5FEGA

Crystal structure of the dimeric allergen profilin (hev b 8)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
130
structure length
130
Chain Sequence
SWQAYVDDHLMCEIEGNHLSAAAIIGQDGSVWAQSANFPQFKSEEITGIMSDFHEPGTLAPTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNQALIIGIYDEPMTPGQCNMIVERLGDYLIDQGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Allergen
molecule keywords Profilin-2
publication title Structural insights into the IgE mediated responses induced by the allergens Hev b 8 and Zea m 12 in their dimeric forms.
pubmed doi rcsb
source organism Hevea brasiliensis
total genus 29
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00235 Profilin Profilin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 5fegA00
1YPRA 2PBDP 1CQAA 2PAVP 3CPTA 2B95A 1PFLA 5EV0A 2VK3A 1FILA 5EVEA 2E8JA 4QWOA 4X1LA 1SKOB 2ZL1B 3T1QB 1CF0A 1HLUP 2JKFA 1A0KA 5EM0A 3DAVA 3T1XA 1Z09A 1K0KA 3L9KA 3LGOA 1J3WA 4D60A 1SZVA 3MS6A 3NULA 1VETB 1VEUB 3CHWP 4FTXA 5FEGA 1SKOA 2ZL1A 3CPTB 1CJFA 1G5UA 4X25A 2ACGA 1Y4OA 1PRQA 3D9YA 3T1RA 1FIKA 1ACFA 3UB5P 3T1SA 3MSHA 5FDSA 1AWIA 1F2KA 3NECA 1D1JA 1PNEA 4X1MA 2V8FA 4ESPA 5FEFA 2V8CA 4FUWA 3KYEA 3U4LP 2PRFA 2JKGA 5EM1A 1VETA 3L7HA 2BTFP 1VEUA 3LEQA 2HZ5A 3T12B
chains in the Genus database with same CATH superfamily
5EVIC 4WMCD 3RXWA 4O0PA 1K6RA 4JF4A 1K54C 1D06A 2P08A 4OP8A 4X56A 2PD7A 3OLOA 3VP0A 3O87A 1C3BA 1MY8A 1YLJA 3CI6A 4BLMA 1WYBA 3ITAA 3HL9A 4GLQA 2Y2HA 5HARA 4X53A 2ZQ9A 3GR2A 4GDBA 3WS5A 2K2NA 1J3WA 1KOUA 2WKHA 3KSIA 2D02A 3P98A 3VV4A 3MR0A 3BY8A 1CEFA 4R4RA 3E4PA 1SCWA 4JKTA 3PYPA 2FZ0A 4MEZA 2XSSA 3OCNA 3GV9A 3M2JA 4WZ5A 4G3KA 2R9XA 3H7WA 1XA1A 1K4FA 3ZG8B 5I94A 2Y2JA 1KVLA 4L9FA 3JYIA 3OBFA 3GSGA 1TS6A 2ZM0A 4FD8A 4BMWA 3EQVA 4N1XA 2Q0OA 1GHIA 2IWCA 1KE3A 5IS1A 3O88A 2W3GA 3A3JA 3EOIA 1TS8A 2V8FA 3UY6A 2PYRA 3OZHA 3E98A 4KZ8A 5DF7A 5CXWA 3SH8A 2HV1A 1OJGA 2XD5A 5DF8A 4P6ZS 3LEQA 3QP8A 3A3DA 3MBZA 2WADA 3C8CA 2ZBBA 3T4JA 1L0DA 1TS0A 1FCOA 4MBKA 4Q0JA 2EFUA 1ALQA 4MBFA 1IFQA 5FQMA 5IU1A 3MQOA 5IT5A 4RQ9A 5HX9A 4YWZA 3LEZA 2EWVA 1XJ3A 1ESUA 3UB7A 4DN0A 1YLYA 1TD5A 1XP4A 4H6JB 1SKFA 4HNBA 3ZNYA 1UWNX 4RYEA 2B02A 3WS2A 4ETXA 3N7WA 4UAAA 4Y17A 5AQ7A 1S4SA 2V0UA 5JYOA 3IF6B 4UEYA 5GHYA 1CI9A 3LR0A 1LHYA 3V67A 4A5RA 5CRFA 3NC8A 4GN2A 4S2LA 5HL6A 2ACGA 4Q0IA 3IT9A 4GZBA 1QMFA 4GKUA 2FH5A 3UB9A 4LPZA 3UB5P 4R6LA 3HVFA 5FDSA 1STZA 3Q7VA 1JWZA 4OQHA 2Q9MA 1S4RA 2A24B 2W3DA 2ZMFA 4DF6A 4X69A 1MC0A 1XGIA 3PBRA 5TGFA 1RGYA 4Q8IA 1CI8A 2PT7A 1T1CA 3BYDA 3T4LA 2PBDP 3A0SA 1CQAA 2Y91A 3B47A 3TW8A 3KSGA 3DTIA 3G30A 3TOIA 3TE8A 2VK3A 5EE8A 4H8RA 5KIZA 3NIAA 5HWVA 4I38A 5CEBA 4HOIA 4MNRA 5FQKA 3FYZA 1PWDA 5U47A 3T4QA 4F94A 3N4IA 2B18A 2XD1A 4E3NA 4HEFA 1NRJA 3IXDA 1W7FA 1OTEA 4EERA 2WZZA 1T1AA 3BFDA 1IYSA 3HLEA 1XJ6A 3CUEA 4S2PA 5FI6A 1OTDA 1W8QA 1DY6A 4Z9QA 3LIFA 3LIAA 2R9WA 4HBTA 3IX8A 1OT6A 2A49A 5FASA 2QYBA 1N9OA 4QD4A 1KGEA 2XDMA 4C75A 5HL1A 3LR3A 4QB8A 4Y5FA 1TDLA 4II7A 3OPPA 4Q0HA 2Z2LB 4E3JA 4H6JA 3Q81A 5J7EA 4PAUA 3HLBA 3HUNA 3KYEA 1YLZA 1QMEA 4QY5A 3MQQA 3IF6A 2XF3A 1GSWA 2ZMVA 3HLDA 1YKDA 5K5BA 2HDRA 3HLFA 4OH0A 4QPRA 4KG2A 3LO7A 4NK3A 2J3WA 2EFXA 3JVVA 1UWPX 3LIBA 3S7QA 2D01A 4E6XA 5EPHA 2AVXA 3AGDA 3BY9A 4UQIM 3FZCA 3TJZC 1YQSA 4GW9A 3GRJA 1VM1A 4PMAA 3IS2B 3RXXA 1I5QA 5DTKA 2A24A 2C5WB 1LL9A 5IHVA 4XXRA 4OLDA 3PBNA 2J7VA 4EETB 4WBGA 5F68A 2XH9A 3D4FA 5HAPA 5CGSA 2OAQ1 3PBSA 4NXFA 5G4YA 1ES4A 1MWRA 3E4QA 5FATA 3UMEA 4K08A 4KZ7A 1D7EA 5DTSA 3IX4A 3M6BA 3CAXA 4FTXA 3EEHA 3FWLA 3MF0A 4ETZA 4U0TA 3KX0X 5HZHA 3IH8A 5L2FA 1S1ZA 5FDHA 3OPLA 2Y2IA 1E3UD 1JNUA 4HJ4A 2WKRA 4R3AA 4GB7A 1LLBA 2KOIA 1XJ2A 2IA2A 1MKIA 1ODVA 4PKYG 4KZBA 1K57C 2PDRA 4LLOB 3KYZA 4NETA 3BM6A 3HJKA 5A8BA 2O9BA 2UV0E 3V50A 3WRZA 1TEMA 1ES5A 1ZHHB 3F1OB 3Q82A 3ZYTA 4HH3A 3HUMA 4DE3A 1K4EA 4L9EA 2HJEA 1SKOB 4OQIA 2EX8A 3W2ZA 3MXRA 1CF0A 4ZAMA 1F9IA 4N92A 3PHYA 4X55A 5HFOA 3R4KA 3QP6A 5F1FA 1O7EA 2EX9A 3JPUA 4P87A 3MXQA 2A2LA 1MZUA 2XR0A 4XUZA 1LL8A 2NUPC 3RH8B 3BQAA 2H10A 1K56A 4Y13A 2B5RA 2HP9A 1WA9A 1VEUB 5DFXA 5M1AA 1ESIA 4X68A 3S1YA 5FEGA 3VP2A 3CPTB 4KENB 1ERMA 3BEBA 1MWUA 5TFQA 3ZNTA 3MFDA 5FAPA 2INWA 3D9YA 4FH4A 5FI2A 3ZG0A 4ID4A 1FQGA 3PAGA 2W3FA 1F5MA 1LL5A 2OLVA 3C7VA 3K3DA 4S2IA 1ZKJA 4L9GA 4BL2A 3DWKA 4MMNA 1H0MA 4YNRA 4ESPA 4F3LB 2ZQDA 3JVUA 4OPQA 2QKPA 2W0NA 3SH9A 2EXBA 2HGVA 5CGXA 5F5YA 2V9AA 2RL3A 4OONA 3GMWA 2ZOHA 1WE4A 3BFFA 4WZ4A 4KZ6A 3KO6A 3T4KA 4EBNA 1ZG4A 2XA7M 1PZPA 2CC1A 4HY8A 3UB6A 2HDQA 4EV4A 1YMXA 4JF5A 3A3FA 3PBTA 1I2WA 3GQZA 3LI8A 5LBRA 1N9BA 2VKSA 1G6AA 1EROA 4E3LA 4O7DA 1GHPA 2PR6A 5CHUA 2PD8A 4E3KA 3ZHHA 5A90A 5BOHA 4IEDA 1GA0A 4LCLA 3I7JA 1FOFA 3F1OA 2X71A 4JLFA 2WGWB 3VSLA 3VSKA 1K55C 3G6OA 3N8LA 2OOLA 5E2HA 4R38A 5FQQA 3Q7VB 2V2FF 1SKOA 4CLCD 3K3CA 1CJFA 1YAXA 2J8YA 1MBLA 2QJ5A 2KDKA 3NOPC 2J9OA 3FC7A 3NOUC 5MC7A 2X01A 2PHYA 1P9WA 4MCWA 1D1JA 5FAOA 1S6RA 4GOGA 5HAIA 1H8MA 2Q9NA 1MPLA 4RX2A 3CLOA 4LV0A 3Q1FA 4IBRA 1VEUA 2H0TA 3A3EA 3P7NA 3SS3A 5G18A 3VP4A 1M6KA 1OTIA 2JBFA 3UE3A 4PM6A 5DJUA 5AQ9A 5F6AA 3CPTA 2BASA 3PTEA 4OPRA 1ZTUA 4CQHA 5I5LA 1KVMA 1IEMA 5GLDA 3DTMA 2ZL1B 2WK0A 3NDEA 3M6HA 5DKKA 1ERQA 2EA9A 4LV2A 2DNSA 4F3LA 3LY4A 2WYXA 3HCYA 2HP5A 4PHTA 3N6IA 4HHDA 4S2NA 2XLNA 1DJBA 3QHYA 3BFGA 1BLSA 1EI5A 3K2NA 4MBHA 1FR6A 1PWGA 3KSFA 1G68A 3LY3A 3R7WB 2M1CA 4OQ0A 5EVIB 4DXCA 4KQQA 1FCMA 1VB6A 4QY6A 4S2KA 4KQDA 1XXMA 1JWPA 5CTNA 4BQMA 1W8YA 3QP1A 2DCFA 3N8SA 4UA7A 4QJGA 2PBYA 2ZD8A 3T50A 1LI9A 1AXBA 2XK1A 1IYQA 2L0WA 1M40A 1H5XA 4R4SA 2CMNA 2EX2A 2GDNA 4ZDXA 2IWBA 1BZAA 3E2LA 5HWWA 1Y28A 2WGWA 2XFTA 2QHKA 4M3KA 1TF1A 5EM1A 4Y15A 3RJUA 2WGIA 4IBXA 1DP8A 3O5YA 4G3WA 5J4EA 4WF0A 1YPRA 3OCLA 1S0WA 1JTGA 4NXEA 5D3OA 3V3RA 1N9NA 5EV0A 2Y2PA 3QP5A 4DXBA 5EVLA 3WS0A 4EBLA 1KGGA 1RCJA 1E4DA 4MDZA 1LSWA 3ZVWA 5J3WA 3ZGAB 1CK3A 1X0OA 1H3QA 1S1YA 1TVFA 4HBUA 1E25A 5GHZA 3PBQA 3GVBA 2Y2GA 3VE3A 3C4OA 4N9LA 1O07A 2Y55A 1S66L 5FQ9A 1SZVA 5CERA 4PM8A 2XQZA 1K25A 4LRYC 1H8YA 4Y2FA 1ES3A 1KDWA 3S7OA 1BLHA 3RTYA 4YINA 2W3EA 5HPIA 4HESA 2ZM2A 2ZL1A 3ICYA 5M18A 2RCXA 4X25A 1ZC2A 4ZJ3A 1Y4OA 4UA6A 1XJ4A 4BBUA 3IF5A 3G35A 1Y54A 2WUQA 1F2KA 1PI4A 3BW6A 5TR7A 4X1MA 5F82A 3P01A 4GDNA 3NCKA 4PM9A 3R7WA 3IBJA 4BL3A 2O9AA 5EVIA 4AFIA 2JCHA 3B3XA 3V39A 2HDSA 4IUHA 3NI9A 3ZG9B 5A92A 1T1BA 1K54A 2BG1A 2ZC5B 3VP1A 2C6WB 2JC7A 2H0YA 4B93A 4CLCC 4GNUA 1SHVA 1BTLA 3AGFA 4IUKA 3PXPA 4GD8A 4FSFA 4E3IA 4KZ5A 1PYYA 1P0ZA 4U0XA 2GJ3A 4I39A 1DJAA 2FFYA 5AJGA 4KZAA 3G31A 1XPBA 5TBMB 3IXHA 3VOZA 2JHEA 2PR5A 5KZHA 3DAVA 3KYQA 3HLGA 3CG5A 4XT2B 4MLLA 2OLUA 3LGOA 1F98A 1N9LA 1OT9A 2H5SA 2Y2MA 5DF9A 2UWXA 3WS1A 3CWFA 2XGNA 2KLIA 2YKHA 2H28A 3A3IA 3CHWP 3D72A 4UHUA 4OVDA 1MWSA 1FCNA 4OQGA 4B88A 4EU0A 3BJNA 1E3UA 1NLYA 4WZ5C 4KG6A 2P7JA 3U2AA 3NECA 3SOIA 2VZWA 1PNEA 2L1MA 1XGJA 2DMWA 4MN6A 3T4TA 3VOLA 4DDSA 1NWZA 1KGFA 1W63M 4RA7A 4S2MA 2PRFA 1KDSA 4RVAA 4LFUA 4IVKA 5HDDA 1ES2A 5DVAA 4CPKA 2JKTM 4EEUA 3MZEA 3C7UA 5F69A 2J80A 3KSHA 2W1TB 4UQIS 2Y2QA 3LR4A 3ZQ5A 1YT4A 3BECA 2HP6A 3VMAA 3BLSA 1JTDA 2XFSA 5CX7A 1KE4A 3GDIA 4KUKA 2EXAA 4WLAA 4Y0TA 4OOLA 3C4PA 2ZQAA 4GD6A 3DW0A 4KQRA 1LSXA 1T19A 1XX2A 4N9KA 1Z09A 5C5KA 1HZOA 1K0KA 1NZOA 1PW8A 2VV6A 3F1NB 3MMHA 4B4ZA 3Q7ZA 1OPXA 2J3TD 1W5DA 3IH9A 1XA7A 3UE6A 1MKMA 1OMEA 1FSWA 1PI5A 4NEED 3CMZA 3GECA 5CEDA 3UB8A 3N8RA 3S7NA 4C6YA 1KE0A 3OOVA 3M2KA 3MXSA 4LCMA 5FSRA 3G4PA 1IELA 1OTAA 5TBMA 4JGPA 5EECA 3T1SA 4WYYA 1Q2QA 3O3VA 1Z6FA 1N4OA 4KG5A 5DJTA 1CEGA 1J9MA 2W1RA 3ZG5A 2OWJA 3S22A 3C30A 4XT2A 1LSVA 3A0RA 4PKYA 3ZCZA 5FEFA 2VGLS 1SDEA 3W8KA 4P6BA 3IQAA 2PU4A 4R70A 5EFWA 2FFFB 3G2ZA 5FAQA 4GS9B 4MN7A 5CHJA 2HZ5A 2Y4AA 1A0KA 3C38A 3MKEA 4GJ4A 1W63Q 1HVBA 3FKWA 2OWHA 1S67L 1K56D 3IBRA 2ZQ8A 5EVEA 5L07A 1DP9A 2JKRM 2PYPA 1V9ZA 4OKPA 2GX5A 4EWFA 2OAP1 3IWOA 2ZQ7A 3W4OA 3FV7A 1NJ4A 4UA9A 4JXWA 4NXGA 2M7VA 3B33A 4I5SA 3UE0A 2WZXA 4WMCA 4EW7A 3LYXA 3IXGA 4E6WA 4CLCE 4JXSA 2ZLYA 1L3LA 2NUTC 5M19A 4LRXC 3EWKA 2W1TA 3NULA 5HW3A 2Y79A 4ME4A 5AQBA 3LUQA 3ZG7B 1U60A 1OJ5A 4WUJA 3T4SA 3EQUA 2VGKA 3ZFZA 3CUEC 1YLTA 3D3OA 4HH2A 3PR6A 1XKZA 2Y2OA 5EUAA 2JKTI 4I3JA 1IKGA 4O01A 2QZ6A 1IYOA 3BFEA 3F1PB 2VJWA 3PBOA 1I2SA 3F1NA 3VFFA 5HSQA 5GL9A 4ZRRA 2V8CA 3ISGA 1FR1A 1PW1A 1ZG6A 3V3SA 1DP6A 3IX3A 2BTFP 3H9WA 3UO9A 2XA7S 2ZOIA 4U3TA 2QWSA 5L10A 3SS4A 4P6ZM 3FG8A 4OPZA 2G2WA 1LT0A 2B95A 4IVIA 3IF6C 2BLSA 2K31A 3LIEA 3DWZA 5FA7A 1XFQA 1UGUA 4K91A 4FCFA 4HIAA 3T1QB 5AQAA 3LR5A 2VV7A 1YSQA 3BFCA 2P9VB 4EQIA 4HQAA 5DFYA 1K38A 4GCZA 1NLZA 5GHXA 1G6OA 3T1XA 4GS9A 3ZVTA 2I72A 4S2JA 2G2UA 5FL3A 5KSHA 4D2OA 5HDCA 1NY0A 4LGWA 2XEPA 1XFNA 3UE1A 1VETB 3FKVA 1BUEA 4O8GA 1L0GA 3LIDA 1BULA 4JXVA 3EGDC 2VX8A 3SZTA 2HPBA 5FQJA 3E2KA 1HTZA 1PRQA 4P85A 4P0MA 5G4ZA 4ARZB 1K57A 5HD3A 1AWIA 5A93A 2ZJ9A 2QPNA 3ULFA 2Z6DA 3MFXA 3UMDA 3LI9A 4DE0A 1L2SA 5E2EA 4FUWA 4BENA 1VQQA 3MQ0A 5L8MA 2JKRI 2J3TC 4HJ3A 4BBVA 4BJPA 2Y2LA 2R78A 4LRZE 3UDIA 3MZDA 5DTTA 2P74A 4EXOA 4HP9A 4EQ1A 1GSVA 2PAVP 3H82B 5E2FA 2Y8HA 3TG9A 1TS7A 2VGJA 3A0VA 5DKLA 4WEKA 4QWOA 4EEPA 1YLPA 2LB9A 4E3OA 3IHAA 3F1PA 3WS4A 4OPYA 1HLUP 2G7UA 2HDUA 2VEAA 2KX6A 2ZM8A 2J9PA 3E0YA 5GLAA 1DRMA 1T18A 5A91A 1PWCA 4RX3A 2V1ZA 3HLWA 4KZ4A 4OP5A 2O0YA 4YOFA 3WRTA 4WN5A 2JN7A 4PM5A 4JGRA 4NXBA 2M7UA 2ZC4B 3W4QA 3G2YA 1EWZA 3MS6A 4IHQA 3NJAA 4MN5A 1IOUA 3QP4A 3UNWA 3VOYA 3CZDA 4DE2A 3PAEA 1G28A 4JXGA 4S2OA 3VP3A 5F1GA 4LENA 2P9VA 3S4XA 4Y3IA 1GSXA 4XUXA 1V9YA 4G3VA 4R23A 4CJNA 4EBPA 4B4XA 4K0WA 2A3UA 2ZMAA 4HP4A 4KZ3A 4ZBEA 1JWVA 2V1BA 1VETA 4X6TA 3UN7A 4K0XA 3G34A 4E04A 2VLGA 1P97A 2ZQCA 3B42A 4Y0OA 3T12B 4N1HA 2IWDA 4DE1A 3UDXA 2LB5A 1H8ZA 3Q07A 3C2WA 1SDNA 2W27A 4E3MA 5KMWA 4ARZA 3EEAA 3T4OA 4HI4A 1NYMA 2DRWA 5E2GA 3FPWA 1IKIA 5EM0A 3MZFA 4WL9A 1K55A 3NY4A 1Q2PA 5JYPA 3L9KA 3UPOA 2QMIA 3OPHA 3QNBA 4LV1A 4DRTA 2L4RA 3IXBA 3H82A 2HF6A 3EGXC 3BWLA 1YM1A 4OOMA 1LI0A 4FOFA 2ZC7A 3IWIA 5EVID 4NG2A 1MWTA 2EWWA 4JGQA 4EESA 3UPNA 1ONHA 3TSGA 3NDGA 3HUOA 3NHQA 3CJMA 3T1RA 1FIKA 1ACFA 1BSGA 5FQIA 3MSHA 2MJ6A 2K7SA 3UPPA 4JBFA 4C3QA 2JE5A 2OV5A 3E4OA 3HBRA 4BD1A 3AGEA 5EOOA 5HPFA 3SH7A 3DBAA 3HLCA 3L7HA 4I3IA 2O9CA 3WWXA 5CECA 4OLGA 3LCEA 4HJ6A 3QNCA 2V1AA 1BLCA 1W79A 1TDGA 4R0QA 4PPRA 4L0LA 3HJIA 1FILA 3OC2A 2E8JA 4X1LA 5FI7A 2W3HA 4QU3A 4ZTKA 2WKEA 4GHIB 5HWTA 5CGWA 5J8XA 5F83A 3ITBA 1NRFA 3C5AA 3NOTC 2VV8A 1EW0A 4BD0A 1JVJA 4JGOA 4WEJA 1NZUA 4PM7A 3BQ8A 4OOYA 5CHMA 3GTCA 4D60A 4JPMA 4Y0UA 3NBLA 4S2NC 4CLCB 4Z1WA 1IYPA 5GLBA 2XROA 1RGZA 3DTEA 5KSCA 4BWIA 3BLMA 4JF6A 4I3AA 1BYWA 2ZC3B 5HDSA 1G5UA 4R3BA 1HD8A 3G32A 1VHMA 1BLPA 4FH2A 4KUOA 3HREA 2VGLM 3CITA 1L0FA 1P9RA 2WKQA 2WAFA 1K6SA 3W4PA 4LV3A 3ZDJA 1YMSA 5E43A 2VA0A 2XRNA 3U4LP 4IJGA 2JKGA 3V5MA 2PU2A 3P09A 3UDFA 3MKFA 1GA9A 5HD5A 1RP5A 4KZ9A 4BBTA 3VE4A 4WM9A 4DKIA 1YSPA 5GLCA 4DDYA 1PFLA 3S7PA 1GCEA 2OSUA 2EX6A 5AVFA 3H7WB 3LICA 1PIOA 2GZAA 2Y59A 3QP2A 4KQOA 2Z6CA 2O99A 2P04A 5EOEA 2JKFA 3SW1A 2Y2NA 1BT5A 5CTMA 2V0WA 2QJ7A 3FPVA 4DMZA 4DJ2A 1NYYA 1PZOA 4R1GA 2X02A 1NXYA 3IS2A 3RFBA 2WKIA 2Y2KA 1YLWA 4R3JA 1MXOA 3IHBA 2WGVA 4B9OA 3SS5A 5AVEA 1L0EA 3DTKA 3LFVA 4EUVA 2ZC6B 3BRMA 4GHIA 3O86A 2Z2MB 2E8IA 3VFHA 4DJ3A 2YKFA 4YFMA 2HJ9C 4ZJ2A 3MJQA 2GNXA 4M4XA 3IWQA 1DJCA 4ZJ1A 2V20A 1WYCA 1OTBA 1FSYA 2WAEA 4EUZA 4NKPA 4CLCA 1ONGA 4QHCA 5L09A 5TJJA 4Y7PA 5HAQA 2WKPA 4WELA 3TRCA 2I9VA 3OPRA 1GHMA
chains in the Genus database with same CATH topology
1YPRA 2PBDP 1CQAA 2PAVP 3CPTA 2B95A 1PFLA 5EV0A 2VK3A 1FILA 5EVEA 2E8JA 4QWOA 4X1LA 1SKOB 2ZL1B 3T1QB 1CF0A 1HLUP 2JKFA 1A0KA 5EM0A 3DAVA 3T1XA 1Z09A 1K0KA 3L9KA 3LGOA 1J3WA 4D60A 1SZVA 3MS6A 3NULA 1VETB 1VEUB 3CHWP 4FTXA 5FEGA 1SKOA 2ZL1A 3CPTB 1CJFA 1G5UA 4X25A 2ACGA 1Y4OA 1PRQA 3D9YA 3T1RA 1FIKA 1ACFA 3UB5P 3T1SA 3MSHA 5FDSA 1AWIA 1F2KA 3NECA 1D1JA 1PNEA 4X1MA 2V8FA 4ESPA 5FEFA 2V8CA 4FUWA 3KYEA 3U4LP 2PRFA 2JKGA 5EM1A 1VETA 3L7HA 2BTFP 1VEUA 3LEQA 2HZ5A 3T12B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YPR A;  2PBD P;  1CQA A;  2PAV P;  3CPT A;  2B95 A;  1PFL A;  5EV0 A;  2VK3 A;  1FIL A;  5EVE A;  2E8J A;  4QWO A;  4X1L A;  1SKO B;  2ZL1 B;  3T1Q B;  1CF0 A;  1HLU P;  2JKF A;  1A0K A;  5EM0 A;  3DAV A;  3T1X A;  1Z09 A;  1K0K A;  3L9K A;  3LGO A;  1J3W A;  4D60 A;  1SZV A;  3MS6 A;  3NUL A;  1VET B;  1VEU B;  3CHW P;  4FTX A;  5FEG A;  1SKO A;  2ZL1 A;  3CPT B;  1CJF A;  1G5U A;  4X25 A;  2ACG A;  1Y4O A;  1PRQ A;  3D9Y A;  3T1R A;  1FIK A;  1ACF A;  3UB5 P;  3T1S A;  3MSH A;  5FDS A;  1AWI A;  1F2K A;  3NEC A;  1D1J A;  1PNE A;  4X1M A;  2V8F A;  4ESP A;  5FEF A;  2V8C A;  4FUW A;  3KYE A;  3U4L P;  2PRF A;  2JKG A;  5EM1 A;  1VET A;  3L7H A;  2BTF P;  1VEU A;  3LEQ A;  2HZ5 A;  3T12 B; 
#chains in the Genus database with same CATH topology
 5EVI C;  4WMC D;  3RXW A;  4O0P A;  1K6R A;  4JF4 A;  1K54 C;  1D06 A;  2P08 A;  4OP8 A;  4X56 A;  2PD7 A;  3OLO A;  3VP0 A;  3O87 A;  1C3B A;  1MY8 A;  1YLJ A;  3CI6 A;  4BLM A;  1WYB A;  3ITA A;  3HL9 A;  4GLQ A;  2Y2H A;  5HAR A;  4X53 A;  2ZQ9 A;  3GR2 A;  4GDB A;  3WS5 A;  2K2N A;  1J3W A;  1KOU A;  2WKH A;  3KSI A;  2D02 A;  3P98 A;  3VV4 A;  3MR0 A;  3BY8 A;  1CEF A;  4R4R A;  3E4P A;  1SCW A;  4JKT A;  3PYP A;  2FZ0 A;  4MEZ A;  2XSS A;  3OCN A;  3GV9 A;  3M2J A;  4WZ5 A;  4G3K A;  2R9X A;  3H7W A;  1XA1 A;  1K4F A;  3ZG8 B;  5I94 A;  2Y2J A;  1KVL A;  4L9F A;  3JYI A;  3OBF A;  3GSG A;  1TS6 A;  2ZM0 A;  4FD8 A;  4BMW A;  3EQV A;  4N1X A;  2Q0O A;  1GHI A;  2IWC A;  1KE3 A;  5IS1 A;  3O88 A;  2W3G A;  3A3J A;  3EOI A;  1TS8 A;  2V8F A;  3UY6 A;  2PYR A;  3OZH A;  3E98 A;  4KZ8 A;  5DF7 A;  5CXW A;  3SH8 A;  2HV1 A;  1OJG A;  2XD5 A;  5DF8 A;  4P6Z S;  3LEQ A;  3QP8 A;  3A3D A;  3MBZ A;  2WAD A;  3C8C A;  2ZBB A;  3T4J A;  1L0D A;  1TS0 A;  1FCO A;  4MBK A;  4Q0J A;  2EFU A;  1ALQ A;  4MBF A;  1IFQ A;  5FQM A;  5IU1 A;  3MQO A;  5IT5 A;  4RQ9 A;  5HX9 A;  4YWZ A;  3LEZ A;  2EWV A;  1XJ3 A;  1ESU A;  3UB7 A;  4DN0 A;  1YLY A;  1TD5 A;  1XP4 A;  4H6J B;  1SKF A;  4HNB A;  3ZNY A;  1UWN X;  4RYE A;  2B02 A;  3WS2 A;  4ETX A;  3N7W A;  4UAA A;  4Y17 A;  5AQ7 A;  1S4S A;  2V0U A;  5JYO A;  3IF6 B;  4UEY A;  5GHY A;  1CI9 A;  3LR0 A;  1LHY A;  3V67 A;  4A5R A;  5CRF A;  3NC8 A;  4GN2 A;  4S2L A;  5HL6 A;  2ACG A;  4Q0I A;  3IT9 A;  4GZB A;  1QMF A;  4GKU A;  2FH5 A;  3UB9 A;  4LPZ A;  3UB5 P;  4R6L A;  3HVF A;  5FDS A;  1STZ A;  3Q7V A;  1JWZ A;  4OQH A;  2Q9M A;  1S4R A;  2A24 B;  2W3D A;  2ZMF A;  4DF6 A;  4X69 A;  1MC0 A;  1XGI A;  3PBR A;  5TGF A;  1RGY A;  4Q8I A;  1CI8 A;  2PT7 A;  1T1C A;  3BYD A;  3T4L A;  2PBD P;  3A0S A;  1CQA A;  2Y91 A;  3B47 A;  3TW8 A;  3KSG A;  3DTI A;  3G30 A;  3TOI A;  3TE8 A;  2VK3 A;  5EE8 A;  4H8R A;  5KIZ A;  3NIA A;  5HWV A;  4I38 A;  5CEB A;  4HOI A;  4MNR A;  5FQK A;  3FYZ A;  1PWD A;  5U47 A;  3T4Q A;  4F94 A;  3N4I A;  2B18 A;  2XD1 A;  4E3N A;  4HEF A;  1NRJ A;  3IXD A;  1W7F A;  1OTE A;  4EER A;  2WZZ A;  1T1A A;  3BFD A;  1IYS A;  3HLE A;  1XJ6 A;  3CUE A;  4S2P A;  5FI6 A;  1OTD A;  1W8Q A;  1DY6 A;  4Z9Q A;  3LIF A;  3LIA A;  2R9W A;  4HBT A;  3IX8 A;  1OT6 A;  2A49 A;  5FAS A;  2QYB A;  1N9O A;  4QD4 A;  1KGE A;  2XDM A;  4C75 A;  5HL1 A;  3LR3 A;  4QB8 A;  4Y5F A;  1TDL A;  4II7 A;  3OPP A;  4Q0H A;  2Z2L B;  4E3J A;  4H6J A;  3Q81 A;  5J7E A;  4PAU A;  3HLB A;  3HUN A;  3KYE A;  1YLZ A;  1QME A;  4QY5 A;  3MQQ A;  3IF6 A;  2XF3 A;  1GSW A;  2ZMV A;  3HLD A;  1YKD A;  5K5B A;  2HDR A;  3HLF A;  4OH0 A;  4QPR A;  4KG2 A;  3LO7 A;  4NK3 A;  2J3W A;  2EFX A;  3JVV A;  1UWP X;  3LIB A;  3S7Q A;  2D01 A;  4E6X A;  5EPH A;  2AVX A;  3AGD A;  3BY9 A;  4UQI M;  3FZC A;  3TJZ C;  1YQS A;  4GW9 A;  3GRJ A;  1VM1 A;  4PMA A;  3IS2 B;  3RXX A;  1I5Q A;  5DTK A;  2A24 A;  2C5W B;  1LL9 A;  5IHV A;  4XXR A;  4OLD A;  3PBN A;  2J7V A;  4EET B;  4WBG A;  5F68 A;  2XH9 A;  3D4F A;  5HAP A;  5CGS A;  2OAQ 1;  3PBS A;  4NXF A;  5G4Y A;  1ES4 A;  1MWR A;  3E4Q A;  5FAT A;  3UME A;  4K08 A;  4KZ7 A;  1D7E A;  5DTS A;  3IX4 A;  3M6B A;  3CAX A;  4FTX A;  3EEH A;  3FWL A;  3MF0 A;  4ETZ A;  4U0T A;  3KX0 X;  5HZH A;  3IH8 A;  5L2F A;  1S1Z A;  5FDH A;  3OPL A;  2Y2I A;  1E3U D;  1JNU A;  4HJ4 A;  2WKR A;  4R3A A;  4GB7 A;  1LLB A;  2KOI A;  1XJ2 A;  2IA2 A;  1MKI A;  1ODV A;  4PKY G;  4KZB A;  1K57 C;  2PDR A;  4LLO B;  3KYZ A;  4NET A;  3BM6 A;  3HJK A;  5A8B A;  2O9B A;  2UV0 E;  3V50 A;  3WRZ A;  1TEM A;  1ES5 A;  1ZHH B;  3F1O B;  3Q82 A;  3ZYT A;  4HH3 A;  3HUM A;  4DE3 A;  1K4E A;  4L9E A;  2HJE A;  1SKO B;  4OQI A;  2EX8 A;  3W2Z A;  3MXR A;  1CF0 A;  4ZAM A;  1F9I A;  4N92 A;  3PHY A;  4X55 A;  5HFO A;  3R4K A;  3QP6 A;  5F1F A;  1O7E A;  2EX9 A;  3JPU A;  4P87 A;  3MXQ A;  2A2L A;  1MZU A;  2XR0 A;  4XUZ A;  1LL8 A;  2NUP C;  3RH8 B;  3BQA A;  2H10 A;  1K56 A;  4Y13 A;  2B5R A;  2HP9 A;  1WA9 A;  1VEU B;  5DFX A;  5M1A A;  1ESI A;  4X68 A;  3S1Y A;  5FEG A;  3VP2 A;  3CPT B;  4KEN B;  1ERM A;  3BEB A;  1MWU A;  5TFQ A;  3ZNT A;  3MFD A;  5FAP A;  2INW A;  3D9Y A;  4FH4 A;  5FI2 A;  3ZG0 A;  4ID4 A;  1FQG A;  3PAG A;  2W3F A;  1F5M A;  1LL5 A;  2OLV A;  3C7V A;  3K3D A;  4S2I A;  1ZKJ A;  4L9G A;  4BL2 A;  3DWK A;  4MMN A;  1H0M A;  4YNR A;  4ESP A;  4F3L B;  2ZQD A;  3JVU A;  4OPQ A;  2QKP A;  2W0N A;  3SH9 A;  2EXB A;  2HGV A;  5CGX A;  5F5Y A;  2V9A A;  2RL3 A;  4OON A;  3GMW A;  2ZOH A;  1WE4 A;  3BFF A;  4WZ4 A;  4KZ6 A;  3KO6 A;  3T4K A;  4EBN A;  1ZG4 A;  2XA7 M;  1PZP A;  2CC1 A;  4HY8 A;  3UB6 A;  2HDQ A;  4EV4 A;  1YMX A;  4JF5 A;  3A3F A;  3PBT A;  1I2W A;  3GQZ A;  3LI8 A;  5LBR A;  1N9B A;  2VKS A;  1G6A A;  1ERO A;  4E3L A;  4O7D A;  1GHP A;  2PR6 A;  5CHU A;  2PD8 A;  4E3K A;  3ZHH A;  5A90 A;  5BOH A;  4IED A;  1GA0 A;  4LCL A;  3I7J A;  1FOF A;  3F1O A;  2X71 A;  4JLF A;  2WGW B;  3VSL A;  3VSK A;  1K55 C;  3G6O A;  3N8L A;  2OOL A;  5E2H A;  4R38 A;  5FQQ A;  3Q7V B;  2V2F F;  1SKO A;  4CLC D;  3K3C A;  1CJF A;  1YAX A;  2J8Y A;  1MBL A;  2QJ5 A;  2KDK A;  3NOP C;  2J9O A;  3FC7 A;  3NOU C;  5MC7 A;  2X01 A;  2PHY A;  1P9W A;  4MCW A;  1D1J A;  5FAO A;  1S6R A;  4GOG A;  5HAI A;  1H8M A;  2Q9N A;  1MPL A;  4RX2 A;  3CLO A;  4LV0 A;  3Q1F A;  4IBR A;  1VEU A;  2H0T A;  3A3E A;  3P7N A;  3SS3 A;  5G18 A;  3VP4 A;  1M6K A;  1OTI A;  2JBF A;  3UE3 A;  4PM6 A;  5DJU A;  5AQ9 A;  5F6A A;  3CPT A;  2BAS A;  3PTE A;  4OPR A;  1ZTU A;  4CQH A;  5I5L A;  1KVM A;  1IEM A;  5GLD A;  3DTM A;  2ZL1 B;  2WK0 A;  3NDE A;  3M6H A;  5DKK A;  1ERQ A;  2EA9 A;  4LV2 A;  2DNS A;  4F3L A;  3LY4 A;  2WYX A;  3HCY A;  2HP5 A;  4PHT A;  3N6I A;  4HHD A;  4S2N A;  2XLN A;  1DJB A;  3QHY A;  3BFG A;  1BLS A;  1EI5 A;  3K2N A;  4MBH A;  1FR6 A;  1PWG A;  3KSF A;  1G68 A;  3LY3 A;  3R7W B;  2M1C A;  4OQ0 A;  5EVI B;  4DXC A;  4KQQ A;  1FCM A;  1VB6 A;  4QY6 A;  4S2K A;  4KQD A;  1XXM A;  1JWP A;  5CTN A;  4BQM A;  1W8Y A;  3QP1 A;  2DCF A;  3N8S A;  4UA7 A;  4QJG A;  2PBY A;  2ZD8 A;  3T50 A;  1LI9 A;  1AXB A;  2XK1 A;  1IYQ A;  2L0W A;  1M40 A;  1H5X A;  4R4S A;  2CMN A;  2EX2 A;  2GDN A;  4ZDX A;  2IWB A;  1BZA A;  3E2L A;  5HWW A;  1Y28 A;  2WGW A;  2XFT A;  2QHK A;  4M3K A;  1TF1 A;  5EM1 A;  4Y15 A;  3RJU A;  2WGI A;  4IBX A;  1DP8 A;  3O5Y A;  4G3W A;  5J4E A;  4WF0 A;  1YPR A;  3OCL A;  1S0W A;  1JTG A;  4NXE A;  5D3O A;  3V3R A;  1N9N A;  5EV0 A;  2Y2P A;  3QP5 A;  4DXB A;  5EVL A;  3WS0 A;  4EBL A;  1KGG A;  1RCJ A;  1E4D A;  4MDZ A;  1LSW A;  3ZVW A;  5J3W A;  3ZGA B;  1CK3 A;  1X0O A;  1H3Q A;  1S1Y A;  1TVF A;  4HBU A;  1E25 A;  5GHZ A;  3PBQ A;  3GVB A;  2Y2G A;  3VE3 A;  3C4O A;  4N9L A;  1O07 A;  2Y55 A;  1S66 L;  5FQ9 A;  1SZV A;  5CER A;  4PM8 A;  2XQZ A;  1K25 A;  4LRY C;  1H8Y A;  4Y2F A;  1ES3 A;  1KDW A;  3S7O A;  1BLH A;  3RTY A;  4YIN A;  2W3E A;  5HPI A;  4HES A;  2ZM2 A;  2ZL1 A;  3ICY A;  5M18 A;  2RCX A;  4X25 A;  1ZC2 A;  4ZJ3 A;  1Y4O A;  4UA6 A;  1XJ4 A;  4BBU A;  3IF5 A;  3G35 A;  1Y54 A;  2WUQ A;  1F2K A;  1PI4 A;  3BW6 A;  5TR7 A;  4X1M A;  5F82 A;  3P01 A;  4GDN A;  3NCK A;  4PM9 A;  3R7W A;  3IBJ A;  4BL3 A;  2O9A A;  5EVI A;  4AFI A;  2JCH A;  3B3X A;  3V39 A;  2HDS A;  4IUH A;  3NI9 A;  3ZG9 B;  5A92 A;  1T1B A;  1K54 A;  2BG1 A;  2ZC5 B;  3VP1 A;  2C6W B;  2JC7 A;  2H0Y A;  4B93 A;  4CLC C;  4GNU A;  1SHV A;  1BTL A;  3AGF A;  4IUK A;  3PXP A;  4GD8 A;  4FSF A;  4E3I A;  4KZ5 A;  1PYY A;  1P0Z A;  4U0X A;  2GJ3 A;  4I39 A;  1DJA A;  2FFY A;  5AJG A;  4KZA A;  3G31 A;  1XPB A;  5TBM B;  3IXH A;  3VOZ A;  2JHE A;  2PR5 A;  5KZH A;  3DAV A;  3KYQ A;  3HLG A;  3CG5 A;  4XT2 B;  4MLL A;  2OLU A;  3LGO A;  1F98 A;  1N9L A;  1OT9 A;  2H5S A;  2Y2M A;  5DF9 A;  2UWX A;  3WS1 A;  3CWF A;  2XGN A;  2KLI A;  2YKH A;  2H28 A;  3A3I A;  3CHW P;  3D72 A;  4UHU A;  4OVD A;  1MWS A;  1FCN A;  4OQG A;  4B88 A;  4EU0 A;  3BJN A;  1E3U A;  1NLY A;  4WZ5 C;  4KG6 A;  2P7J A;  3U2A A;  3NEC A;  3SOI A;  2VZW A;  1PNE A;  2L1M A;  1XGJ A;  2DMW A;  4MN6 A;  3T4T A;  3VOL A;  4DDS A;  1NWZ A;  1KGF A;  1W63 M;  4RA7 A;  4S2M A;  2PRF A;  1KDS A;  4RVA A;  4LFU A;  4IVK A;  5HDD A;  1ES2 A;  5DVA A;  4CPK A;  2JKT M;  4EEU A;  3MZE A;  3C7U A;  5F69 A;  2J80 A;  3KSH A;  2W1T B;  4UQI S;  2Y2Q A;  3LR4 A;  3ZQ5 A;  1YT4 A;  3BEC A;  2HP6 A;  3VMA A;  3BLS A;  1JTD A;  2XFS A;  5CX7 A;  1KE4 A;  3GDI A;  4KUK A;  2EXA A;  4WLA A;  4Y0T A;  4OOL A;  3C4P A;  2ZQA A;  4GD6 A;  3DW0 A;  4KQR A;  1LSX A;  1T19 A;  1XX2 A;  4N9K A;  1Z09 A;  5C5K A;  1HZO A;  1K0K A;  1NZO A;  1PW8 A;  2VV6 A;  3F1N B;  3MMH A;  4B4Z A;  3Q7Z A;  1OPX A;  2J3T D;  1W5D A;  3IH9 A;  1XA7 A;  3UE6 A;  1MKM A;  1OME A;  1FSW A;  1PI5 A;  4NEE D;  3CMZ A;  3GEC A;  5CED A;  3UB8 A;  3N8R A;  3S7N A;  4C6Y A;  1KE0 A;  3OOV A;  3M2K A;  3MXS A;  4LCM A;  5FSR A;  3G4P A;  1IEL A;  1OTA A;  5TBM A;  4JGP A;  5EEC A;  3T1S A;  4WYY A;  1Q2Q A;  3O3V A;  1Z6F A;  1N4O A;  4KG5 A;  5DJT A;  1CEG A;  1J9M A;  2W1R A;  3ZG5 A;  2OWJ A;  3S22 A;  3C30 A;  4XT2 A;  1LSV A;  3A0R A;  4PKY A;  3ZCZ A;  5FEF A;  2VGL S;  1SDE A;  3W8K A;  4P6B A;  3IQA A;  2PU4 A;  4R70 A;  5EFW A;  2FFF B;  3G2Z A;  5FAQ A;  4GS9 B;  4MN7 A;  5CHJ A;  2HZ5 A;  2Y4A A;  1A0K A;  3C38 A;  3MKE A;  4GJ4 A;  1W63 Q;  1HVB A;  3FKW A;  2OWH A;  1S67 L;  1K56 D;  3IBR A;  2ZQ8 A;  5EVE A;  5L07 A;  1DP9 A;  2JKR M;  2PYP A;  1V9Z A;  4OKP A;  2GX5 A;  4EWF A;  2OAP 1;  3IWO A;  2ZQ7 A;  3W4O A;  3FV7 A;  1NJ4 A;  4UA9 A;  4JXW A;  4NXG A;  2M7V A;  3B33 A;  4I5S A;  3UE0 A;  2WZX A;  4WMC A;  4EW7 A;  3LYX A;  3IXG A;  4E6W A;  4CLC E;  4JXS A;  2ZLY A;  1L3L A;  2NUT C;  5M19 A;  4LRX C;  3EWK A;  2W1T A;  3NUL A;  5HW3 A;  2Y79 A;  4ME4 A;  5AQB A;  3LUQ A;  3ZG7 B;  1U60 A;  1OJ5 A;  4WUJ A;  3T4S A;  3EQU A;  2VGK A;  3ZFZ A;  3CUE C;  1YLT A;  3D3O A;  4HH2 A;  3PR6 A;  1XKZ A;  2Y2O A;  5EUA A;  2JKT I;  4I3J A;  1IKG A;  4O01 A;  2QZ6 A;  1IYO A;  3BFE A;  3F1P B;  2VJW A;  3PBO A;  1I2S A;  3F1N A;  3VFF A;  5HSQ A;  5GL9 A;  4ZRR A;  2V8C A;  3ISG A;  1FR1 A;  1PW1 A;  1ZG6 A;  3V3S A;  1DP6 A;  3IX3 A;  2BTF P;  3H9W A;  3UO9 A;  2XA7 S;  2ZOI A;  4U3T A;  2QWS A;  5L10 A;  3SS4 A;  4P6Z M;  3FG8 A;  4OPZ A;  2G2W A;  1LT0 A;  2B95 A;  4IVI A;  3IF6 C;  2BLS A;  2K31 A;  3LIE A;  3DWZ A;  5FA7 A;  1XFQ A;  1UGU A;  4K91 A;  4FCF A;  4HIA A;  3T1Q B;  5AQA A;  3LR5 A;  2VV7 A;  1YSQ A;  3BFC A;  2P9V B;  4EQI A;  4HQA A;  5DFY A;  1K38 A;  4GCZ A;  1NLZ A;  5GHX A;  1G6O A;  3T1X A;  4GS9 A;  3ZVT A;  2I72 A;  4S2J A;  2G2U A;  5FL3 A;  5KSH A;  4D2O A;  5HDC A;  1NY0 A;  4LGW A;  2XEP A;  1XFN A;  3UE1 A;  1VET B;  3FKV A;  1BUE A;  4O8G A;  1L0G A;  3LID A;  1BUL A;  4JXV A;  3EGD C;  2VX8 A;  3SZT A;  2HPB A;  5FQJ A;  3E2K A;  1HTZ A;  1PRQ A;  4P85 A;  4P0M A;  5G4Z A;  4ARZ B;  1K57 A;  5HD3 A;  1AWI A;  5A93 A;  2ZJ9 A;  2QPN A;  3ULF A;  2Z6D A;  3MFX A;  3UMD A;  3LI9 A;  4DE0 A;  1L2S A;  5E2E A;  4FUW A;  4BEN A;  1VQQ A;  3MQ0 A;  5L8M A;  2JKR I;  2J3T C;  4HJ3 A;  4BBV A;  4BJP A;  2Y2L A;  2R78 A;  4LRZ E;  3UDI A;  3MZD A;  5DTT A;  2P74 A;  4EXO A;  4HP9 A;  4EQ1 A;  1GSV A;  2PAV P;  3H82 B;  5E2F A;  2Y8H A;  3TG9 A;  1TS7 A;  2VGJ A;  3A0V A;  5DKL A;  4WEK A;  4QWO A;  4EEP A;  1YLP A;  2LB9 A;  4E3O A;  3IHA A;  3F1P A;  3WS4 A;  4OPY A;  1HLU P;  2G7U A;  2HDU A;  2VEA A;  2KX6 A;  2ZM8 A;  2J9P A;  3E0Y A;  5GLA A;  1DRM A;  1T18 A;  5A91 A;  1PWC A;  4RX3 A;  2V1Z A;  3HLW A;  4KZ4 A;  4OP5 A;  2O0Y A;  4YOF A;  3WRT A;  4WN5 A;  2JN7 A;  4PM5 A;  4JGR A;  4NXB A;  2M7U A;  2ZC4 B;  3W4Q A;  3G2Y A;  1EWZ A;  3MS6 A;  4IHQ A;  3NJA A;  4MN5 A;  1IOU A;  3QP4 A;  3UNW A;  3VOY A;  3CZD A;  4DE2 A;  3PAE A;  1G28 A;  4JXG A;  4S2O A;  3VP3 A;  5F1G A;  4LEN A;  2P9V A;  3S4X A;  4Y3I A;  1GSX A;  4XUX A;  1V9Y A;  4G3V A;  4R23 A;  4CJN A;  4EBP A;  4B4X A;  4K0W A;  2A3U A;  2ZMA A;  4HP4 A;  4KZ3 A;  4ZBE A;  1JWV A;  2V1B A;  1VET A;  4X6T A;  3UN7 A;  4K0X A;  3G34 A;  4E04 A;  2VLG A;  1P97 A;  2ZQC A;  3B42 A;  4Y0O A;  3T12 B;  4N1H A;  2IWD A;  4DE1 A;  3UDX A;  2LB5 A;  1H8Z A;  3Q07 A;  3C2W A;  1SDN A;  2W27 A;  4E3M A;  5KMW A;  4ARZ A;  3EEA A;  3T4O A;  4HI4 A;  1NYM A;  2DRW A;  5E2G A;  3FPW A;  1IKI A;  5EM0 A;  3MZF A;  4WL9 A;  1K55 A;  3NY4 A;  1Q2P A;  5JYP A;  3L9K A;  3UPO A;  2QMI A;  3OPH A;  3QNB A;  4LV1 A;  4DRT A;  2L4R A;  3IXB A;  3H82 A;  2HF6 A;  3EGX C;  3BWL A;  1YM1 A;  4OOM A;  1LI0 A;  4FOF A;  2ZC7 A;  3IWI A;  5EVI D;  4NG2 A;  1MWT A;  2EWW A;  4JGQ A;  4EES A;  3UPN A;  1ONH A;  3TSG A;  3NDG A;  3HUO A;  3NHQ A;  3CJM A;  3T1R A;  1FIK A;  1ACF A;  1BSG A;  5FQI A;  3MSH A;  2MJ6 A;  2K7S A;  3UPP A;  4JBF A;  4C3Q A;  2JE5 A;  2OV5 A;  3E4O A;  3HBR A;  4BD1 A;  3AGE A;  5EOO A;  5HPF A;  3SH7 A;  3DBA A;  3HLC A;  3L7H A;  4I3I A;  2O9C A;  3WWX A;  5CEC A;  4OLG A;  3LCE A;  4HJ6 A;  3QNC A;  2V1A A;  1BLC A;  1W79 A;  1TDG A;  4R0Q A;  4PPR A;  4L0L A;  3HJI A;  1FIL A;  3OC2 A;  2E8J A;  4X1L A;  5FI7 A;  2W3H A;  4QU3 A;  4ZTK A;  2WKE A;  4GHI B;  5HWT A;  5CGW A;  5J8X A;  5F83 A;  3ITB A;  1NRF A;  3C5A A;  3NOT C;  2VV8 A;  1EW0 A;  4BD0 A;  1JVJ A;  4JGO A;  4WEJ A;  1NZU A;  4PM7 A;  3BQ8 A;  4OOY A;  5CHM A;  3GTC A;  4D60 A;  4JPM A;  4Y0U A;  3NBL A;  4S2N C;  4CLC B;  4Z1W A;  1IYP A;  5GLB A;  2XRO A;  1RGZ A;  3DTE A;  5KSC A;  4BWI A;  3BLM A;  4JF6 A;  4I3A A;  1BYW A;  2ZC3 B;  5HDS A;  1G5U A;  4R3B A;  1HD8 A;  3G32 A;  1VHM A;  1BLP A;  4FH2 A;  4KUO A;  3HRE A;  2VGL M;  3CIT A;  1L0F A;  1P9R A;  2WKQ A;  2WAF A;  1K6S A;  3W4P A;  4LV3 A;  3ZDJ A;  1YMS A;  5E43 A;  2VA0 A;  2XRN A;  3U4L P;  4IJG A;  2JKG A;  3V5M A;  2PU2 A;  3P09 A;  3UDF A;  3MKF A;  1GA9 A;  5HD5 A;  1RP5 A;  4KZ9 A;  4BBT A;  3VE4 A;  4WM9 A;  4DKI A;  1YSP A;  5GLC A;  4DDY A;  1PFL A;  3S7P A;  1GCE A;  2OSU A;  2EX6 A;  5AVF A;  3H7W B;  3LIC A;  1PIO A;  2GZA A;  2Y59 A;  3QP2 A;  4KQO A;  2Z6C A;  2O99 A;  2P04 A;  5EOE A;  2JKF A;  3SW1 A;  2Y2N A;  1BT5 A;  5CTM A;  2V0W A;  2QJ7 A;  3FPV A;  4DMZ A;  4DJ2 A;  1NYY A;  1PZO A;  4R1G A;  2X02 A;  1NXY A;  3IS2 A;  3RFB A;  2WKI A;  2Y2K A;  1YLW A;  4R3J A;  1MXO A;  3IHB A;  2WGV A;  4B9O A;  3SS5 A;  5AVE A;  1L0E A;  3DTK A;  3LFV A;  4EUV A;  2ZC6 B;  3BRM A;  4GHI A;  3O86 A;  2Z2M B;  2E8I A;  3VFH A;  4DJ3 A;  2YKF A;  4YFM A;  2HJ9 C;  4ZJ2 A;  3MJQ A;  2GNX A;  4M4X A;  3IWQ A;  1DJC A;  4ZJ1 A;  2V20 A;  1WYC A;  1OTB A;  1FSY A;  2WAE A;  4EUZ A;  4NKP A;  4CLC A;  1ONG A;  4QHC A;  5L09 A;  5TJJ A;  4Y7P A;  5HAQ A;  2WKP A;  4WEL A;  3TRC A;  2I9V A;  3OPR A;  1GHM A; 
#chains in the Genus database with same CATH homology
 1YPR A;  2PBD P;  1CQA A;  2PAV P;  3CPT A;  2B95 A;  1PFL A;  5EV0 A;  2VK3 A;  1FIL A;  5EVE A;  2E8J A;  4QWO A;  4X1L A;  1SKO B;  2ZL1 B;  3T1Q B;  1CF0 A;  1HLU P;  2JKF A;  1A0K A;  5EM0 A;  3DAV A;  3T1X A;  1Z09 A;  1K0K A;  3L9K A;  3LGO A;  1J3W A;  4D60 A;  1SZV A;  3MS6 A;  3NUL A;  1VET B;  1VEU B;  3CHW P;  4FTX A;  5FEG A;  1SKO A;  2ZL1 A;  3CPT B;  1CJF A;  1G5U A;  4X25 A;  2ACG A;  1Y4O A;  1PRQ A;  3D9Y A;  3T1R A;  1FIK A;  1ACF A;  3UB5 P;  3T1S A;  3MSH A;  5FDS A;  1AWI A;  1F2K A;  3NEC A;  1D1J A;  1PNE A;  4X1M A;  2V8F A;  4ESP A;  5FEF A;  2V8C A;  4FUW A;  3KYE A;  3U4L P;  2PRF A;  2JKG A;  5EM1 A;  1VET A;  3L7H A;  2BTF P;  1VEU A;  3LEQ A;  2HZ5 A;  3T12 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...