA 3DTEA 3K2NA 1PW8A 5AJGA 3NHQA 2W1RA 3UN7A 4PM8A 2V0WA 2M1CA 3A3JA 4IJGA 2W1TA 2K2NA 3ZCZA 4LV1A 3LR0A 1NZUA 5CHMA 1ES2A 4MCWA 1TS0A 3CITA 1OJ5A 3ZNTA 1XXMA 3G32A 2OOLA 5L07A 1KE3A 2GDNA 1ZG6A 4G3KA 3C7UA 3BQ8A 5M1AA 4QHCA 4LPZA 2ZQDA 3IWIA 3PBTA 5EOOA 5HFOA 4B93A 4EETB 3HUMA 4UAAA 1BUEA 3E2LA 2WADA 3QP8A 1E4DA 3S7OA 4R6LA 4DXCA 3Q1FA 3S22A 3LY4A 4KZ8A 4MMNA 1ESUA 1Z6FA 1ZG4A 4LV3A 1IYOA 4OP8A 1KVLA 1Y4OA 2HP5A 4LCLA 4Y15A 3VE4A 5FQKA 4JF6A 5HL6A 4JXSA 3NDGA 1K4FA 2ZQ8A 4KZBA 2PYRA 5FQ9A 2R9WA 1MWSA 4PM5A 2J9OA 2WZZA 1MWRA 1PZPA 5J3WA 2HP9A 2V1ZA 4OQIA 3DTMA 5I5LA 3RXXA 5L09A 4EEPA 4HJ4A 5IU1A 4NETA 4WZ5C 1IFQA 2PU4A 3CPTB 1OTBA 2GJ3A 3NI9A 4K08A 1FR6A 1TS6A 2HDSA 3RJUA 4X69A 1JWPA 5LBRA 1QMFA 5F82A 3IQAA 5J4EA 1GHIA 1RGYA 3B33A 3PBOA 2NUPC 4XT2B 3T1XA 4P6BA 3DTIA 3M2JA 3HJIA 3PHYA 3HLBA 2KX6A 1HD8A 2AVXA 4IBXA 4R38A 1DJCA 4DE3A 4WM9A 4GB7A 3QP6A 2DMWA 5EE8A 4KG2A 1XA7A 2WAFA 1GHMA 1FCOA 2VGKA 4DKIA 3C7VA 1OPXA 3ZG9B 4HIAA 5FAPA 3TJZC 3KYEA 2B95A 2E8IA 1I5QA 2KDKA 3I7JA 4DN0A 3EOIA 3GQZA 3IXDA 2YKFA 2ZOIA 2V1AA 3W4QA 4KG6A 4KZAA 5FQJA 1DJBA 1EWZA 2PR5A 4OOYA 2WKHA 3FC7A 3FPWA 5TR7A 4A5RA 3ICYA 4Z1WA 4F94A 4HESA 5HX9A 3KSHA 2P08A 4P87A 2VEAA 1RP5A 1S66L 3T4LA 4JGOA 1T1AA 3UNWA 1YMXA 4RA7A 3OPPA 3LR4A 5G4ZA 1GSXA 4HP9A 3QNCA 1W79A 4X25A 4QWOA 3LI9A 1L2SA 5L10A 4Q8IA 4EUZA 3IXGA 5A8BA 2BTFP 3S7QA 2ZM8A 4L9EA 4KZ6A 3ZDJA 3OBFA 4ZBEA 1W63Q 1NRFA 2HP6A 3LYXA 1YAXA 2WUQA 3MF0A 3NECA 1MZUA 1VQQA 1K57A 3LGOA 2V8FA 1P9WA 4I3IA 1N9LA 3HJKA 1K56D 1N9BA 1K38A 2G7UA 4Z9QA 5M18A 3D3OA 3TSGA 4OOLA 5FAOA 2VV7A 2VGJA 3F1OB 1BLHA 3JYIA 4PKYA 3MQOA 4LV2A 2A3UA 3LEQA 3P7NA 4O7DA 2PBDP 4Q0IA 4PKYG 5EM1A 3EEAA 4OQ0A 2EXAA 5A92A 4WL9A 3MQ0A 4FSFA 3VP1A 2VLGA 2ZOHA 2Y2PA 1PW1A 1ES3A 5HSQA 5HDSA 4B4XA 2IA2A 1XJ4A 2HF6A 1BTLA 3OLOA 2Q0OA 5HD3A 5FI7A 5TGFA 4DJ2A 2A24B 5HL1A 1OTIA 1G6OA 2I72A 2E8JA 2FFYA 3L7HA 3NCKA 3H9WA 4GZBA 3IBRA 4HBTA 3UE3A 2JC7A 1LL5A 3G2YA 1K4EA 2XRNA 4OLDA 1K54C 2JBFA 1X0OA 4UEYA 1W5DA 2EX9A 3EWKA 3R4KA 5FQMA 5F6AA 2W3GA 2OWHA 4GS9A 2WGWA 5JYPA 4ZJ3A 4C3QA 3EGDC 2Z2LB 3ITAA 1PWCA 2FFFB 3EEHA 4L9GA 3R7WA 3VV4A 4WELA 1DP6A 2QKPA 1FCMA 4CLCD 4X68A 3UB7A 3G30A 4WMCD 3A3DA 3NOUC 5DKKA 3OPHA 3EGXC 4OONA 3P01A 1LSWA 1Y28A 3W4OA 4ID4A 1T19A 3OPRA 2QYBA 4GKUA 2VA0A 2XROA 4KZ7A 3VOLA 4EV4A 1TS7A 3IHAA 1LT0A 4EU0A 3F1OA 4BBUA 5L8MA 4DF6A 3OOVA 5E43A 2K31A 5CXWA 2O99A 4QB8A 4KQQA 3KSIA 5G4YA 4Y0TA 2J3TD 2WKIA 3E4PA 5EM0A 3VSKA 1GA0A 1H5XA 4N9LA 3LIAA 4DDYA 1F2KA 1IYSA 4D2OA 4I5SA 3UY6A 1Y54A 3Q7VA 3C5AA 4GOGA 5GLAA 3T12B 4ARZB 1L0GA 2A24A 2C6WB 1SCWA 4OPQA 3G31A 3VFFA 1BLSA 3UB8A 1K25A 5E2EA 4KZ5A 1YSQA 2JKGA 3MMHA 5HDDA 2HZ5A 5E2GA 2WZXA 1ZC2A 2G2UA 2PD8A 1T1BA 4EBLA 1JWZA 5HW3A 4ZDXA 4BQMA 3S4XA 1KGEA 4C6YA 2O9CA 4WZ5A 4G3WA 3MZEA 1JNUA 1Q2QA 2H28A 3KYZA 3N6IA 1YLZA 3ZG0A 3LUQA 3DTKA 3P09A 5EPHA 2D02A 4ETXA 3IXBA 2MJ6A 5FATA 4MDZA 3VOYA 1PI5A 2OAQ1 1TDLA 3DW0A 4HOIA 3BRMA 3LR5A 4K0XA 4GD6A 5DJTA 2B02A 4OKPA 2ZC3B 2P74A 5EVIC 1U60A 1S4RA 5AVEA 5FI2A 5FEFA 3QHYA 4EW7A 3TE8A 1AWIA 5GHXA 2ZLYA 1PIOA 2W3FA 2B18A 4E04A 1IOUA 4CLCE 1L0FA 2WGVA 2JE5A 4FUWA 2Y2HA 1BSGA 2A49A 4R4SA 4GN2A 1CF0A 2VV8A 2XDMA 3G34A 1FOFA 4CPKA 1H8MA 5DF9A 3TG9A 4ARZA 4LFUA 5HWVA 4UA6A 4HEFA 2PT7A 2Y79A 4KG5A 4FOFA 4S2JA 5KSHA 1OMEA 4MN5A 4M4XA 1L0DA 4E3LA 4S2KA 5EFWA 5F1GA 1S0WA 5GLBA 3T1QB 1CQAA 3A0VA 1AXBA 5A93A 5EV0A 1RGZA 4DE2A 1DRMA 3ZGAB 3NY4A 3F1NB 1XJ2A 4JXVA 4MN6A 1FCNA 4LRZE 1ERQA 3JVUA 5DTTA 2GZAA 1IELA 2HDRA 3PYPA 3E4OA 4E6XA 5A91A 4Y0UA 2JKTI 4JGQA 3VFHA 2P7JA 3ISGA 3GTCA 2PDRA 2PYPA 1UGUA 2XGNA 4ZJ1A 1D1JA 2V20A 3IF6C 4MN7A 3BQAA 4GCZA 4Y0OA 2LB9A 2BASA 3C38A 1CI8A 3KX0X 5EVEA 1F9IA 4QD4A 5A90A 3UE0A 4MLLA 4NXBA 3IXHA 2XK1A 2M7UA 3B42A 2ZM0A 5G18A 1L3LA 4F3LA 1IKGA 1PWGA 4I3JA 5IHVA 2ZM2A 3QP5A 4RX3A 3HLWA 1N4OA 1NYMA 4Y17A 3KSFA 1D06A 4XXRA 3IH9A 1IYPA 3FYZA 3QP2A 2HDQA 3NOTC 2KLIA 3WS0A 4N1XA 3H82B 3MZDA 4K0WA 3A3FA 4GNUA 1MY8A 3A0SA 4S2MA 2WKRA 3OCNA 4X1MA 2XFTA 4BLMA 4P85A 2L4RA 2DRWA 1OJGA 2INWA 5DVAA 1E25A 1K54A 4G3VA 4BMWA 3LIFA 5HARA 3FZCA 3E2KA 1TD5A 2GX5A 4GD8A 5EVLA 1H3QA 2L1MA 3LCEA 3E0YA 3F1NA 3CAXA 5J7EA 3IX8A 2QWSA 4JPMA 1F98A 3MXRA 4I38A 4EQ1A 2HJ9C 2XSSA 5FA7A 1V9YA 4OH0A 1LSVA 3LIEA 3T4KA 3LIBA 1BZAA 4E3IA 1BT5A 5FEGA 5EVIB 4PAUA 1ES4A 3KO6A 4Y3IA 2FH5A 2O9AA 3G6OA 4BBTA 3DBAA 1JTDA 1OT6A 2VV6A 3IF5A 2XF3A 1JVJA 3Q07A 3OPLA 1CK3A 1Q2PA 3W4PA 3SH9A 5DFYA 4GS9B 2WGWB 3LY3A 5HWWA 1STZA 3A3IA 1I2WA 1BLPA 2O0YA 1GA9A 4Y5FA 3R7WB 3MSHA 5AQBA 2Y2QA 4EBPA 4UQIM 1E3UA 3HVFA 5IT5A 5AQAA 2EFXA 1SDEA 5DF8A 5TFQA 3BY9A 4HH3A 1PYYA 1W7FA 3H82A 5IS1A 1OTEA 3LICA 4WLAA 1K55A 4WUJA 2R78A 3CI6A 1EW0A 4LCMA 4NKPA 3NULA 2J3WA 4MNRA 2C5WB 3HL9A 3ZQ5A 1TEMA 2DCFA 4BD1A 4N9KA 2JN7A 1XX2A 3QP1A
chains in the Genus database with same CATH topology
3CPTA 5FDSA 1YPRA 5EM0A 3CPTB 1PRQA 4D60A 1D1JA 1F2KA 2ZL1B 1ACFA 2E8JA 3L7HA 1J3WA 3T1RA 5FEGA 3L9KA 4FUWA 3T12B 4ESPA 2VK3A 2PAVP 5EVEA 3T1XA 4X25A 4QWOA 1CF0A 2ZL1A 2BTFP 2JKGA 2JKFA 2HZ5A 3CHWP 3UB5P 1HLUP 1K0KA 3NECA 3MS6A 3LGOA 1PNEA 2V8FA 2ACGA 1A0KA 3T1SA 1SKOA 3MSHA 4X1LA 1SZVA 3KYEA 1VETB 1CJFA 2B95A 1FIKA 3T1QB 1CQAA 1SKOB 1PFLA 4X1MA 5EV0A 1Y4OA 1G5UA 2V8CA 2PRFA 1VEUB 3D9YA 3LEQA 2PBDP 1VETA 5EM1A 4FTXA 3U4LP 3NULA 1Z09A 5FEFA 1VEUA 1FILA 3DAVA 1AWIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CPT A;  5FDS A;  1YPR A;  5EM0 A;  3CPT B;  1PRQ A;  4D60 A;  1D1J A;  1F2K A;  2ZL1 B;  1ACF A;  2E8J A;  3L7H A;  1J3W A;  3T1R A;  5FEG A;  3L9K A;  4FUW A;  3T12 B;  4ESP A;  2VK3 A;  2PAV P;  5EVE A;  3T1X A;  4X25 A;  4QWO A;  1CF0 A;  2ZL1 A;  2BTF P;  2JKG A;  2JKF A;  2HZ5 A;  3CHW P;  3UB5 P;  1HLU P;  1K0K A;  3NEC A;  3MS6 A;  3LGO A;  1PNE A;  2V8F A;  2ACG A;  1A0K A;  3T1S A;  1SKO A;  3MSH A;  4X1L A;  1SZV A;  3KYE A;  1VET B;  1CJF A;  2B95 A;  1FIK A;  3T1Q B;  1CQA A;  1SKO B;  1PFL A;  4X1M A;  5EV0 A;  1Y4O A;  1G5U A;  2V8C A;  2PRF A;  1VEU B;  3D9Y A;  3LEQ A;  2PBD P;  1VET A;  5EM1 A;  4FTX A;  3U4L P;  3NUL A;  1Z09 A;  5FEF A;  1VEU A;  1FIL A;  3DAV A;  1AWI A; 
#chains in the Genus database with same CATH topology
 1LL8 A;  5DTS A;  3T50 A;  2XR0 A;  2W0N A;  4HY8 A;  2ZL1 B;  5CHU A;  5AQ7 A;  1YT4 A;  1IEM A;  1PWD A;  2BLS A;  3S7N A;  4OVD A;  3OZH A;  3T1R A;  2PD7 A;  3MZF A;  1O07 A;  3Q7V B;  5EOE A;  5L2F A;  1S1Z A;  2ZQ9 A;  1NY0 A;  4EEU A;  1WE4 A;  2W3E A;  1H8Y A;  4JF4 A;  4EBN A;  4RVA A;  2HJE A;  4XUZ A;  3V39 A;  3BJN A;  5EVI A;  3FKV A;  5BOH A;  3GSG A;  1QME A;  3UO9 A;  3IF6 B;  5GLD A;  3UPN A;  5KZH A;  4Q0J A;  1XGJ A;  2X71 A;  5DTK A;  3VOZ A;  1IKI A;  4Y7P A;  3N4I A;  3Q82 A;  2ACG A;  1ODV A;  3RFB A;  5EUA A;  1PZO A;  1SZV A;  4CLC C;  3UME A;  3T4J A;  5CED A;  1NJ4 A;  1G28 A;  1YM1 A;  1DJA A;  2K7S A;  3GVB A;  3ZG8 B;  2VGL M;  5GL9 A;  1XP4 A;  2WKP A;  4JXW A;  2ZQ7 A;  3M2K A;  3TOI A;  2ZC6 B;  4NEE D;  1YLW A;  3BW6 A;  1LLB A;  4EQI A;  1FQG A;  3ZFZ A;  4KQR A;  4LV0 A;  5F1F A;  1CEF A;  3BFG A;  1NXY A;  3AGD A;  4EER A;  5CGX A;  4HP4 A;  1OTD A;  4EXO A;  1YSP A;  2OAP 1;  1EI5 A;  3MKE A;  5HZH A;  1PRQ A;  3BLM A;  3IWO A;  4P6Z M;  5DF7 A;  2Y2M A;  2J3T C;  3IBJ A;  1YLJ A;  3CLO A;  3RTY A;  1TVF A;  1IYQ A;  4X56 A;  4WZ4 A;  2PAV P;  3S7P A;  4WBG A;  2PBY A;  5TBM A;  3V3S A;  2Y91 A;  4IVK A;  2ZL1 A;  4BWI A;  2QJ5 A;  2Y2K A;  3IX3 A;  2DNS A;  1NRJ A;  4OQH A;  4IED A;  3UB5 P;  1VHM A;  1HTZ A;  4O0P A;  5JYO A;  3BFF A;  2EA9 A;  2XA7 M;  3CUE A;  5CTN A;  3MS6 A;  4GHI B;  2ZJ9 A;  3GV9 A;  1PNE A;  1T18 A;  1MWT A;  2CC1 A;  3E98 A;  1KE0 A;  5FSR A;  3MXQ A;  2VKS A;  5F5Y A;  3G35 A;  2Q9N A;  1FR1 A;  5HDC A;  1K55 C;  5K5B A;  3LR3 A;  3IF6 A;  4GW9 A;  1CJF A;  4X55 A;  3UDF A;  3QNB A;  3BFE A;  4YWZ A;  4S2N C;  1PFL A;  1ZTU A;  5EEC A;  1GHP A;  4HBU A;  3P98 A;  3T4S A;  3UMD A;  2J80 A;  4NXE A;  3A3E A;  3HLC A;  3WRT A;  4E3M A;  4MEZ A;  2WK0 A;  2O9B A;  1WYC A;  4UQI S;  4AFI A;  4OLG A;  4LEN A;  4LRX C;  2QZ6 A;  4MBK A;  3ZYT A;  1LI0 A;  1S4S A;  2IWB A;  4QY6 A;  4IUH A;  3IT9 A;  3N8R A;  4ZJ2 A;  3DWZ A;  3CZD A;  3V3R A;  1YKD A;  2V9A A;  2KOI A;  3UDX A;  2P04 A;  2OLU A;  3PBN A;  1OT9 A;  3NBL A;  2JKR I;  4WEJ A;  2WYX A;  4R0Q A;  5TJJ A;  2QMI A;  4S2P A;  3C30 A;  2L0W A;  5FAQ A;  2QPN A;  2Y2G A;  4N1H A;  3NC8 A;  3HLD A;  5AVF A;  3V5M A;  3IX4 A;  3MFD A;  3T4T A;  4KEN B;  1YQS A;  4PPR A;  4ZTK A;  4F3L B;  1W8Y A;  4BL2 A;  2FZ0 A;  3SW1 A;  2Y2J A;  2B5R A;  4PM9 A;  4HHD A;  3D72 A;  5CGS A;  3O87 A;  1TF1 A;  4S2O A;  2PU2 A;  4ME4 A;  2Y2O A;  4E3J A;  2NUT C;  2ZD8 A;  4GHI A;  2V2F F;  4DDS A;  3V67 A;  2Y2I A;  2A2L A;  3KSG A;  4JGP A;  5FAS A;  2OV5 A;  3CMZ A;  2J8Y A;  4NK3 A;  4H8R A;  1VEU B;  2Y2N A;  3D9Y A;  4NXF A;  4R3J A;  3Q7Z A;  4FTX A;  2I9V A;  4WN5 A;  3PBS A;  3Q81 A;  4E3N A;  2IWC A;  4JKT A;  4CJN A;  1CEG A;  4KUK A;  3ZVW A;  4S2I A;  4O8G A;  1K6R A;  2EWV A;  1LHY A;  1MC0 A;  1UWP X;  4CLC B;  4Y2F A;  3MXS A;  4IVI A;  4HI4 A;  3N8L A;  4HH2 A;  2EX2 A;  2W3D A;  1FSW A;  3NIA A;  4OOM A;  4R23 A;  3DWK A;  3K3C A;  5U47 A;  2JKR M;  2VGL S;  2WAE A;  3AGF A;  4MBH A;  2H0T A;  4YNR A;  1MPL A;  1P9R A;  3WS4 A;  1K56 A;  3VSL A;  5CX7 A;  3CUE C;  4U0T A;  4JBF A;  4O01 A;  3CWF A;  4LRY C;  5C5K A;  1DP9 A;  4XUX A;  1VB6 A;  3W2Z A;  5FL3 A;  1MKI A;  1MWU A;  1SHV A;  4OP5 A;  1W63 M;  1ALQ A;  1KVM A;  3CHW P;  1KOU A;  4EWF A;  4LGW A;  2Z6C A;  4P6Z S;  1ONG A;  4QJG A;  3CG5 A;  1YLT A;  3HLG A;  5KIZ A;  3SOI A;  2WKQ A;  3HRE A;  1SKO A;  4X1L A;  3LEZ A;  1XGI A;  5F83 A;  3BFD A;  3RXW A;  5HPF A;  2ZMA A;  3C2W A;  3M6B A;  3NDE A;  1XFQ A;  2QHK A;  1J9M A;  3UE1 A;  1PI4 A;  3VP4 A;  5CTM A;  1VM1 A;  2W3H A;  2ZMV A;  1CI9 A;  4GLQ A;  2PHY A;  2XA7 S;  3SZT A;  3PAE A;  2Y8H A;  2ZC7 A;  1KDW A;  3U4L P;  3V50 A;  2GNX A;  2ZQA A;  2EX6 A;  1YMS A;  1OTA A;  1ZKJ A;  3HUO A;  5CER A;  3WWX A;  1VEU A;  4QY5 A;  1FIL A;  1XPB A;  3O88 A;  3DAV A;  3IS2 B;  2H5S A;  4R1G A;  1MKM A;  4YIN A;  1YPR A;  4HJ6 A;  1BUL A;  3GMW A;  3JPU A;  1ONH A;  2JKT M;  4L0L A;  4KQO A;  4QU3 A;  4DXB A;  5F68 A;  1TS8 A;  4CLC A;  3TW8 A;  2VX8 A;  4R3B A;  3ZG5 A;  4HQA A;  1KGF A;  4X53 A;  5FI6 A;  1KGG A;  4H6J B;  1XA1 A;  1J3W A;  4WMC A;  3WS2 A;  2XFS A;  4ESP A;  3GEC A;  1DP8 A;  2X02 A;  3SS5 A;  5DJU A;  2Y59 A;  2QJ7 A;  4JLF A;  1G6A A;  3GDI A;  1XFN A;  2EXB A;  1TDG A;  3PXP A;  1BYW A;  3FV7 A;  1WA9 A;  3F1P B;  1ES5 A;  1HLU P;  3M6H A;  2VZW A;  1BLC A;  1I2S A;  1ERM A;  2WGI A;  4ETZ A;  1A0K A;  2V0U A;  4YOF A;  3BLS A;  4DRT A;  2UV0 E;  5FQI A;  3WRZ A;  1GSW A;  1NLY A;  3JVV A;  4E3K A;  2ZC5 B;  2LB5 A;  1G5U A;  3HLE A;  4OPY A;  1S67 L;  3PBQ A;  3BWL A;  2XEP A;  3HCY A;  3A0R A;  5FDH A;  1D7E A;  1W8Q A;  5CEC A;  4KQD A;  1O7E A;  3K3D A;  2D01 A;  5J8X A;  1ZHH B;  3ZHH A;  3LO7 A;  3CJM A;  3TRC A;  3FG8 A;  2JHE A;  2VJW A;  3CPT A;  4HJ3 A;  3LI8 A;  4U0X A;  4Q0H A;  3FKW A;  1H8Z A;  3PAG A;  4RX2 A;  4GDN A;  4D60 A;  3HUN A;  5HD5 A;  3T4Q A;  3C8C A;  1MBL A;  2XQZ A;  1HZO A;  4XT2 A;  2EFU A;  2WKE A;  4OQG A;  2J9P A;  2Z6D A;  4S2N A;  5FQQ A;  3IS2 A;  2XLN A;  4OPZ A;  3UB9 A;  2VK3 A;  4Y13 A;  2HPB A;  4CQH A;  3PBR A;  3UPP A;  1H0M A;  4EUV A;  4N92 A;  2XD5 A;  5GLC A;  2W27 A;  4QPR A;  1ESI A;  2Y4A A;  5DFX A;  1NWZ A;  5TBM B;  4H6J A;  5CGW A;  2JKF A;  2EWW A;  4RYE A;  3BM6 A;  4II7 A;  3UE6 A;  1N9O A;  1F5M A;  2ZQC A;  4HNB A;  1P0Z A;  4PHT A;  2Y2L A;  1SKF A;  1YLY A;  3HLF A;  2Z2M B;  3O3V A;  4R4R A;  3LFV A;  1N9N A;  4WYY A;  4JGR A;  3N7W A;  4UA9 A;  3T1S A;  3F1P A;  1L0E A;  1VET B;  3VMA A;  3O86 A;  4EES A;  1C3B A;  5HAI A;  3MFX A;  3G4P A;  5CEB A;  1XJ6 A;  1UWN X;  3B3X A;  3C4P A;  1MXO A;  3SS3 A;  1LI9 A;  3KYQ A;  1Z09 A;  4KZ4 A;  5GHZ A;  2XH9 A;  3H7W B;  4E3O A;  1M40 A;  4JXG A;  3BYD A;  2G2W A;  2UWX A;  1S6R A;  2HGV A;  2J7V A;  5CHJ A;  1V9Z A;  2H0Y A;  3EQV A;  4X6T A;  3BEB A;  5HPI A;  2YKH A;  3L9K A;  3U2A A;  1JTG A;  1FSY A;  3HBR A;  3ZG7 B;  4DMZ A;  1T1C A;  2HDU A;  4DJ3 A;  3BFC A;  4B88 A;  5HWT A;  3BEC A;  4KUO A;  3PR6 A;  1LL9 A;  3W8K A;  4JF5 A;  2P9V B;  2XD1 A;  4NXG A;  3BY8 A;  4B9O A;  1RCJ A;  2RL3 A;  4PM6 A;  4PM7 A;  3LID A;  3UB6 A;  1HVB A;  1K0K A;  4S2L A;  4E6W A;  1G68 A;  4DE0 A;  4BJP A;  1WYB A;  4C75 A;  1KDS A;  1DY6 A;  2ZC4 B;  2IWD A;  4GJ4 A;  3ULF A;  3IWQ A;  3MBZ A;  1YLP A;  4PMA A;  5GHY A;  3MKF A;  2V8C A;  5M19 A;  1XJ3 A;  2HV1 A;  3MJQ A;  4FH4 A;  1VET A;  2X01 A;  1SDN A;  3D4F A;  3GR2 A;  3MQQ A;  3VP0 A;  3G2Z A;  3IH8 A;  2R9X A;  4M3K A;  1S1Y A;  3T4O A;  4I3A A;  2Y55 A;  4FCF A;  3FWL A;  3VP2 A;  3ZVT A;  1NLZ A;  1NYY A;  1K57 C;  1LSX A;  4DE1 A;  3B47 A;  5FDS A;  1E3U D;  2M7V A;  3PTE A;  2RCX A;  4WEK A;  3NOP C;  4BL3 A;  4FD8 A;  2W1T B;  2PR6 A;  5KSC A;  2OWJ A;  4NG2 A;  1GCE A;  4KZ9 A;  4GDB A;  4U3T A;  3SS4 A;  3H7W A;  4B4Z A;  4R70 A;  2ZMF A;  3GRJ A;  5I94 A;  5CRF A;  1K6S A;  4R3A A;  1M6K A;  4UHU A;  5HAP A;  3O5Y A;  1GSV A;  5DKL A;  2V1B A;  3RH8 B;  4BBV A;  2EX8 A;  3SH8 A;  1XKZ A;  3ITB A;  3N8S A;  4BEN A;  3VE3 A;  4P0M A;  3WS5 A;  3FPV A;  2OLV A;  2P9V A;  5E2F A;  1ERO A;  4IUK A;  4MBF A;  4IHQ A;  4L9F A;  1NZO A;  3WS1 A;  4KZ3 A;  1FIK A;  5KMW A;  5MC7 A;  5AQ9 A;  5D3O A;  4RQ9 A;  1KE4 A;  1SKO B;  2JCH A;  3MR0 A;  4WF0 A;  3VP3 A;  4IBR A;  4ZRR A;  5HAQ A;  1JWV A;  4UA7 A;  3AGE A;  5F69 A;  4OPR A;  5EVI D;  2PRF A;  3SH7 A;  5E2H A;  3OCL A;  4BD0 A;  3QP4 A;  3UPO A;  3NJA A;  3EQU A;  4ZAM A;  4FH2 A;  3S1Y A;  3E4Q A;  2ZBB A;  1P97 A;  4I39 A;  2BG1 A;  2H10 A;  3OC2 A;  2CMN A;  3C4O A;  2OSU A;  4YFM A;  4LLO B;  4K91 A;  3IHB A;  1ACF A;  2Q9M A;  3UDI A;  3ZNY A;  3DTE A;  3K2N A;  1PW8 A;  5AJG A;  3NHQ A;  2W1R A;  3UN7 A;  4PM8 A;  2V0W A;  2M1C A;  3A3J A;  4IJG A;  2W1T A;  2K2N A;  3ZCZ A;  4LV1 A;  3LR0 A;  1NZU A;  5CHM A;  1ES2 A;  4MCW A;  1TS0 A;  3CIT A;  1OJ5 A;  3ZNT A;  1XXM A;  3G32 A;  2OOL A;  5L07 A;  1KE3 A;  2GDN A;  1ZG6 A;  4G3K A;  3C7U A;  3BQ8 A;  5M1A A;  4QHC A;  4LPZ A;  2ZQD A;  3IWI A;  3PBT A;  5EOO A;  5HFO A;  4B93 A;  4EET B;  3HUM A;  4UAA A;  1BUE A;  3E2L A;  2WAD A;  3QP8 A;  1E4D A;  3S7O A;  4R6L A;  4DXC A;  3Q1F A;  3S22 A;  3LY4 A;  4KZ8 A;  4MMN A;  1ESU A;  1Z6F A;  1ZG4 A;  4LV3 A;  1IYO A;  4OP8 A;  1KVL A;  1Y4O A;  2HP5 A;  4LCL A;  4Y15 A;  3VE4 A;  5FQK A;  4JF6 A;  5HL6 A;  4JXS A;  3NDG A;  1K4F A;  2ZQ8 A;  4KZB A;  2PYR A;  5FQ9 A;  2R9W A;  1MWS A;  4PM5 A;  2J9O A;  2WZZ A;  1MWR A;  1PZP A;  5J3W A;  2HP9 A;  2V1Z A;  4OQI A;  3DTM A;  5I5L A;  3RXX A;  5L09 A;  4EEP A;  4HJ4 A;  5IU1 A;  4NET A;  4WZ5 C;  1IFQ A;  2PU4 A;  3CPT B;  1OTB A;  2GJ3 A;  3NI9 A;  4K08 A;  1FR6 A;  1TS6 A;  2HDS A;  3RJU A;  4X69 A;  1JWP A;  5LBR A;  1QMF A;  5F82 A;  3IQA A;  5J4E A;  1GHI A;  1RGY A;  3B33 A;  3PBO A;  2NUP C;  4XT2 B;  3T1X A;  4P6B A;  3DTI A;  3M2J A;  3HJI A;  3PHY A;  3HLB A;  2KX6 A;  1HD8 A;  2AVX A;  4IBX A;  4R38 A;  1DJC A;  4DE3 A;  4WM9 A;  4GB7 A;  3QP6 A;  2DMW A;  5EE8 A;  4KG2 A;  1XA7 A;  2WAF A;  1GHM A;  1FCO A;  2VGK A;  4DKI A;  3C7V A;  1OPX A;  3ZG9 B;  4HIA A;  5FAP A;  3TJZ C;  3KYE A;  2B95 A;  2E8I A;  1I5Q A;  2KDK A;  3I7J A;  4DN0 A;  3EOI A;  3GQZ A;  3IXD A;  2YKF A;  2ZOI A;  2V1A A;  3W4Q A;  4KG6 A;  4KZA A;  5FQJ A;  1DJB A;  1EWZ A;  2PR5 A;  4OOY A;  2WKH A;  3FC7 A;  3FPW A;  5TR7 A;  4A5R A;  3ICY A;  4Z1W A;  4F94 A;  4HES A;  5HX9 A;  3KSH A;  2P08 A;  4P87 A;  2VEA A;  1RP5 A;  1S66 L;  3T4L A;  4JGO A;  1T1A A;  3UNW A;  1YMX A;  4RA7 A;  3OPP A;  3LR4 A;  5G4Z A;  1GSX A;  4HP9 A;  3QNC A;  1W79 A;  4X25 A;  4QWO A;  3LI9 A;  1L2S A;  5L10 A;  4Q8I A;  4EUZ A;  3IXG A;  5A8B A;  2BTF P;  3S7Q A;  2ZM8 A;  4L9E A;  4KZ6 A;  3ZDJ A;  3OBF A;  4ZBE A;  1W63 Q;  1NRF A;  2HP6 A;  3LYX A;  1YAX A;  2WUQ A;  3MF0 A;  3NEC A;  1MZU A;  1VQQ A;  1K57 A;  3LGO A;  2V8F A;  1P9W A;  4I3I A;  1N9L A;  3HJK A;  1K56 D;  1N9B A;  1K38 A;  2G7U A;  4Z9Q A;  5M18 A;  3D3O A;  3TSG A;  4OOL A;  5FAO A;  2VV7 A;  2VGJ A;  3F1O B;  1BLH A;  3JYI A;  4PKY A;  3MQO A;  4LV2 A;  2A3U A;  3LEQ A;  3P7N A;  4O7D A;  2PBD P;  4Q0I A;  4PKY G;  5EM1 A;  3EEA A;  4OQ0 A;  2EXA A;  5A92 A;  4WL9 A;  3MQ0 A;  4FSF A;  3VP1 A;  2VLG A;  2ZOH A;  2Y2P A;  1PW1 A;  1ES3 A;  5HSQ A;  5HDS A;  4B4X A;  2IA2 A;  1XJ4 A;  2HF6 A;  1BTL A;  3OLO A;  2Q0O A;  5HD3 A;  5FI7 A;  5TGF A;  4DJ2 A;  2A24 B;  5HL1 A;  1OTI A;  1G6O A;  2I72 A;  2E8J A;  2FFY A;  3L7H A;  3NCK A;  3H9W A;  4GZB A;  3IBR A;  4HBT A;  3UE3 A;  2JC7 A;  1LL5 A;  3G2Y A;  1K4E A;  2XRN A;  4OLD A;  1K54 C;  2JBF A;  1X0O A;  4UEY A;  1W5D A;  2EX9 A;  3EWK A;  3R4K A;  5FQM A;  5F6A A;  2W3G A;  2OWH A;  4GS9 A;  2WGW A;  5JYP A;  4ZJ3 A;  4C3Q A;  3EGD C;  2Z2L B;  3ITA A;  1PWC A;  2FFF B;  3EEH A;  4L9G A;  3R7W A;  3VV4 A;  4WEL A;  1DP6 A;  2QKP A;  1FCM A;  4CLC D;  4X68 A;  3UB7 A;  3G30 A;  4WMC D;  3A3D A;  3NOU C;  5DKK A;  3OPH A;  3EGX C;  4OON A;  3P01 A;  1LSW A;  1Y28 A;  3W4O A;  4ID4 A;  1T19 A;  3OPR A;  2QYB A;  4GKU A;  2VA0 A;  2XRO A;  4KZ7 A;  3VOL A;  4EV4 A;  1TS7 A;  3IHA A;  1LT0 A;  4EU0 A;  3F1O A;  4BBU A;  5L8M A;  4DF6 A;  3OOV A;  5E43 A;  2K31 A;  5CXW A;  2O99 A;  4QB8 A;  4KQQ A;  3KSI A;  5G4Y A;  4Y0T A;  2J3T D;  2WKI A;  3E4P A;  5EM0 A;  3VSK A;  1GA0 A;  1H5X A;  4N9L A;  3LIA A;  4DDY A;  1F2K A;  1IYS A;  4D2O A;  4I5S A;  3UY6 A;  1Y54 A;  3Q7V A;  3C5A A;  4GOG A;  5GLA A;  3T12 B;  4ARZ B;  1L0G A;  2A24 A;  2C6W B;  1SCW A;  4OPQ A;  3G31 A;  3VFF A;  1BLS A;  3UB8 A;  1K25 A;  5E2E A;  4KZ5 A;  1YSQ A;  2JKG A;  3MMH A;  5HDD A;  2HZ5 A;  5E2G A;  2WZX A;  1ZC2 A;  2G2U A;  2PD8 A;  1T1B A;  4EBL A;  1JWZ A;  5HW3 A;  4ZDX A;  4BQM A;  3S4X A;  1KGE A;  4C6Y A;  2O9C A;  4WZ5 A;  4G3W A;  3MZE A;  1JNU A;  1Q2Q A;  2H28 A;  3KYZ A;  3N6I A;  1YLZ A;  3ZG0 A;  3LUQ A;  3DTK A;  3P09 A;  5EPH A;  2D02 A;  4ETX A;  3IXB A;  2MJ6 A;  5FAT A;  4MDZ A;  3VOY A;  1PI5 A;  2OAQ 1;  1TDL A;  3DW0 A;  4HOI A;  3BRM A;  3LR5 A;  4K0X A;  4GD6 A;  5DJT A;  2B02 A;  4OKP A;  2ZC3 B;  2P74 A;  5EVI C;  1U60 A;  1S4R A;  5AVE A;  5FI2 A;  5FEF A;  3QHY A;  4EW7 A;  3TE8 A;  1AWI A;  5GHX A;  2ZLY A;  1PIO A;  2W3F A;  2B18 A;  4E04 A;  1IOU A;  4CLC E;  1L0F A;  2WGV A;  2JE5 A;  4FUW A;  2Y2H A;  1BSG A;  2A49 A;  4R4S A;  4GN2 A;  1CF0 A;  2VV8 A;  2XDM A;  3G34 A;  1FOF A;  4CPK A;  1H8M A;  5DF9 A;  3TG9 A;  4ARZ A;  4LFU A;  5HWV A;  4UA6 A;  4HEF A;  2PT7 A;  2Y79 A;  4KG5 A;  4FOF A;  4S2J A;  5KSH A;  1OME A;  4MN5 A;  4M4X A;  1L0D A;  4E3L A;  4S2K A;  5EFW A;  5F1G A;  1S0W A;  5GLB A;  3T1Q B;  1CQA A;  3A0V A;  1AXB A;  5A93 A;  5EV0 A;  1RGZ A;  4DE2 A;  1DRM A;  3ZGA B;  3NY4 A;  3F1N B;  1XJ2 A;  4JXV A;  4MN6 A;  1FCN A;  4LRZ E;  1ERQ A;  3JVU A;  5DTT A;  2GZA A;  1IEL A;  2HDR A;  3PYP A;  3E4O A;  4E6X A;  5A91 A;  4Y0U A;  2JKT I;  4JGQ A;  3VFH A;  2P7J A;  3ISG A;  3GTC A;  2PDR A;  2PYP A;  1UGU A;  2XGN A;  4ZJ1 A;  1D1J A;  2V20 A;  3IF6 C;  4MN7 A;  3BQA A;  4GCZ A;  4Y0O A;  2LB9 A;  2BAS A;  3C38 A;  1CI8 A;  3KX0 X;  5EVE A;  1F9I A;  4QD4 A;  5A90 A;  3UE0 A;  4MLL A;  4NXB A;  3IXH A;  2XK1 A;  2M7U A;  3B42 A;  2ZM0 A;  5G18 A;  1L3L A;  4F3L A;  1IKG A;  1PWG A;  4I3J A;  5IHV A;  2ZM2 A;  3QP5 A;  4RX3 A;  3HLW A;  1N4O A;  1NYM A;  4Y17 A;  3KSF A;  1D06 A;  4XXR A;  3IH9 A;  1IYP A;  3FYZ A;  3QP2 A;  2HDQ A;  3NOT C;  2KLI A;  3WS0 A;  4N1X A;  3H82 B;  3MZD A;  4K0W A;  3A3F A;  4GNU A;  1MY8 A;  3A0S A;  4S2M A;  2WKR A;  3OCN A;  4X1M A;  2XFT A;  4BLM A;  4P85 A;  2L4R A;  2DRW A;  1OJG A;  2INW A;  5DVA A;  1E25 A;  1K54 A;  4G3V A;  4BMW A;  3LIF A;  5HAR A;  3FZC A;  3E2K A;  1TD5 A;  2GX5 A;  4GD8 A;  5EVL A;  1H3Q A;  2L1M A;  3LCE A;  3E0Y A;  3F1N A;  3CAX A;  5J7E A;  3IX8 A;  2QWS A;  4JPM A;  1F98 A;  3MXR A;  4I38 A;  4EQ1 A;  2HJ9 C;  2XSS A;  5FA7 A;  1V9Y A;  4OH0 A;  1LSV A;  3LIE A;  3T4K A;  3LIB A;  1BZA A;  4E3I A;  1BT5 A;  5FEG A;  5EVI B;  4PAU A;  1ES4 A;  3KO6 A;  4Y3I A;  2FH5 A;  2O9A A;  3G6O A;  4BBT A;  3DBA A;  1JTD A;  1OT6 A;  2VV6 A;  3IF5 A;  2XF3 A;  1JVJ A;  3Q07 A;  3OPL A;  1CK3 A;  1Q2P A;  3W4P A;  3SH9 A;  5DFY A;  4GS9 B;  2WGW B;  3LY3 A;  5HWW A;  1STZ A;  3A3I A;  1I2W A;  1BLP A;  2O0Y A;  1GA9 A;  4Y5F A;  3R7W B;  3MSH A;  5AQB A;  2Y2Q A;  4EBP A;  4UQI M;  1E3U A;  3HVF A;  5IT5 A;  5AQA A;  2EFX A;  1SDE A;  5DF8 A;  5TFQ A;  3BY9 A;  4HH3 A;  1PYY A;  1W7F A;  3H82 A;  5IS1 A;  1OTE A;  3LIC A;  4WLA A;  1K55 A;  4WUJ A;  2R78 A;  3CI6 A;  1EW0 A;  4LCM A;  4NKP A;  3NUL A;  2J3W A;  4MNR A;  2C5W B;  3HL9 A;  3ZQ5 A;  1TEM A;  2DCF A;  4BD1 A;  4N9K A;  2JN7 A;  1XX2 A;  3QP1 A; 
#chains in the Genus database with same CATH homology
 3CPT A;  5FDS A;  1YPR A;  5EM0 A;  3CPT B;  1PRQ A;  4D60 A;  1D1J A;  1F2K A;  2ZL1 B;  1ACF A;  2E8J A;  3L7H A;  1J3W A;  3T1R A;  5FEG A;  3L9K A;  4FUW A;  3T12 B;  4ESP A;  2VK3 A;  2PAV P;  5EVE A;  3T1X A;  4X25 A;  4QWO A;  1CF0 A;  2ZL1 A;  2BTF P;  2JKG A;  2JKF A;  2HZ5 A;  3CHW P;  3UB5 P;  1HLU P;  1K0K A;  3NEC A;  3MS6 A;  3LGO A;  1PNE A;  2V8F A;  2ACG A;  1A0K A;  3T1S A;  1SKO A;  3MSH A;  4X1L A;  1SZV A;  3KYE A;  1VET B;  1CJF A;  2B95 A;  1FIK A;  3T1Q B;  1CQA A;  1SKO B;  1PFL A;  4X1M A;  5EV0 A;  1Y4O A;  1G5U A;  2V8C A;  2PRF A;  1VEU B;  3D9Y A;  3LEQ A;  2PBD P;  1VET A;  5EM1 A;  4FTX A;  3U4L P;  3NUL A;  1Z09 A;  5FEF A;  1VEU A;  1FIL A;  3DAV A;  1AWI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...