5HPFA

Crystal structure of the double mutant of pobr transcription factor inducer binding domain from acinetobacter
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
175
structure length
175
Chain Sequence
AHLPKVAQSFLNLLCAQTSLTFSIVVLDEHEVVPVARSYLPQQDNRVSPYGMHLGNRLPAHATSTGKVLLSVLDREVQIEWIEKYGLKRLTPYTITDEHTFLETLDAVRQSDYCLSTEEHELGVIAIAVPVLNAQGLTIAALNCMSQTNRVQPQYLIDQVLPLLRNTANELRNLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords p-hydroxybenzoate hydroxylase transcriptional activator
publication title A microbial sensor for organophosphate hydrolysis exploiting an engineered specificity switch in a transcription factor.
pubmed doi rcsb
source organism Acinetobacter baylyi str. adp1
total genus 44
structure length 175
sequence length 175
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2016-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01614 IclR Bacterial transcriptional regulator
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5hpfA00
1YSQA 4PAUA 5C5KA 4LRZE 3IBRA 2M7VA 2W3FA 4DMZA 3CITA 3OBFA 5DFYA 3MQ0A 1TD5A 5HSQA 2W1TA 2K31A 3NOPC 1ZTUA 2W3EA 4DN0A 4Y2FA 2QYBA 4Q0JA 3RFBA 4MMNA 1VHMA 4Z1WA 4EU0A 1F5MA 4QPRA 3LFVA 2ZMFA 1YSPA 3D3OA 4IUKA 3G6OA 2OOLA 3KSFA 3KSGA 4CQHA 4EUVA 3E98A 3MF0A 4GW9A 3W2ZA 2VZWA 5HPFA 2W3DA 3C2WA 2LB5A 4Q0HA 4Y3IA 3S7NA 4MCWA 3MMHA 2W1TB 3KSIA 4O0PA 2O0YA 5HL6A 3NOTC 5AJGA 3CI6A 2KLIA 4IUHA 5I5LA 2XRNA 2Y8HA 5L8MA 1STZA 2G7UA 2W3GA 3NOUC 2O99A 4G3KA 2M7UA 2XSSA 4YOFA 2B18A 3TRCA 2W3HA 4LRXC 4R6LA 3KSHA 2VKSA 4RQ9A 3S7OA 4LRYC 4ZRRA 4BWIA 3ZQ5A 3IBJA 4GLQA 5K5BA 4ETXA 3DBAA 4O01A 4Y5FA 3S7QA 4MDZA 5HPIA 4O8GA 2O9BA 4ETZA 2VJWA 4R70A 3E0YA 4E04A 1YKDA 3OOVA 2IA2A 2XROA 3EEAA 3R4KA 3VV4A 2K2NA 3BJNA 3K2NA 2GX5A 3KO6A 4YNRA 2W1RA 3S7PA 2O9CA 4MN7A 2KOIA 3NHQA 4FOFA 4G3WA 1MKMA 2O9AA 3O5YA 4G3VA 4Q0IA 5TJJA 2Y79A 3HCYA 5DFXA 1TF1A 2HGVA 2VEAA 4ME4A 4IJGA 5LBRA 1MC0A 2LB9A
chains in the Genus database with same CATH superfamily
4E3LA 4ZJ2A 1Y28A 3VSKA 4F3LA 3B42A 5AQAA 2RCXA 1CJFA 3UB7A 1OTAA 4CLCD 4LV3A 1SZVA 4LV0A 3UMDA 3LIEA 3T4TA 3QHYA 2ZQ7A 4S2KA 5M18A 1G6OA 1OT9A 5CEDA 4B9OA 4NK3A 1YMXA 4JF5A 1FQGA 1S66L 5IS1A 4IVIA 4EUVA 3VMAA 2LB5A 2DRWA 2HJ9C 4PPRA 4GN2A 5KZHA 4DXBA 4K91A 4BENA 5AJGA 5KSCA 4NETA 4R4RA 4OKPA 4IUHA 3T1SA 4PM7A 2XRNA 1Z6FA 5J8XA 3BYDA 3LR5A 1LSVA 3DTKA 4HH3A 4PM8A 4LRXC 2EWVA 5EE8A 4M4XA 1F9IA 1JWZA 1T18A 2UWXA 2XFSA 4I3IA 4Y5FA 4CJNA 3PBNA 3N4IA 2WKHA 3QP6A 5EVIB 3A0VA 1LSWA 4OOYA 1G6AA 2M1CA 4MN5A 2E8JA 3EEAA 1TEMA 1G68A 1LT0A 4WBGA 3V39A 3A3DA 5EM1A 4DDSA 3T4SA 3GECA 2XK1A 2VA0A 2Y59A 2Y79A 1U60A 4GB7A 3N8RA 2HGVA 3G30A 4CPKA 3DWZA 4UEYA 5HDCA 1GSXA 5EECA 2WGVA 4UHUA 2ZOHA 3ITAA 1DY6A 5CX7A 4DKIA 1YLYA 4DN0A 3GMWA 2QYBA 4OQGA 3W8KA 1CEGA 5A8BA 4MMNA 1YMSA 2XQZA 5L10A 3LFVA 3C7VA 3MQOA 3LEZA 3BQAA 3W2ZA 4X25A 5FA7A 3Q7VB 5F5YA 1HVBA 4S2NC 3HBRA 5E2GA 5HL6A 3TSGA 2ZOIA 1W8QA 2XD1A 3IWIA 1IYPA 2Y8HA 3UB8A 4CLCC 4E3NA 1NY0A 2G7UA 1FCOA 3CHWP 2O99A 3DAVA 1ERQA 1OTDA 4U0XA 1K56A 5F1GA 4O01A 3ZVWA 4KZ6A 4Y0OA 5FQ9A 4QHCA 4JGPA 1HTZA 1FIKA 3AGDA 3NY4A 1VEUA 4DE3A 2PYPA 4R3BA 4KZBA 3Q7VA 2O9AA 1KDWA 3E4PA 3T4OA 4UQIS 1XA7A 4KZ4A 4OQIA 3HLCA 3UNWA 2Z6DA 4I3AA 3IF6C 2R9WA 5EUAA 1XJ4A 4HHDA 2BLSA 5HSQA 3E4QA 1PW1A 3HLBA 4OH0A 1GCEA 4Q0JA 4E3OA 1N4OA 3K3CA 2IWDA 4YINA 2OLVA 3OPLA 5CTMA 5DJUA 2EX6A 4KG6A 2OOLA 3OZHA 3QP2A 3E2LA 1T1BA 2XH9A 5TR7A 3E98A 4WLAA 4IEDA 2VLGA 2H10A 1LL5A 4HJ3A 3JVVA 2CC1A 3EEHA 4JXWA 3O87A 1IOUA 1MBLA 3IHBA 1I5QA 4O0PA 1F2KA 3UB9A 3LY4A 4ZBEA 5CHUA 2EX9A 4EQ1A 4EEUA 3BFGA 3LCEA 3HUOA 3WRZA 4BLMA 2ZQDA 3MS6A 3ISGA 4EW7A 4B93A 1D1JA 3S1YA 4UA9A 1H8YA 3UY6A 1TS7A 3ZG0A 4KQDA 3IH8A 3SS5A 2A24B 3A3IA 2XDMA 1PZPA 1S6RA 2IA2A 3MR0A 3FZCA 1GA0A 5DTSA 2V8FA 1VQQA 5G18A 3G32A 2EXAA 1H8MA 4FTXA 2X71A 1BULA 4P6ZM 4HP9A 3HCYA 1NLZA 3OPPA 2H28A 1AXBA 4LFUA 1DP8A 4KQOA 4P0MA 3TOIA 5FQQA 2J7VA 1ESIA 2W3FA 2J9OA 3BFEA 2DNSA 2J3TD 2PT7A 1OTBA 2W1TA 1H3QA 5F69A 1GHMA 2Q0OA 4XT2A 2A24A 1IYOA 5GLAA 3SS4A 2XA7S 3IXHA 3ZFZA 3G4PA 4MLLA 3WRTA 2VV8A 4MN6A 3HLWA 2Y2MA 2C6WB 5CGWA 2E8IA 1DJCA 3WS4A 4GD8A 1JVJA 2DCFA 4KQQA 3ZNYA 3VP0A 1DP6A 4OPZA 3E2KA 5MC7A 1RCJA 4UA6A 2BG1A 2Y2NA 4LCMA 3UE1A 2V2FF 1XGJA 2R9XA 5HFOA 2HZ5A 1NWZA 4JGOA 3BQ8A 2W3GA 4QY5A 2GZAA 3W4PA 4EETB 1H0MA 2WKPA 3ZG8B 2P7JA 3ZQ5A 1PI5A 5GL9A 1MWRA 3DBAA 4Y0TA 2P08A 4DF6A 1ODVA 2O9BA 3BLSA 1TVFA 2JBFA 1XPBA 4JGRA 2MJ6A 4ARZB 2V1AA 1A0KA 2K2NA 3K2NA 4I38A 3LYXA 5AQ7A 4C3QA 4ZJ1A 3O5YA 5GLDA 3OPRA 1CI8A 4KZ8A 2Y2GA 3IX8A 4GNUA 1OJ5A 1MC0A 2LB9A 4X68A 3VFFA 4LRZE 2P9VA 4KUOA 3GDIA 3CITA 3H82B 4I3JA 3HUMA 1JWVA 1TS0A 1TD5A 3VE3A 1SKOA 3WS5A 3NCKA 3G2YA 3MXRA 4BD0A 4IBXA 2ZBBA 3DWKA 2A2LA 1ZG6A 3FKVA 2OAQ1 4QPRA 4EXOA 1K56D 4KZ3A 4HH2A 4ARZA 4BBTA 2D01A 3HL9A 3NDEA 4MBFA 2WKRA 1IYQA 2L1MA 3KYQA 3C2WA 4FH4A 3MXSA 1NRJA 4HBTA 2HDRA 1BYWA 1J9MA 4WN5A 3T50A 3QNCA 1I2WA 2PYRA 4IVKA 3E4OA 2JKRI 4EEPA 5L8MA 3H82A 2I9VA 3UB5P 4GJ4A 5DF8A 3A3FA 4BJPA 3IH9A 4NXBA 3EGDC 3O3VA 3QP5A 4MBHA 2FZ0A 3PBQA 1BLSA 5HX9A 1XKZA 2J9PA 4FSFA 5K5BA 3BFFA 1NXYA 4BBUA 5D3OA 2HPBA 2V0UA 1ACFA 4ZDXA 3LIFA 4NEED 5HPIA 2VJWA 3NECA 1F98A 3Q82A 5F83A 1MZUA 3B3XA 3OOVA 3F1OB 3BECA 4OVDA 3BJNA 1QMFA 1NYYA 2V1BA 2VGKA 1L0GA 5F68A 2QWSA 2B5RA 3CUEA 1MY8A 3UPPA 4Q0IA 1SHVA 4EUZA 2ZC6B 3JVUA 2JKRM 2ZM8A 5KMWA 4WELA 4EBLA 4HESA 5FEGA 4G3KA 4LENA 5U47A 3JYIA 3C38A 5C5KA 4UA7A 2EX2A 2XD5A 3IBRA 5FQJA 3LI9A 3RXWA 3D72A 3HLEA 1GSVA 2NUTC 1OT6A 4D60A 3HUNA 5EVIC 2V8CA 3F1OA 3W4OA 5EM0A 4P87A 3S22A 5FQKA 4JXGA 1WA9A 4U3TA 5CECA 2VV7A 1ONHA 4QWOA 2GDNA 3GRJA 4E3MA 1PRQA 2HF6A 1IKIA 3EQVA 4R0QA 1OTEA 1YLPA 5HD3A 1XJ2A 3BY8A 2WGIA 3BFCA 1ZHHB 3UPOA 2G2UA 4PHTA 2P74A 3U2AA 3CPTB 3HVFA 2XGNA 1W7FA 5EVLA 2NUPC 4HEFA 3GQZA 1AWIA 2XLNA 3VP4A 3MKFA 3ZVTA 2ZJ9A 3OCLA 5J7EA 4OP8A 1IYSA 1L0DA 4MEZA 3WS2A 4DMZA 4IBRA 5FAOA 4N1HA 5FI2A 4E3IA 3ZG7B 4GDBA 2L4RA 1ZTUA 3DTEA 3SZTA 3TG9A 3CPTA 1S1YA 1F5MA 2YKHA 1YM1A 1KE4A 1ES3A 5HL1A 3WS1A 3QP8A 3FKWA 4BBVA 1TS8A 1GHIA 2WKEA 4B4ZA 2FFFB 4HY8A 5BOHA 1BLCA 3GV9A 4FUWA 5EPHA 2WGWB 3C4OA 3DW0A 4LV1A 4JF4A 4Q0HA 2QMIA 3NI9A 1IELA 3QP1A 3O88A 4WF0A 4EV4A 1KGEA 1FR1A 1YT4A 3LR3A 5EVIA 1GSWA 5TGFA 1ZG4A 4GDNA 5FAPA 4JXSA 4L9EA 1V9ZA 4DJ2A 1XJ3A 5AVFA 1SDNA 3FV7A 3N8SA 3BRMA 1ERMA 3BFDA 4ZRRA 2Y2LA 4GOGA 4ETZA 2HP9A 2EA9A 4UQIM 1I2SA 2EXBA 2WGWA 3S7PA 2AVXA 1ZC2A 3HLDA 5FL3A 3G31A 3NIAA 4R23A 3BY9A 1TF1A 2Z2LB 3NJAA 4WL9A 4IJGA 3IX3A 4RX3A 3K3DA 3HLGA 4PAUA 5TBMB 3OLOA 1PFLA 4N9KA 1FCMA 2XEPA 3CJMA 2QJ7A 4HBUA 3NOPC 2ZMVA 3VE4A 3OC2A 4H6JB 5G4YA 3KX0X 1JTDA 1SDEA 1VHMA 5CERA 1K25A 2B95A 1IKGA 1KGFA 1P0ZA 4O7DA 3LR4A 1BLHA 2G2WA 3L9KA 3IHAA 1L0FA 4DE1A 5E2FA 1RGZA 4MCWA 3T1XA 3DTIA 4XUZA 4II7A 3V67A 2KLIA 5DJTA 4GCZA 4JF6A 1OJGA 3F1PB 1S67L 3NOUC 5IT5A 1FSWA 3FG8A 1P9RA 4YOFA 3QP4A 1K0KA 4RQ9A 4PM5A 3GVBA 4RX2A 4H6JA 1XGIA 3KYZA 3OCNA 5CHJA 4Q8IA 5GLBA 5A93A 2OLUA 3CG5A 4HOIA 3SH8A 4E04A 4KZ7A 3BWLA 3MXQA 3L7HA 2KOIA 4OP5A 1WE4A 1TS6A 2JN7A 5E2HA 3IWQA 4G3WA 5CRFA 5AQ9A 2EFUA 5TJJA 3U4LP 1TDLA 2XF3A 4HJ6A 4ESPA 3T1RA 3Q07A 4OONA 4GD6A 4XUXA 3F1PA 3SOIA 3PBTA 3A0RA 2VV6A 4ZTKA 4K0XA 2XA7M 5L09A 4JBFA 4QU3A 5L07A 1GHPA 1ONGA 3S4XA 4Y2FA 3D9YA 4MBKA 4H8RA 1YAXA 4OQ0A 1VB6A 1G5UA 5DVAA 4S2MA 3D3OA 3ZNTA 3LICA 3ZHHA 3KSFA 4CQHA 1ES5A 4F94A 5FDSA 2WKQA 3M6HA 4OPYA 5IHVA 3S7NA 2K7SA 2PHYA 2ZD8A 1E3UA 3NDGA 2OAP1 4HQAA 2ZC3B 4XXRA 4Y17A 2OWHA 3LUQA 1YLWA 4RA7A 4BL3A 3V50A 3ZG5A 4PKYG 1CK3A 1STZA 3EWKA 4N1XA 2VX8A 3KYEA 2XSSA 2W27A 4C75A 1LI9A 3GR2A 4BWIA 1Q2QA 3IBJA 1NLYA 4OQHA 4WEJA 4LCLA 2Y2IA 4NXFA 2H0YA 3ICYA 2WUQA 3Q7ZA 4R70A 5J3WA 1E4DA 4X55A 4Y7PA 2XROA 2VK3A 2PU4A 4P6ZS 3C30A 4U0TA 1M6KA 1SKFA 2CMNA 3NC8A 1MWSA 1TDGA 3CUEC 1CF0A 3VOYA 3GSGA 1WYCA 2VEAA 4ME4A 3BEBA 4R38A 4ID4A 5EVID 1XXMA 1YSQA 1XFQA 2HDUA 1S4RA 2UV0E 3IQAA 5L2FA 4GZBA 4P6BA 3BLMA 1OTIA 2V0WA 4EBNA 3CZDA 4X69A 1K55A 4CLCE 1YSPA 3G35A 3UDXA 1H5XA 3G6OA 3KSGA 1ES2A 2PAVP 4EQIA 5EOOA 4KQRA 4Y3IA 4HJ4A 4KENB 3KSIA 3P01A 4WMCA 2C5WB 3HJKA 4Y13A 5HWWA 4K0WA 3TW8A 4DDYA 4Z9QA 3MZDA 4DXCA 4PM6A 2VKSA 2Y4AA 5IU1A 3SH7A 1VM1A 5FASA 1T1CA 2PD7A 3A0SA 1KE0A 3CWFA 5HDDA 5FQIA 2RL3A 4YNRA 1MPLA 3PR6A 4E3JA 3HJIA 4FOFA 1UWNX 4JKTA 4G3VA 3T12B 1C3BA 5DFXA 1KDSA 4M3KA 4C6YA 3ZDJA 4I39A 1MXOA 3A3EA 1JNUA 2IWBA 1G28A 4KZ9A 1PWDA 4DE0A 1P9WA 1RP5A 4NKPA 4R3JA 2P04A 1PW8A 2EWWA 2B02A 1BLPA 2HDQA 5HAIA 5FSRA 3V3RA 4EU0A 2WAFA 1HZOA 3OPHA 2R78A 4WZ4A 4LV2A 1MWUA 3MF0A 4DJ3A 3V3SA 3MFDA 4S2PA 5GHYA 5FDHA 3PYPA 5FEFA 1BSGA 3LR0A 2HDSA 4NG2A 4UAAA 1IEMA 5JYOA 3SW1A 1L0EA 1W8YA 1Y4OA 1T19A 1K54A 2OSUA 3NOTC 5CGSA 2H5SA 3PBSA 4X1MA 1YLJA 5KIZA 1CEFA 1W63Q 3AGFA 2JE5A 1HLUP 1NJ4A 3GTCA 2B18A 2QKPA 2EFXA 2QJ5A 3LIBA 1UGUA 2J80A 1DRMA 1LHYA 3LGOA 4N92A 2VGLS 1Q2PA 4RVAA 4X53A 1V9YA 5GHXA 3WWXA 2ZC7A 3IS2B 2ZC4B 2GX5A 1FOFA 4PKYA 2ZQ8A 2X01A 5AQBA 1J3WA 2PDRA 1FR6A 1BTLA 3RXXA 1E3UD 5LBRA 3NULA 5DKLA 3HLFA 1X0OA 1LSXA 1RGYA 1KGGA 1PYYA 4HI4A 3PTEA 5DTKA 2Y2JA 3MQ0A 1SCWA 2FH5A 2JKTI 3T4LA 4HNBA 4NXGA 1W79A 4GHIB 1CQAA 4L9GA 1WYBA 5HAPA 3TJZC 5CEBA 3B33A 3IS2A 5HZHA 3I7JA 2KX6A 3UE0A 5HPFA 1VETB 3ZCZA 3PHYA 3MFXA 4NXEA 3F1NB 1XX2A 3CI6A 1E25A 2JKTM 3EGXC 2WZXA 3Q81A 2HP6A 3PBOA 3ZG9B 2Q9NA 2W3HA 4B88A 3S7OA 3QNBA 3ITBA 4GLQA 3N6IA 4GHIA 1LL8A 2WKIA 5FI7A 3V5MA 2ZM2A 4R4SA 5I94A 1XFNA 4L9FA 2FFYA 4MN7A 1KOUA 1VETA 5HWVA 3IXBA 3NHQA 4R1GA 1K38A 3PAEA 4JLFA 1YLTA 3A3JA 4HIAA 3H9WA 4WZ5A 3F1NA 4WMCD 3DTMA 3VP1A 3LY3A 5HD5A 3PBRA 2Q9MA 1FSYA 3P09A 5FATA 5DFYA 1VEUB 1KVMA 3SH9A 3T4JA 3R7WB 3TE8A 4JXVA 5DF7A 3BM6A 1BUEA 1XP4A 2WADA 2Y91A 4OOLA 2OWJA 4KZAA 2KDKA 2EX8A 2D02A 2ZMFA 1D7EA 4IUKA 2J3WA 3LIAA 3VP3A 2Y2KA 2Y55A 3IXDA 3MZFA 3EQUA 4GW9A 4OPQA 3T1QB 4OOMA 1N9LA 1K6RA 2W3DA 1NZOA 5A92A 5CTNA 4L0LA 5J4EA 4IHQA 4BD1A 1PI4A 3PXPA 4D2OA 1NYMA 3MZEA 4RYEA 4PM9A 4OLGA 4S2OA 3VSLA 1H8ZA 1W63M 1CI9A 4EERA 2M7UA 3R7WA 2HV1A 2WAEA 3SS3A 1W5DA 3KSHA 1M40A 4LRYC 1ES4A 3C4PA 2Z6CA 3JPUA 2V20A 5E2EA 3LI8A 4KG2A 2H0TA 5TBMA 4KZ5A 3UDIA 4YFMA 3R4KA 1DP9A 4BQMA 2JCHA 2PD8A 3Q1FA 5CHMA 1N9BA 1ALQA 3G34A 3ULFA 3M2JA 1YLZA 1LI0A 4JGQA 4Y0UA 4DRTA 4FD8A 1YPRA 5HW3A 3UB6A 1BZAA 5E43A 3RJUA 2ZLYA 4CLCB 4E6WA 2I72A 1PZOA 1XA1A 3OBFA 3T4KA 4ZAMA 2OV5A 1EROA 1FILA 4YWZA 4N9LA 3VOLA 3RFBA 4Z1WA 1K55C 5EVEA 2DMWA 5GHZA 3MBZA 4X1LA 1K4FA 1O7EA 2A3UA 5JYPA 3IT9A 3UN7A 2VZWA 1K6SA 4QY6A 3PAGA 3MMHA 4S2NA 2W1TB 2HP5A 1JWPA 1QMEA 3W4QA 4XT2B 5EOEA 2O0YA 3IX4A 2V1ZA 2PBYA 3AGEA 4CLCA 3FYZA 3UO9A 1Z09A 5A90A 3M6BA 3IF6B 2INWA 3C5AA 1KE3A 3O86A 1FCNA 3TRCA 3FPWA 1P97A 3WS0A 3CMZA 4E3KA 2JHEA 2XR0A 1K4EA 4O8GA 2ZM0A 3E0YA 3D4FA 1T1AA 1LL9A 2WZZA 3VV4A 1O07A 2W1RA 2PR6A 4WEKA 4FH2A 1HD8A 3BW6A 3MKEA 5DF9A 1PNEA 3VOZA 1N9OA 3RTYA 4QB8A 2ACGA 5CGXA 4EWFA 4R3AA 3MSHA 3IF6A 1S0WA 3UPNA 5EFWA 4E6XA 5M19A 2WK0A 1DJBA 4ZJ3A 3B47A 4QJGA 2ZQ9A 2BASA 2K31A 4DE2A 5F1FA 1XJ6A 3EOIA 1IFQA 2V9AA 3LEQA 3IF5A 3RH8B 4P85A 1ZKJA 1LLBA 1Y54A 1PWCA 2L0WA 4K08A 1NRFA 1EI5A 3UMEA 4PMAA 4EBPA 2ZC5B 2P9VB 4OLDA 3FC7A 2IWCA 1PIOA 1SKOB 3UE6A 2Y2HA 2J8YA 2Z2MB 3UE3A 2Y2QA 2A49A 3MJQA 2ZMAA 1K54C 2BTFP 3P7NA 4X6TA 2GNXA 4A5RA 4S2LA 1KVLA 3T4QA 4S2IA 1K57C 3C8CA 4BMWA 5F6AA 1DJAA 2GJ3A 4WM9A 4ETXA 3S7QA 2PBDP 4EESA 2YKFA 1YKDA 3IXGA 2X02A 2JKFA 3KO6A 2VGJA 3UDFA 5CXWA 2O9CA 5DKKA 2QPNA 1L2SA 2Y2OA 2JKGA 3HREA 2WYXA 4QD4A 2HJEA 4KG5A 1OPXA 1MWTA 1NZUA 3CLOA 5FAQA 5M1AA 3M2KA 5GLCA 2M7VA 3NBLA 5FI6A 1BT5A 4LLOB 1S4SA 5F82A 1ESUA 3LIDA 2ZQCA 1EW0A 2W3EA 4S2JA 1S1ZA 1EWZA 4AFIA 2W0NA 2ZL1B 4B4XA 5HDSA 5HWTA 4I5SA 5EV0A 5A91A 3MQQA 1JTGA 3VFHA 5DTTA 2J3TC 1OMEA 4HP4A 3H7WB 1N9NA 4LPZA 4LGWA 2QHKA 3ZYTA 4BL2A 5AVEA 5KSHA 2PRFA 3P98A 4GS9B 2XFTA 5HARA 1L3LA 5I5LA 5G4ZA 3FWLA 3VP2A 1MKIA 2PR5A 3IWOA 4F3LB 2VGLM 1GA9A 4GKUA 3FPVA 4R6LA 4FCFA 4OPRA 3ZGAB 2ZQAA 4MNRA 5HAQA 4Y15A 2ZL1A 5FQMA 2Y2PA 3CAXA 4X56A 4MDZA 3C7UA 4WYYA 3G2ZA 2PU2A 1PWGA 1D06A 4JPMA 3H7WA 1YQSA 3N8LA 1K57A 1MKMA 3LO7A 3N7WA 4GS9A 1UWPX 5TFQA 2QZ6A 2JC7A 4KUKA 4WZ5C 4WUJA
chains in the Genus database with same CATH topology
1Y28A 4F3LA 3B42A 3F1PA 5HD5A 3PBRA 4LRZE 3UB7A 1OTAA 4KUOA 3PBTA 4CLCD 3A0RA 2VV6A 3GDIA 3CITA 2XA7M 3H82B 4I3JA 1TS0A 5DFYA 1TD5A 3UMDA 3VE3A 3T4JA 3R7WB 3TE8A 2ZBBA 3LIEA 3T4TA 4Y2FA 2A2LA 1YAXA 2OWJA 4OOLA 2KDKA 1VB6A 2OAQ1 4QPRA 4EXOA 1G6OA 1OT9A 4HH2A 4ARZA 2D02A 2ZMFA 1D7EA 4B9OA 3D3OA 4IUKA 2J3WA 3LIAA 3LICA 4BBTA 3KSFA 1S66L 4CQHA 4EUVA 5IS1A 2D01A 4GW9A 3EQUA 2WKQA 2WKRA 4OOMA 1N9LA 2L1MA 2W3DA 3KYQA 3C2WA 2LB5A 3S7NA 4L0LA 2K7SA 2PHYA 5J4EA 1NRJA 2HJ9C 4IHQA 1BYWA 2OAP1 3PXPA 4HQAA 4WN5A 3T50A 2OWHA 2PYRA 3LUQA 3E4OA 5AJGA 2JKRI 4IUHA 4EEPA 2XRNA 5L8MA 4PKYG 3EWKA 1STZA 1W63M 2I9VA 3H82A 4GJ4A 2VX8A 4BJPA 4EERA 3LR5A 2M7UA 4NXBA 3EGDC 2XSSA 1LSVA 3R7WA 2W27A 2HV1A 4HH3A 4LRXC 2EWVA 3KSHA 4LRYC 4BWIA 2FZ0A 3PBQA 4M4XA 1F9IA 3IBJA 1NLYA 4FSFA 4WEJA 1T18A 4BBUA 4Y5FA 4I3IA 2Z6CA 5K5BA 3PBNA 4NXFA 2V0UA 5HPIA 3LIFA 4NEED 2VJWA 1LSWA 3A0VA 1F98A 3ICYA 3LI8A 4R70A 5J3WA 5TBMA 1MZUA 2M1CA 3OOVA 4MN5A 2XROA 3F1OB 3EEAA 3R4KA 3BJNA 4P6ZS 3C30A 1DP9A 1LT0A 2PD8A 2V1BA 5F68A 2QWSA 3CUEA 2CMNA 4Q0IA 3T4SA 3GECA 3JVUA 2VA0A 3ULFA 3CUEC 2JKRM 2Y79A 4WELA 4JGQA 2HGVA 2VEAA 4ME4A 4G3KA 4R38A 3UB6A 5HDCA 4UEYA 1YSQA 1XFQA 3C38A 5C5KA 4CLCB 3IBRA 1GSXA 3LI9A 3D72A 1GSVA 2NUTC 1S4RA 3OBFA 2ZOHA 3T4KA 1OTIA 5CX7A 2V0WA 4DN0A 1OT6A 2QYBA 4YWZA 3VOLA 5A8BA 3RFBA 4MMNA 4CLCE 4Z1WA 3LFVA 2DMWA 3F1OA 1YSPA 3G6OA 3KSGA 3MQOA 3BQAA 3W2ZA 1WA9A 2VZWA 2VV7A 4Y3IA 3MMHA 4HJ4A 2W1TB 3KSIA 3P01A 5F5YA 4XT2B 2O0YA 5HL6A 3HJKA 2ZOIA 2HF6A 4CLCA 3EQVA 5HWWA 2Y8HA 3TW8A 3UB8A 4CLCC 1OTEA 2INWA 2G7UA 2O99A 5HD3A 1XJ2A 3BY8A 3TRCA 3FPWA 2VKSA 1P97A 1OTDA 1ZHHB 5IU1A 4O01A 2JHEA 1T1CA 4PHTA 4O8GA 3U2AA 3E0YA 2PD7A 1T1AA 3A0SA 3CWFA 5HDDA 3VV4A 4JGPA 4YNRA 3PR6A 2W1RA 2PR6A 2NUPC 4WEKA 3HJIA 4FOFA 2PYPA 1UWNX 3BW6A 2O9AA 5DF9A 4G3VA 3E4PA 3T4OA 1N9OA 4UQIS 5DFXA 3RTYA 4I39A 3OCLA 4WUJA 2Z6DA 1JNUA 4R3AA 5J7EA 4I3AA 5EFWA 1G28A 1XJ4A 4DMZA 3B47A 1P9WA 4HHDA 5HSQA 4NKPA 3E4QA 2BASA 2K31A 2L4RA 1XJ6A 2P04A 1ZTUA 1IFQA 2V9AA 3EOIA 2EWWA 2B02A 4Q0JA 3RH8B 1S1YA 3K3CA 4EU0A 1F5MA 2YKHA 5DJUA 2L0WA 4K08A 3UMEA 4BBVA 2R78A 1TS8A 2OOLA 1T1BA 4HY8A 3E98A 3MF0A 4WLAA 4DJ3A 3FC7A 2VLGA 4HJ3A 3JVVA 3EEHA 3PYPA 3LR0A 1IOUA 4Q0HA 3UE6A 4WF0A 4O0PA 3LR3A 3SW1A 3UB9A 1T19A 3UE3A 1GSWA 4EQ1A 4EEUA 3NOTC 3MJQA 4L9EA 1V9ZA 4DJ2A 3PBSA 1XJ3A 5AVFA 3P7NA 2GNXA 5KIZA 1W63Q 4EW7A 4B93A 3T4QA 2B18A 2QKPA 3C8CA 4BMWA 2QJ5A 4ZRRA 5F6AA 3LIBA 1TS7A 1UGUA 2GJ3A 4ETXA 3S7QA 2J80A 4KQDA 1DRMA 2VGLS 2A24B 4EESA 4ETZA 2YKFA 2EA9A 1V9YA 4UQIM 1YKDA 2IA2A 3MR0A 3IS2B 2GX5A 3KO6A 3S7PA 2O9CA 5DKKA 4PKYA 1H8MA 5FL3A 4P6ZM 4HP9A 3HCYA 1NLZA 2PDRA 3BY9A 1TF1A 2H28A 3NJAA 4WL9A 2HJEA 4IJGA 5LBRA 5DKLA 1DP8A 1X0OA 3K3DA 4KQOA 1OPXA 1LSXA 3CLOA 4PAUA 5TBMB 3OLOA 4HI4A 2M7VA 2W3FA 4LLOB 3MQ0A 2J3TD 1S4SA 2FH5A 2JKTI 2PT7A 1OTBA 2QJ7A 2W1TA 3T4LA 3LIDA 1H3QA 3NOPC 1EW0A 2ZMVA 5F69A 2W3EA 4HNBA 4NXGA 3VE4A 3OC2A 4H6JB 1S1ZA 4XT2A 5G4YA 3KX0X 2A24A 4AFIA 2W0NA 1VHMA 4GHIB 1P0ZA 4L9GA 2XA7S 3TJZC 3B33A 5HDSA 5HWTA 3IS2A 4I5SA 5HZHA 3MQQA 2VV8A 3LR4A 4MN6A 2KX6A 2J3TC 4HP4A 3H7WB 1N9NA 4LPZA 3ZYTA 2QHKA 5HPFA 5AVEA 5KSHA 3PHYA 4MCWA 4GS9B 1DP6A 5MC7A 3MFXA 4II7A 4NXEA 3V67A 3F1NB 3CI6A 1NWZA 2KLIA 5DJTA 2JKTM 4GCZA 4JGOA 3EGXC 5G4ZA 5I5LA 3BQ8A 2PR5A 4F3LB 1OJGA 3F1PB 1S67L 2W3GA 3NOUC 2VGLM 5IT5A 3PBOA 2GZAA 3FG8A 3FPVA 4EETB 1P9RA 4YOFA 2W3HA 2WKPA 4R6LA 4RQ9A 2P7JA 4H6JA 3S7OA 3KYZA 3OCNA 3ZQ5A 4GLQA 4GHIA 3DBAA 1LL8A 2P08A 1ODVA 3CAXA 4MDZA 2O9BA 4HOIA 4E04A 3BWLA 4JGRA 2MJ6A 4ARZB 2V1AA 3MXQA 1D06A 1XFNA 2K2NA 3K2NA 3H7WA 4I38A 3LYXA 4L9FA 4MN7A 1KOUA 2KOIA 5HWVA 1TS6A 2JN7A 3NHQA 4G3WA 1MKMA 4GS9A 3O5YA 1UWPX 5TJJA 4HIAA 3H9WA 4HJ6A 4KUKA 3F1NA 1OJ5A 1MC0A 2LB9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YSQ A;  4PAU A;  5C5K A;  4LRZ E;  3IBR A;  2M7V A;  2W3F A;  4DMZ A;  3CIT A;  3OBF A;  5DFY A;  3MQ0 A;  1TD5 A;  5HSQ A;  2W1T A;  2K31 A;  3NOP C;  1ZTU A;  2W3E A;  4DN0 A;  4Y2F A;  2QYB A;  4Q0J A;  3RFB A;  4MMN A;  1VHM A;  4Z1W A;  4EU0 A;  1F5M A;  4QPR A;  3LFV A;  2ZMF A;  1YSP A;  3D3O A;  4IUK A;  3G6O A;  2OOL A;  3KSF A;  3KSG A;  4CQH A;  4EUV A;  3E98 A;  3MF0 A;  4GW9 A;  3W2Z A;  2VZW A;  5HPF A;  2W3D A;  3C2W A;  2LB5 A;  4Q0H A;  4Y3I A;  3S7N A;  4MCW A;  3MMH A;  2W1T B;  3KSI A;  4O0P A;  2O0Y A;  5HL6 A;  3NOT C;  5AJG A;  3CI6 A;  2KLI A;  4IUH A;  5I5L A;  2XRN A;  2Y8H A;  5L8M A;  1STZ A;  2G7U A;  2W3G A;  3NOU C;  2O99 A;  4G3K A;  2M7U A;  2XSS A;  4YOF A;  2B18 A;  3TRC A;  2W3H A;  4LRX C;  4R6L A;  3KSH A;  2VKS A;  4RQ9 A;  3S7O A;  4LRY C;  4ZRR A;  4BWI A;  3ZQ5 A;  3IBJ A;  4GLQ A;  5K5B A;  4ETX A;  3DBA A;  4O01 A;  4Y5F A;  3S7Q A;  4MDZ A;  5HPI A;  4O8G A;  2O9B A;  4ETZ A;  2VJW A;  4R70 A;  3E0Y A;  4E04 A;  1YKD A;  3OOV A;  2IA2 A;  2XRO A;  3EEA A;  3R4K A;  3VV4 A;  2K2N A;  3BJN A;  3K2N A;  2GX5 A;  3KO6 A;  4YNR A;  2W1R A;  3S7P A;  2O9C A;  4MN7 A;  2KOI A;  3NHQ A;  4FOF A;  4G3W A;  1MKM A;  2O9A A;  3O5Y A;  4G3V A;  4Q0I A;  5TJJ A;  2Y79 A;  3HCY A;  5DFX A;  1TF1 A;  2HGV A;  2VEA A;  4ME4 A;  4IJG A;  5LBR A;  1MC0 A;  2LB9 A; 
#chains in the Genus database with same CATH topology
 4E3L A;  4ZJ2 A;  1Y28 A;  3VSK A;  4F3L A;  3B42 A;  5AQA A;  2RCX A;  1CJF A;  3UB7 A;  1OTA A;  4CLC D;  4LV3 A;  1SZV A;  4LV0 A;  3UMD A;  3LIE A;  3T4T A;  3QHY A;  2ZQ7 A;  4S2K A;  5M18 A;  1G6O A;  1OT9 A;  5CED A;  4B9O A;  4NK3 A;  1YMX A;  4JF5 A;  1FQG A;  1S66 L;  5IS1 A;  4IVI A;  4EUV A;  3VMA A;  2LB5 A;  2DRW A;  2HJ9 C;  4PPR A;  4GN2 A;  5KZH A;  4DXB A;  4K91 A;  4BEN A;  5AJG A;  5KSC A;  4NET A;  4R4R A;  4OKP A;  4IUH A;  3T1S A;  4PM7 A;  2XRN A;  1Z6F A;  5J8X A;  3BYD A;  3LR5 A;  1LSV A;  3DTK A;  4HH3 A;  4PM8 A;  4LRX C;  2EWV A;  5EE8 A;  4M4X A;  1F9I A;  1JWZ A;  1T18 A;  2UWX A;  2XFS A;  4I3I A;  4Y5F A;  4CJN A;  3PBN A;  3N4I A;  2WKH A;  3QP6 A;  5EVI B;  3A0V A;  1LSW A;  4OOY A;  1G6A A;  2M1C A;  4MN5 A;  2E8J A;  3EEA A;  1TEM A;  1G68 A;  1LT0 A;  4WBG A;  3V39 A;  3A3D A;  5EM1 A;  4DDS A;  3T4S A;  3GEC A;  2XK1 A;  2VA0 A;  2Y59 A;  2Y79 A;  1U60 A;  4GB7 A;  3N8R A;  2HGV A;  3G30 A;  4CPK A;  3DWZ A;  4UEY A;  5HDC A;  1GSX A;  5EEC A;  2WGV A;  4UHU A;  2ZOH A;  3ITA A;  1DY6 A;  5CX7 A;  4DKI A;  1YLY A;  4DN0 A;  3GMW A;  2QYB A;  4OQG A;  3W8K A;  1CEG A;  5A8B A;  4MMN A;  1YMS A;  2XQZ A;  5L10 A;  3LFV A;  3C7V A;  3MQO A;  3LEZ A;  3BQA A;  3W2Z A;  4X25 A;  5FA7 A;  3Q7V B;  5F5Y A;  1HVB A;  4S2N C;  3HBR A;  5E2G A;  5HL6 A;  3TSG A;  2ZOI A;  1W8Q A;  2XD1 A;  3IWI A;  1IYP A;  2Y8H A;  3UB8 A;  4CLC C;  4E3N A;  1NY0 A;  2G7U A;  1FCO A;  3CHW P;  2O99 A;  3DAV A;  1ERQ A;  1OTD A;  4U0X A;  1K56 A;  5F1G A;  4O01 A;  3ZVW A;  4KZ6 A;  4Y0O A;  5FQ9 A;  4QHC A;  4JGP A;  1HTZ A;  1FIK A;  3AGD A;  3NY4 A;  1VEU A;  4DE3 A;  2PYP A;  4R3B A;  4KZB A;  3Q7V A;  2O9A A;  1KDW A;  3E4P A;  3T4O A;  4UQI S;  1XA7 A;  4KZ4 A;  4OQI A;  3HLC A;  3UNW A;  2Z6D A;  4I3A A;  3IF6 C;  2R9W A;  5EUA A;  1XJ4 A;  4HHD A;  2BLS A;  5HSQ A;  3E4Q A;  1PW1 A;  3HLB A;  4OH0 A;  1GCE A;  4Q0J A;  4E3O A;  1N4O A;  3K3C A;  2IWD A;  4YIN A;  2OLV A;  3OPL A;  5CTM A;  5DJU A;  2EX6 A;  4KG6 A;  2OOL A;  3OZH A;  3QP2 A;  3E2L A;  1T1B A;  2XH9 A;  5TR7 A;  3E98 A;  4WLA A;  4IED A;  2VLG A;  2H10 A;  1LL5 A;  4HJ3 A;  3JVV A;  2CC1 A;  3EEH A;  4JXW A;  3O87 A;  1IOU A;  1MBL A;  3IHB A;  1I5Q A;  4O0P A;  1F2K A;  3UB9 A;  3LY4 A;  4ZBE A;  5CHU A;  2EX9 A;  4EQ1 A;  4EEU A;  3BFG A;  3LCE A;  3HUO A;  3WRZ A;  4BLM A;  2ZQD A;  3MS6 A;  3ISG A;  4EW7 A;  4B93 A;  1D1J A;  3S1Y A;  4UA9 A;  1H8Y A;  3UY6 A;  1TS7 A;  3ZG0 A;  4KQD A;  3IH8 A;  3SS5 A;  2A24 B;  3A3I A;  2XDM A;  1PZP A;  1S6R A;  2IA2 A;  3MR0 A;  3FZC A;  1GA0 A;  5DTS A;  2V8F A;  1VQQ A;  5G18 A;  3G32 A;  2EXA A;  1H8M A;  4FTX A;  2X71 A;  1BUL A;  4P6Z M;  4HP9 A;  3HCY A;  1NLZ A;  3OPP A;  2H28 A;  1AXB A;  4LFU A;  1DP8 A;  4KQO A;  4P0M A;  3TOI A;  5FQQ A;  2J7V A;  1ESI A;  2W3F A;  2J9O A;  3BFE A;  2DNS A;  2J3T D;  2PT7 A;  1OTB A;  2W1T A;  1H3Q A;  5F69 A;  1GHM A;  2Q0O A;  4XT2 A;  2A24 A;  1IYO A;  5GLA A;  3SS4 A;  2XA7 S;  3IXH A;  3ZFZ A;  3G4P A;  4MLL A;  3WRT A;  2VV8 A;  4MN6 A;  3HLW A;  2Y2M A;  2C6W B;  5CGW A;  2E8I A;  1DJC A;  3WS4 A;  4GD8 A;  1JVJ A;  2DCF A;  4KQQ A;  3ZNY A;  3VP0 A;  1DP6 A;  4OPZ A;  3E2K A;  5MC7 A;  1RCJ A;  4UA6 A;  2BG1 A;  2Y2N A;  4LCM A;  3UE1 A;  2V2F F;  1XGJ A;  2R9X A;  5HFO A;  2HZ5 A;  1NWZ A;  4JGO A;  3BQ8 A;  2W3G A;  4QY5 A;  2GZA A;  3W4P A;  4EET B;  1H0M A;  2WKP A;  3ZG8 B;  2P7J A;  3ZQ5 A;  1PI5 A;  5GL9 A;  1MWR A;  3DBA A;  4Y0T A;  2P08 A;  4DF6 A;  1ODV A;  2O9B A;  3BLS A;  1TVF A;  2JBF A;  1XPB A;  4JGR A;  2MJ6 A;  4ARZ B;  2V1A A;  1A0K A;  2K2N A;  3K2N A;  4I38 A;  3LYX A;  5AQ7 A;  4C3Q A;  4ZJ1 A;  3O5Y A;  5GLD A;  3OPR A;  1CI8 A;  4KZ8 A;  2Y2G A;  3IX8 A;  4GNU A;  1OJ5 A;  1MC0 A;  2LB9 A;  4X68 A;  3VFF A;  4LRZ E;  2P9V A;  4KUO A;  3GDI A;  3CIT A;  3H82 B;  4I3J A;  3HUM A;  1JWV A;  1TS0 A;  1TD5 A;  3VE3 A;  1SKO A;  3WS5 A;  3NCK A;  3G2Y A;  3MXR A;  4BD0 A;  4IBX A;  2ZBB A;  3DWK A;  2A2L A;  1ZG6 A;  3FKV A;  2OAQ 1;  4QPR A;  4EXO A;  1K56 D;  4KZ3 A;  4HH2 A;  4ARZ A;  4BBT A;  2D01 A;  3HL9 A;  3NDE A;  4MBF A;  2WKR A;  1IYQ A;  2L1M A;  3KYQ A;  3C2W A;  4FH4 A;  3MXS A;  1NRJ A;  4HBT A;  2HDR A;  1BYW A;  1J9M A;  4WN5 A;  3T50 A;  3QNC A;  1I2W A;  2PYR A;  4IVK A;  3E4O A;  2JKR I;  4EEP A;  5L8M A;  3H82 A;  2I9V A;  3UB5 P;  4GJ4 A;  5DF8 A;  3A3F A;  4BJP A;  3IH9 A;  4NXB A;  3EGD C;  3O3V A;  3QP5 A;  4MBH A;  2FZ0 A;  3PBQ A;  1BLS A;  5HX9 A;  1XKZ A;  2J9P A;  4FSF A;  5K5B A;  3BFF A;  1NXY A;  4BBU A;  5D3O A;  2HPB A;  2V0U A;  1ACF A;  4ZDX A;  3LIF A;  4NEE D;  5HPI A;  2VJW A;  3NEC A;  1F98 A;  3Q82 A;  5F83 A;  1MZU A;  3B3X A;  3OOV A;  3F1O B;  3BEC A;  4OVD A;  3BJN A;  1QMF A;  1NYY A;  2V1B A;  2VGK A;  1L0G A;  5F68 A;  2QWS A;  2B5R A;  3CUE A;  1MY8 A;  3UPP A;  4Q0I A;  1SHV A;  4EUZ A;  2ZC6 B;  3JVU A;  2JKR M;  2ZM8 A;  5KMW A;  4WEL A;  4EBL A;  4HES A;  5FEG A;  4G3K A;  4LEN A;  5U47 A;  3JYI A;  3C38 A;  5C5K A;  4UA7 A;  2EX2 A;  2XD5 A;  3IBR A;  5FQJ A;  3LI9 A;  3RXW A;  3D72 A;  3HLE A;  1GSV A;  2NUT C;  1OT6 A;  4D60 A;  3HUN A;  5EVI C;  2V8C A;  3F1O A;  3W4O A;  5EM0 A;  4P87 A;  3S22 A;  5FQK A;  4JXG A;  1WA9 A;  4U3T A;  5CEC A;  2VV7 A;  1ONH A;  4QWO A;  2GDN A;  3GRJ A;  4E3M A;  1PRQ A;  2HF6 A;  1IKI A;  3EQV A;  4R0Q A;  1OTE A;  1YLP A;  5HD3 A;  1XJ2 A;  3BY8 A;  2WGI A;  3BFC A;  1ZHH B;  3UPO A;  2G2U A;  4PHT A;  2P74 A;  3U2A A;  3CPT B;  3HVF A;  2XGN A;  1W7F A;  5EVL A;  2NUP C;  4HEF A;  3GQZ A;  1AWI A;  2XLN A;  3VP4 A;  3MKF A;  3ZVT A;  2ZJ9 A;  3OCL A;  5J7E A;  4OP8 A;  1IYS A;  1L0D A;  4MEZ A;  3WS2 A;  4DMZ A;  4IBR A;  5FAO A;  4N1H A;  5FI2 A;  4E3I A;  3ZG7 B;  4GDB A;  2L4R A;  1ZTU A;  3DTE A;  3SZT A;  3TG9 A;  3CPT A;  1S1Y A;  1F5M A;  2YKH A;  1YM1 A;  1KE4 A;  1ES3 A;  5HL1 A;  3WS1 A;  3QP8 A;  3FKW A;  4BBV A;  1TS8 A;  1GHI A;  2WKE A;  4B4Z A;  2FFF B;  4HY8 A;  5BOH A;  1BLC A;  3GV9 A;  4FUW A;  5EPH A;  2WGW B;  3C4O A;  3DW0 A;  4LV1 A;  4JF4 A;  4Q0H A;  2QMI A;  3NI9 A;  1IEL A;  3QP1 A;  3O88 A;  4WF0 A;  4EV4 A;  1KGE A;  1FR1 A;  1YT4 A;  3LR3 A;  5EVI A;  1GSW A;  5TGF A;  1ZG4 A;  4GDN A;  5FAP A;  4JXS A;  4L9E A;  1V9Z A;  4DJ2 A;  1XJ3 A;  5AVF A;  1SDN A;  3FV7 A;  3N8S A;  3BRM A;  1ERM A;  3BFD A;  4ZRR A;  2Y2L A;  4GOG A;  4ETZ A;  2HP9 A;  2EA9 A;  4UQI M;  1I2S A;  2EXB A;  2WGW A;  3S7P A;  2AVX A;  1ZC2 A;  3HLD A;  5FL3 A;  3G31 A;  3NIA A;  4R23 A;  3BY9 A;  1TF1 A;  2Z2L B;  3NJA A;  4WL9 A;  4IJG A;  3IX3 A;  4RX3 A;  3K3D A;  3HLG A;  4PAU A;  5TBM B;  3OLO A;  1PFL A;  4N9K A;  1FCM A;  2XEP A;  3CJM A;  2QJ7 A;  4HBU A;  3NOP C;  2ZMV A;  3VE4 A;  3OC2 A;  4H6J B;  5G4Y A;  3KX0 X;  1JTD A;  1SDE A;  1VHM A;  5CER A;  1K25 A;  2B95 A;  1IKG A;  1KGF A;  1P0Z A;  4O7D A;  3LR4 A;  1BLH A;  2G2W A;  3L9K A;  3IHA A;  1L0F A;  4DE1 A;  5E2F A;  1RGZ A;  4MCW A;  3T1X A;  3DTI A;  4XUZ A;  4II7 A;  3V67 A;  2KLI A;  5DJT A;  4GCZ A;  4JF6 A;  1OJG A;  3F1P B;  1S67 L;  3NOU C;  5IT5 A;  1FSW A;  3FG8 A;  1P9R A;  4YOF A;  3QP4 A;  1K0K A;  4RQ9 A;  4PM5 A;  3GVB A;  4RX2 A;  4H6J A;  1XGI A;  3KYZ A;  3OCN A;  5CHJ A;  4Q8I A;  5GLB A;  5A93 A;  2OLU A;  3CG5 A;  4HOI A;  3SH8 A;  4E04 A;  4KZ7 A;  3BWL A;  3MXQ A;  3L7H A;  2KOI A;  4OP5 A;  1WE4 A;  1TS6 A;  2JN7 A;  5E2H A;  3IWQ A;  4G3W A;  5CRF A;  5AQ9 A;  2EFU A;  5TJJ A;  3U4L P;  1TDL A;  2XF3 A;  4HJ6 A;  4ESP A;  3T1R A;  3Q07 A;  4OON A;  4GD6 A;  4XUX A;  3F1P A;  3SOI A;  3PBT A;  3A0R A;  2VV6 A;  4ZTK A;  4K0X A;  2XA7 M;  5L09 A;  4JBF A;  4QU3 A;  5L07 A;  1GHP A;  1ONG A;  3S4X A;  4Y2F A;  3D9Y A;  4MBK A;  4H8R A;  1YAX A;  4OQ0 A;  1VB6 A;  1G5U A;  5DVA A;  4S2M A;  3D3O A;  3ZNT A;  3LIC A;  3ZHH A;  3KSF A;  4CQH A;  1ES5 A;  4F94 A;  5FDS A;  2WKQ A;  3M6H A;  4OPY A;  5IHV A;  3S7N A;  2K7S A;  2PHY A;  2ZD8 A;  1E3U A;  3NDG A;  2OAP 1;  4HQA A;  2ZC3 B;  4XXR A;  4Y17 A;  2OWH A;  3LUQ A;  1YLW A;  4RA7 A;  4BL3 A;  3V50 A;  3ZG5 A;  4PKY G;  1CK3 A;  1STZ A;  3EWK A;  4N1X A;  2VX8 A;  3KYE A;  2XSS A;  2W27 A;  4C75 A;  1LI9 A;  3GR2 A;  4BWI A;  1Q2Q A;  3IBJ A;  1NLY A;  4OQH A;  4WEJ A;  4LCL A;  2Y2I A;  4NXF A;  2H0Y A;  3ICY A;  2WUQ A;  3Q7Z A;  4R70 A;  5J3W A;  1E4D A;  4X55 A;  4Y7P A;  2XRO A;  2VK3 A;  2PU4 A;  4P6Z S;  3C30 A;  4U0T A;  1M6K A;  1SKF A;  2CMN A;  3NC8 A;  1MWS A;  1TDG A;  3CUE C;  1CF0 A;  3VOY A;  3GSG A;  1WYC A;  2VEA A;  4ME4 A;  3BEB A;  4R38 A;  4ID4 A;  5EVI D;  1XXM A;  1YSQ A;  1XFQ A;  2HDU A;  1S4R A;  2UV0 E;  3IQA A;  5L2F A;  4GZB A;  4P6B A;  3BLM A;  1OTI A;  2V0W A;  4EBN A;  3CZD A;  4X69 A;  1K55 A;  4CLC E;  1YSP A;  3G35 A;  3UDX A;  1H5X A;  3G6O A;  3KSG A;  1ES2 A;  2PAV P;  4EQI A;  5EOO A;  4KQR A;  4Y3I A;  4HJ4 A;  4KEN B;  3KSI A;  3P01 A;  4WMC A;  2C5W B;  3HJK A;  4Y13 A;  5HWW A;  4K0W A;  3TW8 A;  4DDY A;  4Z9Q A;  3MZD A;  4DXC A;  4PM6 A;  2VKS A;  2Y4A A;  5IU1 A;  3SH7 A;  1VM1 A;  5FAS A;  1T1C A;  2PD7 A;  3A0S A;  1KE0 A;  3CWF A;  5HDD A;  5FQI A;  2RL3 A;  4YNR A;  1MPL A;  3PR6 A;  4E3J A;  3HJI A;  4FOF A;  1UWN X;  4JKT A;  4G3V A;  3T12 B;  1C3B A;  5DFX A;  1KDS A;  4M3K A;  4C6Y A;  3ZDJ A;  4I39 A;  1MXO A;  3A3E A;  1JNU A;  2IWB A;  1G28 A;  4KZ9 A;  1PWD A;  4DE0 A;  1P9W A;  1RP5 A;  4NKP A;  4R3J A;  2P04 A;  1PW8 A;  2EWW A;  2B02 A;  1BLP A;  2HDQ A;  5HAI A;  5FSR A;  3V3R A;  4EU0 A;  2WAF A;  1HZO A;  3OPH A;  2R78 A;  4WZ4 A;  4LV2 A;  1MWU A;  3MF0 A;  4DJ3 A;  3V3S A;  3MFD A;  4S2P A;  5GHY A;  5FDH A;  3PYP A;  5FEF A;  1BSG A;  3LR0 A;  2HDS A;  4NG2 A;  4UAA A;  1IEM A;  5JYO A;  3SW1 A;  1L0E A;  1W8Y A;  1Y4O A;  1T19 A;  1K54 A;  2OSU A;  3NOT C;  5CGS A;  2H5S A;  3PBS A;  4X1M A;  1YLJ A;  5KIZ A;  1CEF A;  1W63 Q;  3AGF A;  2JE5 A;  1HLU P;  1NJ4 A;  3GTC A;  2B18 A;  2QKP A;  2EFX A;  2QJ5 A;  3LIB A;  1UGU A;  2J80 A;  1DRM A;  1LHY A;  3LGO A;  4N92 A;  2VGL S;  1Q2P A;  4RVA A;  4X53 A;  1V9Y A;  5GHX A;  3WWX A;  2ZC7 A;  3IS2 B;  2ZC4 B;  2GX5 A;  1FOF A;  4PKY A;  2ZQ8 A;  2X01 A;  5AQB A;  1J3W A;  2PDR A;  1FR6 A;  1BTL A;  3RXX A;  1E3U D;  5LBR A;  3NUL A;  5DKL A;  3HLF A;  1X0O A;  1LSX A;  1RGY A;  1KGG A;  1PYY A;  4HI4 A;  3PTE A;  5DTK A;  2Y2J A;  3MQ0 A;  1SCW A;  2FH5 A;  2JKT I;  3T4L A;  4HNB A;  4NXG A;  1W79 A;  4GHI B;  1CQA A;  4L9G A;  1WYB A;  5HAP A;  3TJZ C;  5CEB A;  3B33 A;  3IS2 A;  5HZH A;  3I7J A;  2KX6 A;  3UE0 A;  5HPF A;  1VET B;  3ZCZ A;  3PHY A;  3MFX A;  4NXE A;  3F1N B;  1XX2 A;  3CI6 A;  1E25 A;  2JKT M;  3EGX C;  2WZX A;  3Q81 A;  2HP6 A;  3PBO A;  3ZG9 B;  2Q9N A;  2W3H A;  4B88 A;  3S7O A;  3QNB A;  3ITB A;  4GLQ A;  3N6I A;  4GHI A;  1LL8 A;  2WKI A;  5FI7 A;  3V5M A;  2ZM2 A;  4R4S A;  5I94 A;  1XFN A;  4L9F A;  2FFY A;  4MN7 A;  1KOU A;  1VET A;  5HWV A;  3IXB A;  3NHQ A;  4R1G A;  1K38 A;  3PAE A;  4JLF A;  1YLT A;  3A3J A;  4HIA A;  3H9W A;  4WZ5 A;  3F1N A;  4WMC D;  3DTM A;  3VP1 A;  3LY3 A;  5HD5 A;  3PBR A;  2Q9M A;  1FSY A;  3P09 A;  5FAT A;  5DFY A;  1VEU B;  1KVM A;  3SH9 A;  3T4J A;  3R7W B;  3TE8 A;  4JXV A;  5DF7 A;  3BM6 A;  1BUE A;  1XP4 A;  2WAD A;  2Y91 A;  4OOL A;  2OWJ A;  4KZA A;  2KDK A;  2EX8 A;  2D02 A;  2ZMF A;  1D7E A;  4IUK A;  2J3W A;  3LIA A;  3VP3 A;  2Y2K A;  2Y55 A;  3IXD A;  3MZF A;  3EQU A;  4GW9 A;  4OPQ A;  3T1Q B;  4OOM A;  1N9L A;  1K6R A;  2W3D A;  1NZO A;  5A92 A;  5CTN A;  4L0L A;  5J4E A;  4IHQ A;  4BD1 A;  1PI4 A;  3PXP A;  4D2O A;  1NYM A;  3MZE A;  4RYE A;  4PM9 A;  4OLG A;  4S2O A;  3VSL A;  1H8Z A;  1W63 M;  1CI9 A;  4EER A;  2M7U A;  3R7W A;  2HV1 A;  2WAE A;  3SS3 A;  1W5D A;  3KSH A;  1M40 A;  4LRY C;  1ES4 A;  3C4P A;  2Z6C A;  3JPU A;  2V20 A;  5E2E A;  3LI8 A;  4KG2 A;  2H0T A;  5TBM A;  4KZ5 A;  3UDI A;  4YFM A;  3R4K A;  1DP9 A;  4BQM A;  2JCH A;  2PD8 A;  3Q1F A;  5CHM A;  1N9B A;  1ALQ A;  3G34 A;  3ULF A;  3M2J A;  1YLZ A;  1LI0 A;  4JGQ A;  4Y0U A;  4DRT A;  4FD8 A;  1YPR A;  5HW3 A;  3UB6 A;  1BZA A;  5E43 A;  3RJU A;  2ZLY A;  4CLC B;  4E6W A;  2I72 A;  1PZO A;  1XA1 A;  3OBF A;  3T4K A;  4ZAM A;  2OV5 A;  1ERO A;  1FIL A;  4YWZ A;  4N9L A;  3VOL A;  3RFB A;  4Z1W A;  1K55 C;  5EVE A;  2DMW A;  5GHZ A;  3MBZ A;  4X1L A;  1K4F A;  1O7E A;  2A3U A;  5JYP A;  3IT9 A;  3UN7 A;  2VZW A;  1K6S A;  4QY6 A;  3PAG A;  3MMH A;  4S2N A;  2W1T B;  2HP5 A;  1JWP A;  1QME A;  3W4Q A;  4XT2 B;  5EOE A;  2O0Y A;  3IX4 A;  2V1Z A;  2PBY A;  3AGE A;  4CLC A;  3FYZ A;  3UO9 A;  1Z09 A;  5A90 A;  3M6B A;  3IF6 B;  2INW A;  3C5A A;  1KE3 A;  3O86 A;  1FCN A;  3TRC A;  3FPW A;  1P97 A;  3WS0 A;  3CMZ A;  4E3K A;  2JHE A;  2XR0 A;  1K4E A;  4O8G A;  2ZM0 A;  3E0Y A;  3D4F A;  1T1A A;  1LL9 A;  2WZZ A;  3VV4 A;  1O07 A;  2W1R A;  2PR6 A;  4WEK A;  4FH2 A;  1HD8 A;  3BW6 A;  3MKE A;  5DF9 A;  1PNE A;  3VOZ A;  1N9O A;  3RTY A;  4QB8 A;  2ACG A;  5CGX A;  4EWF A;  4R3A A;  3MSH A;  3IF6 A;  1S0W A;  3UPN A;  5EFW A;  4E6X A;  5M19 A;  2WK0 A;  1DJB A;  4ZJ3 A;  3B47 A;  4QJG A;  2ZQ9 A;  2BAS A;  2K31 A;  4DE2 A;  5F1F A;  1XJ6 A;  3EOI A;  1IFQ A;  2V9A A;  3LEQ A;  3IF5 A;  3RH8 B;  4P85 A;  1ZKJ A;  1LLB A;  1Y54 A;  1PWC A;  2L0W A;  4K08 A;  1NRF A;  1EI5 A;  3UME A;  4PMA A;  4EBP A;  2ZC5 B;  2P9V B;  4OLD A;  3FC7 A;  2IWC A;  1PIO A;  1SKO B;  3UE6 A;  2Y2H A;  2J8Y A;  2Z2M B;  3UE3 A;  2Y2Q A;  2A49 A;  3MJQ A;  2ZMA A;  1K54 C;  2BTF P;  3P7N A;  4X6T A;  2GNX A;  4A5R A;  4S2L A;  1KVL A;  3T4Q A;  4S2I A;  1K57 C;  3C8C A;  4BMW A;  5F6A A;  1DJA A;  2GJ3 A;  4WM9 A;  4ETX A;  3S7Q A;  2PBD P;  4EES A;  2YKF A;  1YKD A;  3IXG A;  2X02 A;  2JKF A;  3KO6 A;  2VGJ A;  3UDF A;  5CXW A;  2O9C A;  5DKK A;  2QPN A;  1L2S A;  2Y2O A;  2JKG A;  3HRE A;  2WYX A;  4QD4 A;  2HJE A;  4KG5 A;  1OPX A;  1MWT A;  1NZU A;  3CLO A;  5FAQ A;  5M1A A;  3M2K A;  5GLC A;  2M7V A;  3NBL A;  5FI6 A;  1BT5 A;  4LLO B;  1S4S A;  5F82 A;  1ESU A;  3LID A;  2ZQC A;  1EW0 A;  2W3E A;  4S2J A;  1S1Z A;  1EWZ A;  4AFI A;  2W0N A;  2ZL1 B;  4B4X A;  5HDS A;  5HWT A;  4I5S A;  5EV0 A;  5A91 A;  3MQQ A;  1JTG A;  3VFH A;  5DTT A;  2J3T C;  1OME A;  4HP4 A;  3H7W B;  1N9N A;  4LPZ A;  4LGW A;  2QHK A;  3ZYT A;  4BL2 A;  5AVE A;  5KSH A;  2PRF A;  3P98 A;  4GS9 B;  2XFT A;  5HAR A;  1L3L A;  5I5L A;  5G4Z A;  3FWL A;  3VP2 A;  1MKI A;  2PR5 A;  3IWO A;  4F3L B;  2VGL M;  1GA9 A;  4GKU A;  3FPV A;  4R6L A;  4FCF A;  4OPR A;  3ZGA B;  2ZQA A;  4MNR A;  5HAQ A;  4Y15 A;  2ZL1 A;  5FQM A;  2Y2P A;  3CAX A;  4X56 A;  4MDZ A;  3C7U A;  4WYY A;  3G2Z A;  2PU2 A;  1PWG A;  1D06 A;  4JPM A;  3H7W A;  1YQS A;  3N8L A;  1K57 A;  1MKM A;  3LO7 A;  3N7W A;  4GS9 A;  1UWP X;  5TFQ A;  2QZ6 A;  2JC7 A;  4KUK A;  4WZ5 C;  4WUJ A; 
#chains in the Genus database with same CATH homology
 1Y28 A;  4F3L A;  3B42 A;  3F1P A;  5HD5 A;  3PBR A;  4LRZ E;  3UB7 A;  1OTA A;  4KUO A;  3PBT A;  4CLC D;  3A0R A;  2VV6 A;  3GDI A;  3CIT A;  2XA7 M;  3H82 B;  4I3J A;  1TS0 A;  5DFY A;  1TD5 A;  3UMD A;  3VE3 A;  3T4J A;  3R7W B;  3TE8 A;  2ZBB A;  3LIE A;  3T4T A;  4Y2F A;  2A2L A;  1YAX A;  2OWJ A;  4OOL A;  2KDK A;  1VB6 A;  2OAQ 1;  4QPR A;  4EXO A;  1G6O A;  1OT9 A;  4HH2 A;  4ARZ A;  2D02 A;  2ZMF A;  1D7E A;  4B9O A;  3D3O A;  4IUK A;  2J3W A;  3LIA A;  3LIC A;  4BBT A;  3KSF A;  1S66 L;  4CQH A;  4EUV A;  5IS1 A;  2D01 A;  4GW9 A;  3EQU A;  2WKQ A;  2WKR A;  4OOM A;  1N9L A;  2L1M A;  2W3D A;  3KYQ A;  3C2W A;  2LB5 A;  3S7N A;  4L0L A;  2K7S A;  2PHY A;  5J4E A;  1NRJ A;  2HJ9 C;  4IHQ A;  1BYW A;  2OAP 1;  3PXP A;  4HQA A;  4WN5 A;  3T50 A;  2OWH A;  2PYR A;  3LUQ A;  3E4O A;  5AJG A;  2JKR I;  4IUH A;  4EEP A;  2XRN A;  5L8M A;  4PKY G;  3EWK A;  1STZ A;  1W63 M;  2I9V A;  3H82 A;  4GJ4 A;  2VX8 A;  4BJP A;  4EER A;  3LR5 A;  2M7U A;  4NXB A;  3EGD C;  2XSS A;  1LSV A;  3R7W A;  2W27 A;  2HV1 A;  4HH3 A;  4LRX C;  2EWV A;  3KSH A;  4LRY C;  4BWI A;  2FZ0 A;  3PBQ A;  4M4X A;  1F9I A;  3IBJ A;  1NLY A;  4FSF A;  4WEJ A;  1T18 A;  4BBU A;  4Y5F A;  4I3I A;  2Z6C A;  5K5B A;  3PBN A;  4NXF A;  2V0U A;  5HPI A;  3LIF A;  4NEE D;  2VJW A;  1LSW A;  3A0V A;  1F98 A;  3ICY A;  3LI8 A;  4R70 A;  5J3W A;  5TBM A;  1MZU A;  2M1C A;  3OOV A;  4MN5 A;  2XRO A;  3F1O B;  3EEA A;  3R4K A;  3BJN A;  4P6Z S;  3C30 A;  1DP9 A;  1LT0 A;  2PD8 A;  2V1B A;  5F68 A;  2QWS A;  3CUE A;  2CMN A;  4Q0I A;  3T4S A;  3GEC A;  3JVU A;  2VA0 A;  3ULF A;  3CUE C;  2JKR M;  2Y79 A;  4WEL A;  4JGQ A;  2HGV A;  2VEA A;  4ME4 A;  4G3K A;  4R38 A;  3UB6 A;  5HDC A;  4UEY A;  1YSQ A;  1XFQ A;  3C38 A;  5C5K A;  4CLC B;  3IBR A;  1GSX A;  3LI9 A;  3D72 A;  1GSV A;  2NUT C;  1S4R A;  3OBF A;  2ZOH A;  3T4K A;  1OTI A;  5CX7 A;  2V0W A;  4DN0 A;  1OT6 A;  2QYB A;  4YWZ A;  3VOL A;  5A8B A;  3RFB A;  4MMN A;  4CLC E;  4Z1W A;  3LFV A;  2DMW A;  3F1O A;  1YSP A;  3G6O A;  3KSG A;  3MQO A;  3BQA A;  3W2Z A;  1WA9 A;  2VZW A;  2VV7 A;  4Y3I A;  3MMH A;  4HJ4 A;  2W1T B;  3KSI A;  3P01 A;  5F5Y A;  4XT2 B;  2O0Y A;  5HL6 A;  3HJK A;  2ZOI A;  2HF6 A;  4CLC A;  3EQV A;  5HWW A;  2Y8H A;  3TW8 A;  3UB8 A;  4CLC C;  1OTE A;  2INW A;  2G7U A;  2O99 A;  5HD3 A;  1XJ2 A;  3BY8 A;  3TRC A;  3FPW A;  2VKS A;  1P97 A;  1OTD A;  1ZHH B;  5IU1 A;  4O01 A;  2JHE A;  1T1C A;  4PHT A;  4O8G A;  3U2A A;  3E0Y A;  2PD7 A;  1T1A A;  3A0S A;  3CWF A;  5HDD A;  3VV4 A;  4JGP A;  4YNR A;  3PR6 A;  2W1R A;  2PR6 A;  2NUP C;  4WEK A;  3HJI A;  4FOF A;  2PYP A;  1UWN X;  3BW6 A;  2O9A A;  5DF9 A;  4G3V A;  3E4P A;  3T4O A;  1N9O A;  4UQI S;  5DFX A;  3RTY A;  4I39 A;  3OCL A;  4WUJ A;  2Z6D A;  1JNU A;  4R3A A;  5J7E A;  4I3A A;  5EFW A;  1G28 A;  1XJ4 A;  4DMZ A;  3B47 A;  1P9W A;  4HHD A;  5HSQ A;  4NKP A;  3E4Q A;  2BAS A;  2K31 A;  2L4R A;  1XJ6 A;  2P04 A;  1ZTU A;  1IFQ A;  2V9A A;  3EOI A;  2EWW A;  2B02 A;  4Q0J A;  3RH8 B;  1S1Y A;  3K3C A;  4EU0 A;  1F5M A;  2YKH A;  5DJU A;  2L0W A;  4K08 A;  3UME A;  4BBV A;  2R78 A;  1TS8 A;  2OOL A;  1T1B A;  4HY8 A;  3E98 A;  3MF0 A;  4WLA A;  4DJ3 A;  3FC7 A;  2VLG A;  4HJ3 A;  3JVV A;  3EEH A;  3PYP A;  3LR0 A;  1IOU A;  4Q0H A;  3UE6 A;  4WF0 A;  4O0P A;  3LR3 A;  3SW1 A;  3UB9 A;  1T19 A;  3UE3 A;  1GSW A;  4EQ1 A;  4EEU A;  3NOT C;  3MJQ A;  4L9E A;  1V9Z A;  4DJ2 A;  3PBS A;  1XJ3 A;  5AVF A;  3P7N A;  2GNX A;  5KIZ A;  1W63 Q;  4EW7 A;  4B93 A;  3T4Q A;  2B18 A;  2QKP A;  3C8C A;  4BMW A;  2QJ5 A;  4ZRR A;  5F6A A;  3LIB A;  1TS7 A;  1UGU A;  2GJ3 A;  4ETX A;  3S7Q A;  2J80 A;  4KQD A;  1DRM A;  2VGL S;  2A24 B;  4EES A;  4ETZ A;  2YKF A;  2EA9 A;  1V9Y A;  4UQI M;  1YKD A;  2IA2 A;  3MR0 A;  3IS2 B;  2GX5 A;  3KO6 A;  3S7P A;  2O9C A;  5DKK A;  4PKY A;  1H8M A;  5FL3 A;  4P6Z M;  4HP9 A;  3HCY A;  1NLZ A;  2PDR A;  3BY9 A;  1TF1 A;  2H28 A;  3NJA A;  4WL9 A;  2HJE A;  4IJG A;  5LBR A;  5DKL A;  1DP8 A;  1X0O A;  3K3D A;  4KQO A;  1OPX A;  1LSX A;  3CLO A;  4PAU A;  5TBM B;  3OLO A;  4HI4 A;  2M7V A;  2W3F A;  4LLO B;  3MQ0 A;  2J3T D;  1S4S A;  2FH5 A;  2JKT I;  2PT7 A;  1OTB A;  2QJ7 A;  2W1T A;  3T4L A;  3LID A;  1H3Q A;  3NOP C;  1EW0 A;  2ZMV A;  5F69 A;  2W3E A;  4HNB A;  4NXG A;  3VE4 A;  3OC2 A;  4H6J B;  1S1Z A;  4XT2 A;  5G4Y A;  3KX0 X;  2A24 A;  4AFI A;  2W0N A;  1VHM A;  4GHI B;  1P0Z A;  4L9G A;  2XA7 S;  3TJZ C;  3B33 A;  5HDS A;  5HWT A;  3IS2 A;  4I5S A;  5HZH A;  3MQQ A;  2VV8 A;  3LR4 A;  4MN6 A;  2KX6 A;  2J3T C;  4HP4 A;  3H7W B;  1N9N A;  4LPZ A;  3ZYT A;  2QHK A;  5HPF A;  5AVE A;  5KSH A;  3PHY A;  4MCW A;  4GS9 B;  1DP6 A;  5MC7 A;  3MFX A;  4II7 A;  4NXE A;  3V67 A;  3F1N B;  3CI6 A;  1NWZ A;  2KLI A;  5DJT A;  2JKT M;  4GCZ A;  4JGO A;  3EGX C;  5G4Z A;  5I5L A;  3BQ8 A;  2PR5 A;  4F3L B;  1OJG A;  3F1P B;  1S67 L;  2W3G A;  3NOU C;  2VGL M;  5IT5 A;  3PBO A;  2GZA A;  3FG8 A;  3FPV A;  4EET B;  1P9R A;  4YOF A;  2W3H A;  2WKP A;  4R6L A;  4RQ9 A;  2P7J A;  4H6J A;  3S7O A;  3KYZ A;  3OCN A;  3ZQ5 A;  4GLQ A;  4GHI A;  3DBA A;  1LL8 A;  2P08 A;  1ODV A;  3CAX A;  4MDZ A;  2O9B A;  4HOI A;  4E04 A;  3BWL A;  4JGR A;  2MJ6 A;  4ARZ B;  2V1A A;  3MXQ A;  1D06 A;  1XFN A;  2K2N A;  3K2N A;  3H7W A;  4I38 A;  3LYX A;  4L9F A;  4MN7 A;  1KOU A;  2KOI A;  5HWV A;  1TS6 A;  2JN7 A;  3NHQ A;  4G3W A;  1MKM A;  4GS9 A;  3O5Y A;  1UWP X;  5TJJ A;  4HIA A;  3H9W A;  4HJ6 A;  4KUK A;  3F1N A;  1OJ5 A;  1MC0 A;  2LB9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...