5HPIA

Crystal structure of the double mutant of pobr transcription factor inducer binding domain-3-hydroxy benzoic acid complex from acinetobacter
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
175
structure length
175
Chain Sequence
AHLPKVAQSFLNLLCAQTSLTFSIVVLDEHEVVPVARSYLPQQDNRVSPYGMHLGNRLPAHATSTGKVLLSVLDREVQIEWIEKYGLKRLTPYTITDEHTFLETLDAVRQSDYCLSTEEHELGVIAIAVPVLNAQGLTIAALNCMSQTNRVQPQYLIDQVLPLLRNTANELRNLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords p-hydroxybenzoate hydroxylase transcriptional activator
publication title A microbial sensor for organophosphate hydrolysis exploiting an engineered specificity switch in a transcription factor.
pubmed doi rcsb
source organism Acinetobacter baylyi str. adp1
total genus 40
structure length 175
sequence length 175
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01614 IclR Bacterial transcriptional regulator
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5hpiA00
5HPFA 3ZQ5A 2XSSA 4YNRA 4E04A 4Y2FA 3K2NA 1F5MA 5TJJA 5HPIA 2XRNA 3OBFA 4EUVA 1VHMA 4PAUA 3MF0A 4O0PA 4O01A 4QPRA 5I5LA 2VKSA 5K5BA 5HL6A 3S7QA 3G6OA 3CITA 3EEAA 4LRYC 3NHQA 3HCYA 3NOUC 2M7VA 2KLIA 4GW9A 5HSQA 2O99A 3KSFA 2VEAA 3E98A 4Z1WA 1TD5A 2W3EA 4IUKA 2XROA 2W1RA 2IA2A 2VZWA 1YKDA 2GX5A 4DN0A 4G3WA 3CI6A 2K2NA 2LB5A 3KO6A 3S7OA 2W3DA 3W2ZA 2Y79A 3IBJA 4IUHA 4ZRRA 5C5KA 4Q0HA 3O5YA 4GLQA 3S7NA 3MQ0A 2QYBA 2W1TA 3NOTC 5AJGA 3C2WA 3S7PA 1STZA 4Y3IA 2Y8HA 3OOVA 5DFYA 3DBAA 4O8GA 1YSQA 4IJGA 4ME4A 5LBRA 2VJWA 5L8MA 4ETXA 2KOIA 2O9CA 2O0YA 2B18A 2G7UA 2O9BA 3NOPC 3TRCA 4BWIA 4YOFA 4RQ9A 1MC0A 3R4KA 4EU0A 2HGVA 3D3OA 3IBRA 4G3KA 1YSPA 2K31A 3E0YA 4R6LA 3KSHA 3KSIA 3MMHA 3KSGA 4R70A 4MN7A 4Q0JA 4G3VA 4DMZA 1ZTUA 3VV4A 2LB9A 4LRZE 4CQHA 5DFXA 2W1TB 3LFVA 4ETZA 3RFBA 3BJNA 2W3FA 4LRXC 4MMNA 4Y5FA 1MKMA 4FOFA 2OOLA 2O9AA 2M7UA 2W3GA 1TF1A 4MDZA 4Q0IA 4MCWA 2W3HA 2ZMFA
chains in the Genus database with same CATH superfamily
1H0MA 3T4KA 3ZG5A 4GKUA 4U0XA 4Y0TA 2WZXA 3OBFA 4O7DA 4E3KA 3IQAA 4WF0A 4MBHA 5DKLA 3H82B 1XP4A 1DJBA 3EEAA 3E2KA 5CERA 3VP0A 4NXEA 4NXBA 5HX9A 5HFOA 2PYPA 4GD6A 2XDMA 5EM1A 3GR2A 5EE8A 5L07A 2ZC5B 1ALQA 4IEDA 4X68A 4HJ6A 3OCNA 3GDIA 3S7NA 4DDYA 2WKQA 4JBFA 3DTMA 3C2WA 3IF6C 3O88A 2HF6A 4FD8A 4EW7A 3U2AA 3DW0A 4E3JA 1YSQA 3TOIA 4CLCD 1SKFA 5AQBA 4GCZA 4PKYG 5DJUA 4N9LA 1H8MA 1MZUA 1UWPX 2G7UA 4QY5A 3MZDA 4P6ZS 3VFHA 4MN7A 2W27A 3RJUA 1ZTUA 2JE5A 1T18A 3GV9A 5CRFA 4ID4A 3Q7VB 1F98A 4LRXC 3FKVA 4Q8IA 5CGWA 1KGGA 3LY4A 2XD5A 2Y2IA 3BYDA 5HZHA 2WKRA 5CHJA 3P7NA 2HP5A 4M4XA 1K56D 3JVUA 4YFMA 4LFUA 4KZBA 4WEJA 3HUOA 1Q2PA 1ES4A 5EFWA 1NWZA 3ICYA 5F1FA 4A5RA 2HDRA 5EVEA 2X01A 2X02A 4HOIA 5AQ7A 1CF0A 3GMWA 4JGQA 4DN0A 3B47A 4JKTA 1PI4A 1OT6A 1Y4OA 3T1XA 3QHYA 4R4RA 5U47A 3W2ZA 1L0GA 3IBJA 3ZVWA 1FQGA 1C3BA 5EVIB 4KZ3A 4RVAA 5AJGA 3LCEA 4S2LA 3HL9A 4HIAA 1CI9A 5JYPA 2A49A 4PM6A 2HP9A 3GECA 4KZ7A 4R1GA 2KOIA 3A3DA 1JWZA 4GJ4A 4EQ1A 1LT0A 4QY6A 3MBZA 1MC0A 1MPLA 1RCJA 1VETA 1GCEA 4ZAMA 2J8YA 1H8ZA 2ZMVA 3IS2B 2PD8A 2P08A 4OQHA 3SH8A 1EI5A 4Y17A 1MBLA 4C3QA 2Y2MA 4CLCA 5HAQA 4HH2A 4PMAA 4BQMA 3MFDA 3C5AA 1S6RA 2B02A 4EEUA 4C75A 1BLPA 3LI8A 5HDSA 3HLCA 2WKPA 1FSWA 5CTNA 2DCFA 4JLFA 1ODVA 3LR0A 3IX3A 2PU2A 2ZQ9A 1YMXA 3K2NA 2HV1A 3LIFA 4OLDA 1P9RA 5GLAA 4PM7A 4GD8A 5HAIA 4EBNA 2W0NA 3HCYA 2M7VA 2OAP1 2KLIA 3MZEA 5HSQA 1FR1A 5FQ9A 1OJ5A 1SDEA 2ZQAA 2EWWA 4ARZA 1K56A 1P97A 2P9VB 3O86A 4IUHA 5E2FA 2ZJ9A 4Q0HA 3O5YA 4BBTA 1MWUA 1BLHA 3B42A 2XH9A 4DXCA 2Y8HA 4K91A 3D9YA 2Y2OA 5DTTA 1G6OA 4UA9A 1DJAA 1OJGA 1M40A 1NLZA 2HZ5A 1GSWA 3C30A 2PYRA 3OC2A 4ZTKA 3M6HA 3NJAA 1VM1A 2XA7S 5E2HA 3MSHA 5G18A 2Y2QA 3JVVA 3S1YA 3CMZA 3BECA 3VSKA 2C6WB 4H6JA 4KENB 4WM9A 4WN5A 3CJMA 1T1AA 1VEUB 4K0XA 3WS5A 4LV3A 1L3LA 4Y5FA 1K0KA 1OT9A 3IH9A 4Q0IA 2A2LA 2PHYA 5TBMB 2KX6A 3VP3A 1X0OA 1W79A 2EXAA 1XA1A 4Y2FA 4UQIS 4GB7A 3UN7A 4BENA 1S1ZA 4EETB 2OWHA 1ES5A 3P09A 5A90A 4KZ5A 3L7HA 3G6OA 4YINA 1PI5A 2WAEA 3V67A 2EXBA 2UWXA 2RCXA 1EWZA 1OMEA 1AWIA 4HJ3A 1E4DA 2D02A 5JYOA 4KQDA 3MQOA 3MXSA 1JNUA 3RH8B 3PBOA 1XX2A 2PT7A 4ZRRA 3UMDA 2G2UA 5HDDA 2E8IA 2ZM0A 1ACFA 3S7PA 2EX2A 1KOUA 3OOVA 1GSXA 1RP5A 2IWCA 2YKFA 3WS1A 2A24B 1JWPA 1SHVA 2DMWA 2VLGA 4PHTA 4NXGA 4KQRA 5DJTA 1WE4A 3G32A 3UPNA 3CPTA 4G3KA 3N4IA 4NXFA 3MKEA 1N9NA 1K6SA 3P98A 3H82A 4L9FA 4MBFA 3A3EA 3OPPA 2VGLM 1KVMA 4P6BA 4WELA 1Q2QA 3HBRA 1LSVA 2ZLYA 5TFQA 1HTZA 2PR6A 1O7EA 1LLBA 4MDZA 2ZMFA 3G34A 3W4QA 1I2WA 2JKFA 3HLDA 3N8LA 4OLGA 2OSUA 1BYWA 1HZOA 3F1PA 1SZVA 4LV0A 4JF5A 4KUKA 1IYPA 2J3TD 3PBQA 3ZVTA 4D2OA 2WADA 4R0QA 3MXQA 3G2ZA 1XFNA 4ZJ3A 3Q7ZA 1BSGA 3VE3A 2QPNA 1FOFA 2Q0OA 1PIOA 3G35A 3HLEA 2IA2A 5F82A 3C7UA 4PM8A 2C5WB 5GLCA 3IXHA 3DTEA 4HNBA 4OH0A 3V39A 1P9WA 3EQUA 1ZG6A 4GLQA 2ZC4B 5CHMA 3Q7VA 4S2OA 3IF6B 3UE6A 1DY6A 3NDEA 5DFYA 4IJGA 3ZCZA 1W7FA 3WRZA 5HARA 3PYPA 4OKPA 1V9ZA 5J7EA 2ZL1B 4QU3A 4M3KA 3IBRA 5L09A 1KDWA 3E0YA 1U60A 5E2EA 2L0WA 1IKGA 5G4YA 3KSGA 4DMZA 3CAXA 2DNSA 1YLPA 5HD3A 1PYYA 4I3IA 3T4OA 4OPZA 3BJNA 5DTKA 1KE0A 2W3FA 1H8YA 5GL9A 1V9YA 1Z09A 4UHUA 4CLCC 4KG2A 2W3HA 2ZD8A 5HPFA 3OPHA 4E6XA 2NUTC 1F5MA 3OPLA 4LPZA 3CZDA 3ZG0A 1YLJA 2IWDA 5I94A 3LICA 2HJEA 2Z6DA 1CJFA 4GNUA 3VP4A 1JVJA 4FCFA 1BTLA 3P01A 3BWLA 1LSXA 3A3JA 4H8RA 4F3LA 1HVBA 3HLFA 1WYBA 5M19A 3LI9A 1G6AA 2QZ6A 4JXWA 3VOYA 3RXWA 1KGFA 4HJ4A 1ZKJA 4MNRA 3QP8A 1D1JA 4WZ5A 2V0WA 1NLYA 3ITBA 2O0YA 3NOPC 5GHXA 1CK3A 3PXPA 4BWIA 4YOFA 4ZBEA 4EU0A 4NETA 2WUQA 3VP1A 1ESUA 2R9XA 3H7WB 3UNWA 3BRMA 3K3CA 4R70A 1T1BA 3IF5A 5M1AA 1CI8A 2Z6CA 3PHYA 5F68A 2Y59A 1XGJA 3LR5A 2BG1A 4I38A 4S2PA 2P9VA 2Y91A 2PAVP 4X56A 4JPMA 5HDCA 4JXVA 5KSCA 3PTEA 1DP8A 3ZDJA 5FDSA 4CLCE 5F83A 4AFIA 5IS1A 1KVLA 1ZHHB 4II7A 3JYIA 5EVLA 4FSFA 3PAGA 4DE0A 3F1NA 1F9IA 3OPRA 3B3XA 4JF4A 5GHYA 1K6RA 2VZWA 1YKDA 5FQQA 3S4XA 3UE3A 4EQIA 4DKIA 4MLLA 4BMWA 2HP6A 3NECA 4R4SA 1VEUA 3K3DA 5TR7A 2D01A 3MQQA 3UB5P 4KQOA 1OTEA 1TEMA 4QB8A 3CWFA 2PBYA 2VJWA 5L10A 3UMEA 1KE4A 1ERQA 1DJCA 3Q1FA 3LIDA 3R4KA 1YPRA 4X55A 2QJ5A 3A3FA 2M1CA 3IX4A 1YT4A 3ZYTA 1TS6A 3IXGA 3IWIA 5A91A 3ZG7B 1GSVA 4GZBA 2QMIA 2J7VA 4B93A 2PD7A 2OOLA 2XK1A 2XF3A 4MN6A 5HL6A 1JTDA 3ZQ5A 4YNRA 1PWDA 3LY3A 3Q81A 3H9WA 4E3LA 1ES3A 3TJZC 2XEPA 3GSGA 4DDSA 2MJ6A 4OPQA 2WGWA 3C7VA 3F1OA 2VGLS 1BUEA 2HPBA 4OP5A 2X71A 4RX3A 3L9KA 4LCMA 3BY9A 1T19A 3EGDC 2XR0A 4GW9A 4UEYA 4HP9A 3SH9A 5M18A 5FQKA 1IEMA 2J3WA 2BTFP 5EV0A 4E3OA 2JC7A 4MBKA 5DKKA 4JXSA 2UV0E 4NEED 5FAPA 2I72A 4ZJ1A 3E4QA 3VSLA 3VP2A 1ONHA 2WKEA 1I2SA 3TG9A 3VOZA 4JXGA 1K4EA 2PBDP 3T1QB 2VV8A 4QD4A 4WL9A 3MJQA 5CGXA 4LLOB 5DF7A 4PM9A 3QP6A 1XFQA 1WA9A 3LEQA 4X69A 1TS0A 1BLSA 4KZ4A 1J3WA 4HP4A 1LL9A 4ZDXA 4GOGA 1AXBA 3GVBA 4FH2A 3SOIA 2OLUA 4JGPA 3ZGAB 4OQ0A 1RGYA 4NKPA 4R38A 1NXYA 2KDKA 3MMHA 2JN7A 5L2FA 3VV4A 1BZAA 2LB9A 2W1TB 3UB7A 3MZFA 2VGJA 4HH3A 4FOFA 5FSRA 4HHDA 1TF1A 2WKHA 1CQAA 4FUWA 3ZG9B 1S1YA 2OV5A 4E3NA 2Y2NA 2JBFA 2QWSA 1PNEA 3S22A 3C38A 4IVIA 4KZAA 3LUQA 4X53A 2HJ9C 5KZHA 5TJJA 1XJ3A 3UE0A 1VHMA 4QJGA 1NRFA 5I5LA 4Z9QA 4Y13A 3CITA 3UB8A 4OQIA 2H0YA 3WS4A 1NJ4A 1TD5A 3N8SA 2W1RA 2ZL1A 4HBUA 3V5MA 3MFXA 5HW3A 1GHIA 2K2NA 3KO6A 3U4LP 4EBPA 1FR6A 5KIZA 3LO7A 2ZOHA 3JPUA 3BM6A 1K4FA 3ZG8B 3HLWA 3TW8A 2EA9A 3NOTC 1STZA 4Y3IA 2J3TC 4KZ6A 5KMWA 4RA7A 3T4LA 5G4ZA 5LBRA 4EWFA 2VX8A 4WZ5C 2ZM8A 5J4EA 5HAPA 1D7EA 3TRCA 1E3UA 4BL3A 4E3MA 4PPRA 3WS2A 5A93A 2R78A 2K31A 1XGIA 4BD1A 4R3AA 1VETB 1SDNA 1N9BA 1W63Q 2XD1A 3T1RA 2H5SA 3BFEA 3T4QA 4R23A 2JKRM 2Q9NA 2WK0A 3HJKA 2V9AA 5FAOA 2PU4A 5EVID 4CLCB 1BT5A 1GA9A 4RYEA 1OTIA 4XXRA 1SKOB 1YLYA 1S4RA 3FG8A 2PDRA 3N6IA 3W4PA 4EEPA 4N92A 4UAAA 3PBNA 2XGNA 1ERMA 3LGOA 1UWNX 4B9OA 2O99A 3UO9A 3G4PA 3BFGA 2GJ3A 3G30A 2GX5A 2OLVA 4MN5A 4HBTA 3T4SA 4KQQA 1PWGA 4OP8A 5E43A 3Q07A 5CEBA 3MXRA 2JKGA 2QJ7A 4C6YA 1PRQA 1G28A 3NULA 1TS8A 1HLUP 4WMCD 4ARZB 4Y0OA 4K0WA 4YWZA 1DP9A 1W63M 3UPOA 2CC1A 2EFXA 2B18A 2O9BA 3T50A 3M2JA 3G2YA 3CLOA 2H0TA 1GA0A 4KG6A 3R7WB 4UA6A 4HI4A 4PKYA 3SS3A 1PFLA 3FZCA 1VQQA 2WKIA 3ZHHA 4KUOA 3UB6A 5J3WA 3A3IA 1DP6A 3VE4A 4ETZA 2WAFA 2ZC7A 1XKZA 2XFTA 4H6JB 4RX2A 1MKMA 2O9AA 1ZG4A 3QP2A 4OPRA 5FQJA 2L4RA 3LR3A 4E04A 3PBTA 3O3VA 3LYXA 2OAQ1 1N9OA 2RL3A 4EUVA 1K57A 1WYCA 4QPRA 1D06A 2Y2JA 1UGUA 1LHYA 1FSYA 2V8CA 5MC7A 1YM1A 1YLTA 3KSFA 4IBXA 1NZUA 3A0VA 3HUNA 1GHMA 3IH8A 3HLBA 5EVIA 1FILA 1N9LA 4Y0UA 5F6AA 5CHUA 1RGZA 4FH4A 1P0ZA 5HWTA 1F2KA 2JKRI 3E4OA 3MQ0A 4XT2B 5TGFA 3OZHA 3BEBA 2VA0A 4GN2A 1MWRA 4Y7PA 4OVDA 3V3RA 1KDSA 4N1HA 2V0UA 3IXDA 2L1MA 1W8YA 2WGVA 3EWKA 2YKHA 4ETXA 4I3JA 3MKFA 4DE1A 1EROA 1SCWA 4S2NA 4RQ9A 3IS2A 3FKWA 1Y28A 2WGIA 3MS6A 4I39A 4WMCA 4LENA 4FTXA 1S4SA 4LRZE 3CPTB 3V3SA 3IHAA 3W8KA 5EOOA 3PBRA 3RFBA 4IVKA 4CPKA 5FA7A 3A0RA 3SS5A 3IX8A 1LI9A 1JWVA 2J9OA 2W3GA 4F94A 1IYQA 4DE2A 1L0DA 2XSSA 2Z2MB 3C4OA 2R9WA 2I9VA 4GS9B 3TE8A 2ZQ7A 3E2LA 2G2WA 5IHVA 2Z2LB 4I5SA 3UPPA 3MF0A 4O01A 3ISGA 4EXOA 3PR6A 5FQIA 2K7SA 1I5QA 3F1PB 4U3TA 3NHQA 1A0KA 1TDLA 4BBUA 2W3EA 4GHIB 3UB9A 5EUAA 4G3WA 4R3JA 3S7OA 2W3DA 4LV1A 1IYOA 5HWWA 2W1TA 1IOUA 3CUEA 1NRJA 4ME4A 5L8MA 3T12B 3D72A 1XA7A 5FASA 1K54C 3GQZA 1HD8A 4N9KA 4WYYA 3W4OA 1KGEA 5DF8A 3KSHA 3LR4A 3IWOA 2J9PA 3BQ8A 2BLSA 1E25A 2WZZA 3UDXA 5TBMA 1L0FA 3OLOA 1LL8A 3ZNYA 2JHEA 1PZPA 2M7UA 4JGRA 1OPXA 4MEZA 3NIAA 3DAVA 1NYYA 3KX0X 2P74A 2AVXA 4QWOA 5AVFA 3V50A 2XRNA 5HWVA 3BLMA 2E8JA 4PAUA 2FZ0A 2ZBBA 3BY8A 1TDGA 2GDNA 1XJ4A 3FYZA 3NOUC 1LL5A 2VEAA 4P0MA 3E98A 3I7JA 1H3QA 3NBLA 3LIAA 4Y15A 4UA7A 4OOMA 5IU1A 3CI6A 2PR5A 3CG5A 2IWBA 4JGOA 1CEGA 4P85A 5CEDA 1ESIA 1PZOA 4K08A 5HD5A 2A24A 4F3LB 5FAQA 4JF6A 3WRTA 1PW8A 1N4OA 4P87A 3BW6A 1TVFA 3QNBA 4X1MA 4X1LA 3AGEA 4BD0A 3CHWP 1E3UD 2Y2PA 4S2KA 5EM0A 3SZTA 4N1XA 1NY0A 1SKOA 3GRJA 3MR0A 3EQVA 2ZQCA 5F5YA 2DRWA 2P04A 3QP4A 5FI7A 1MKIA 5GHZA 4QHCA 2FFFB 1NZOA 2NUPC 2ZMAA 4DF6A 3UE1A 4L9GA 5DFXA 3QNCA 3FWLA 4X6TA 1OTBA 4E3IA 4XUXA 1K55C 3T1SA 2HDUA 3UY6A 3O87A 5AVEA 5CECA 5DVAA 1GHPA 1BULA 4B4XA 4ZJ2A 3B33A 3OCLA 4KG5A 2JKTM 4OONA 1PW1A 3ZNTA 2Y2GA 3HJIA 4O0PA 2EX8A 1W8QA 3GTCA 3SS4A 2Y4AA 5K5BA 3WS0A 5CTMA 1Z6FA 4LRYC 3SW1A 1K57C 5AQAA 1FCMA 4BL2A 4IUKA 3ULFA 3UDIA 5F1GA 3NI9A 2BASA 4DXBA 1BLCA 3IWQA 3R7WA 3F1NB 2LB5A 5FEFA 2XLNA 4OPYA 3PAEA 5EVIC 2WYXA 3IF6A 5FDHA 3IT9A 5C5KA 2EX9A 4P6ZM 2GZAA 2Y2LA 2QYBA 5CXWA 1QMFA 4KZ8A 3T4JA 4WZ4A 5A92A 1DRMA 2H10A 4LCLA 3DTIA 3NDGA 2B95A 5EOEA 1XJ6A 2XQZA 4DE3A 5KSHA 4XUZA 1K38A 1VB6A 2V2FF 1XPBA 3IHBA 4WEKA 2HGVA 4EV4A 4EUZA 5F69A 3M2KA 1YLZA 4WUJA 4S2NC 1MXOA 1NYMA 3HLGA 1IELA 3QP5A 4Q0JA 4WBGA 3UDFA 3A0SA 3NC8A 4R3BA 3PBSA 3LFVA 2OWJA 1K54A 1G68A 3N7WA 2B5RA 5AQ9A 5D3OA 4MMNA 2HDSA 5FATA 1Y54A 2ACGA 5FQMA 3FC7A 4MCWA 3SH7A 1XXMA 3BLSA 4EERA 1S67L 3VMAA 5FI6A 2EX6A 1ZC2A 4XT2A 5HPIA 1H5XA 1YAXA 3BQAA 3RXXA 4GDBA 3S7QA 1OTDA 4L9EA 5FEGA 2QHKA 3FPVA 2WGWB 3F1OB 1MY8A 4I3AA 4DJ3A 4X25A 4EESA 4U0TA 5IT5A 1XJ2A 2Y79A 4OOYA 2V1BA 1S66L 2J80A 1YQSA 3TSGA 1T1CA 1MWSA 5J8XA 3C4PA 2PRFA 4GDNA 3DWKA 2JKTI 3LIBA 4O8GA 3KYQA 1CEFA 3CUEC 1K25A 1ONGA 3NY4A 4S2IA 3H7WA 4GS9A 5CX7A 4OOLA 5FI2A 3EOIA 5FL3A 3M6BA 4HQAA 4BJPA 1OTAA 1YLWA 3NCKA 3LEZA 1O07A 5GLBA 1QMEA 5EPHA 4NK3A 1FCOA 2JCHA 1LSWA 4B88A 3KSIA 3E4PA 4G3VA 5E2GA 2FFYA 3EEHA 3FPWA 4HY8A 4ESPA 2V8FA 4GHIA 5HL1A 1W5DA 3G31A 3LIEA 5A8BA 1S0WA 2INWA 4WLAA 3D4FA 2VV6A 4NG2A 1ES2A 3BFFA 1YMSA 4IBRA 2H28A 3HUMA 1K55A 3KYEA 1FCNA 4S2JA 4CJNA 2V1AA 1L2SA 2VKSA 2ZC3B 1LI0A 4IHQA 4HEFA 1MWTA 4D60A 2V20A 4Z1WA 3AGFA 2XROA 2A3UA 2Y2KA 1J9MA 3KYZA 2ZQ8A 1IKIA 3EGXC 4L0LA 1L0EA 2EWVA 2ZM2A 2XA7M 3Q82A 1FIKA 5GLDA 3BFDA 3BFCA 5DTSA 3HREA 3DWZA 2VGKA 2ZOIA 1G5UA 1TS7A 2Q9MA 4DRTA 3RTYA 4BLMA 5BOHA 3VOLA 3DBAA 2CMNA 2HDQA 1KE3A 4KZ9A 1JTGA 2V1ZA 3HVFA 2O9CA 1IYSA 1IFQA 5DF9A 3DTKA 4LV2A 3IXBA 4E6WA 4S2MA 3D3OA 1YSPA 2P7JA 3C8CA 4UQIM 4BBVA 4EBLA 2VK3A 3N8RA 4R6LA 3QP1A 2Y2HA 3T4TA 1EW0A 2XFSA 4B4ZA 4CQHA 4PM5A 1M6KA 4HESA 2EFUA 2Y55A 3ITAA 3VFFA 2FH5A 4DJ2A 2ZQDA 2ZC6B 2GNXA 5CGSA 2QKPA 5EECA 3WWXA 1PWCA 3ZFZA 2VV7A 3FV7A 4OQGA 4LGWA 3AGDA
chains in the Genus database with same CATH topology
1S1YA 3T4KA 2QWSA 1BYWA 3F1PA 3KX0X 3C38A 3LUQA 5AVFA 2HJ9C 5TJJA 2XRNA 5HWVA 1XJ3A 3OBFA 1VHMA 4KUKA 4PAUA 2FZ0A 2J3TD 2ZBBA 3BY8A 3PBQA 4WF0A 5I5LA 5DKLA 3H82B 3MXQA 3CITA 3EEAA 3UB8A 1XJ4A 3NOUC 1XFNA 2VEAA 4NXEA 3VE3A 3E98A 1TD5A 2W1RA 4NXBA 1H3QA 2IA2A 3LIAA 2PYPA 4OOMA 5IU1A 3MFXA 3CI6A 2PR5A 2K2NA 4JGOA 3KO6A 4HJ6A 4HNBA 1P9WA 3OCNA 3EQUA 5KIZA 2ZOHA 4K08A 5HD5A 3GDIA 4GLQA 3S7NA 2WKQA 2EA9A 2A24A 3NOTC 3TW8A 4F3LB 3C2WA 1STZA 2HF6A 4EW7A 4Y3IA 2J3TC 3U2AA 3UE6A 3BW6A 5DFYA 1YSQA 4IJGA 3T4LA 4CLCD 5G4ZA 4GCZA 5LBRA 4PKYG 5DJUA 1H8MA 2VX8A 1MZUA 3PYPA 1V9ZA 1UWPX 5J7EA 5J4EA 1D7EA 2G7UA 3TRCA 3MR0A 3IBRA 3EQVA 5F5YA 2R78A 2K31A 2P04A 3E0YA 4P6ZS 2L0WA 5G4YA 3KSGA 2NUPC 4MN7A 2W27A 4DMZA 1ZTUA 3CAXA 4R3AA 4L9GA 5DFXA 1T18A 1W63Q 5HD3A 1OTBA 4I3IA 3T4OA 3BJNA 2W3FA 1F98A 4LRXC 3T4QA 1V9YA 2JKRM 5AVEA 4CLCC 3HJKA 2W3HA 2V9AA 5HZHA 2WKRA 5HPFA 4CLCB 3P7NA 1OTIA 4M4XA 3B33A 3OCLA 2JKTM 3JVUA 2NUTC 1F5MA 4LPZA 1S4RA 3FG8A 2PDRA 3HJIA 4O0PA 4WEJA 5K5BA 4EEPA 3LICA 3PBNA 5EFWA 4LRYC 1NWZA 3ICYA 1UWNX 3SW1A 4B9OA 2HJEA 2O99A 2Z6DA 4IUKA 3ULFA 4HOIA 3P01A 3BWLA 1LSXA 2BASA 2GJ3A 2GX5A 3R7WA 4JGQA 4DN0A 3B47A 4MN5A 3T4SA 1OT6A 3F1NB 2LB5A 4F3LA 3W2ZA 3IBJA 2QJ7A 3LI9A 5C5KA 1G28A 4P6ZM 2GZAA 2QYBA 1TS8A 5AJGA 4ARZB 4YWZA 4HJ4A 4HIAA 3T4JA 1DRMA 1DP9A 2V0WA 1W63M 3GECA 1NLYA 2KOIA 1XJ6A 5KSHA 2O0YA 2B18A 2O9BA 3NOPC 4GJ4A 3T50A 1VB6A 4BWIA 1LT0A 3PXPA 4EQ1A 3CLOA 4YOFA 1MC0A 4EU0A 4WEKA 2HGVA 3R7WB 5F69A 4HI4A 4PKYA 4WUJA 3H7WB 4KUOA 3K3CA 4R70A 1T1BA 4Q0JA 3IS2B 2ZMVA 3UB6A 5J3WA 3A0SA 2PD8A 1DP6A 2P08A 3PBSA 3LFVA 3VE4A 4ETZA 2OWJA 2Z6CA 3PHYA 4CLCA 4HH2A 4H6JB 5F68A 4MMNA 1MKMA 2O9AA 3LR5A 4I38A 2B02A 3FC7A 4EEUA 2L4RA 4MCWA 3LI8A 5HDSA 3LR3A 2WKPA 4EERA 4E04A 1S67L 3PBTA 5HDCA 1ODVA 3LR0A 3LYXA 4XT2A 1DP8A 2HV1A 3K2NA 2OAQ1 1N9OA 4CLCE 5HPIA 3LIFA 4EUVA 4AFIA 1P9RA 5IS1A 1YAXA 3BQAA 1ZHHB 4II7A 4QPRA 1D06A 4FSFA 1UGUA 3S7QA 1OTDA 4L9EA 2W0NA 3HCYA 2M7VA 2OAP1 2KLIA 5HSQA 5MC7A 3F1NA 3KSFA 1F9IA 2QHKA 3FPVA 3F1OB 2VZWA 1OJ5A 1YKDA 3A0VA 4I3AA 1N9LA 5F6AA 4DJ3A 2EWWA 4ARZA 3UE3A 4EESA 5IT5A 1P97A 1XJ2A 2Y79A 4IUHA 1P0ZA 4BMWA 2V1BA 5HWTA 2JKRI 3E4OA 1S66L 2J80A 3O5YA 4Q0HA 3K3DA 3MQ0A 2D01A 4XT2B 4BBTA 1T1CA 3MQQA 3B42A 2VA0A 4KQOA 2Y8HA 1OTEA 2JKTI 3LIBA 4O8GA 2V0UA 3KYQA 2L1MA 3CUEC 1G6OA 3CWFA 3EWKA 2YKHA 2VJWA 4ETXA 1OJGA 1NLZA 3UMEA 4I3JA 1GSWA 3C30A 2PYRA 3OC2A 3H7WA 4GS9A 3NJAA 4OOLA 5CX7A 3EOIA 3LIDA 5FL3A 4HQAA 2XA7S 3IS2A 1OTAA 3R4KA 4RQ9A 4BJPA 1Y28A 2QJ5A 2M1CA 3JVVA 4I39A 1LSWA 4H6JA 3KSIA 4WN5A 3ZYTA 3E4PA 4G3VA 1S4SA 1T1AA 4LRZE 1TS6A 3EEHA 3FPWA 3PBRA 4HY8A 3RFBA 1GSVA 4GHIA 3A0RA 4B93A 4Y5FA 2PD7A 2OOLA 2W3GA 1OT9A 3LIEA 4Q0IA 5A8BA 2A2LA 4MN6A 2PHYA 5HL6A 2KX6A 5TBMB 1X0OA 3ZQ5A 2INWA 4WLAA 2XSSA 4YNRA 2VV6A 2I9VA 3H9WA 4Y2FA 4GS9B 4UQIS 3TE8A 3TJZC 2H28A 2MJ6A 1S1ZA 4I5SA 4EETB 2OWHA 3MF0A 4O01A 2V1AA 3F1OA 4EXOA 3PR6A 2VGLS 2K7SA 2VKSA 3F1PB 4IHQA 3G6OA 3V67A 3NHQA 3BY9A 1T19A 3EGDC 4GW9A 4UEYA 4HP9A 4Z1WA 4BBUA 2W3EA 2XROA 2J3WA 4GHIB 3KYZA 3UB9A 3EGXC 4HJ3A 4L0LA 2EWVA 2D02A 4G3WA 4KQDA 3MQOA 5DKKA 2XA7M 3S7OA 4NEED 2W3DA 1JNUA 3RH8B 3E4QA 3PBOA 2PT7A 4ZRRA 5HWWA 3UMDA 5HDDA 2W1TA 2ZOIA 1IOUA 3S7PA 1TS7A 3CUEA 2VV8A 1KOUA 4WL9A 3RTYA 3MJQA 3OOVA 1GSXA 3VOLA 2YKFA 3DBAA 4LLOB 2A24B 1NRJA 1WA9A 1XFQA 2CMNA 2DMWA 4ME4A 5L8MA 2VLGA 4PHTA 1TS0A 2O9CA 1IFQA 5DF9A 4NXGA 3D72A 4HP4A 5DJTA 3D3OA 4G3KA 1YSPA 2P7JA 3C8CA 4UQIM 4BBVA 4NXFA 1N9NA 4JGPA 4R6LA 3H82A 4L9FA 4NKPA 3KSHA 4R38A 3LR4A 2KDKA 3MMHA 2JN7A 3VV4A 3T4TA 2LB9A 2VGLM 1EW0A 3BQ8A 4CQHA 2W1TB 3UB7A 5TBMA 4WELA 2FH5A 4DJ2A 3OLOA 1LL8A 1LSVA 2GNXA 2QKPA 2JHEA 4HH3A 2PR6A 4FOFA 2VV7A 2M7UA 4HHDA 1TF1A 4JGRA 4MDZA 1OPXA 2ZMFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HPF A;  3ZQ5 A;  2XSS A;  4YNR A;  4E04 A;  4Y2F A;  3K2N A;  1F5M A;  5TJJ A;  5HPI A;  2XRN A;  3OBF A;  4EUV A;  1VHM A;  4PAU A;  3MF0 A;  4O0P A;  4O01 A;  4QPR A;  5I5L A;  2VKS A;  5K5B A;  5HL6 A;  3S7Q A;  3G6O A;  3CIT A;  3EEA A;  4LRY C;  3NHQ A;  3HCY A;  3NOU C;  2M7V A;  2KLI A;  4GW9 A;  5HSQ A;  2O99 A;  3KSF A;  2VEA A;  3E98 A;  4Z1W A;  1TD5 A;  2W3E A;  4IUK A;  2XRO A;  2W1R A;  2IA2 A;  2VZW A;  1YKD A;  2GX5 A;  4DN0 A;  4G3W A;  3CI6 A;  2K2N A;  2LB5 A;  3KO6 A;  3S7O A;  2W3D A;  3W2Z A;  2Y79 A;  3IBJ A;  4IUH A;  4ZRR A;  5C5K A;  4Q0H A;  3O5Y A;  4GLQ A;  3S7N A;  3MQ0 A;  2QYB A;  2W1T A;  3NOT C;  5AJG A;  3C2W A;  3S7P A;  1STZ A;  4Y3I A;  2Y8H A;  3OOV A;  5DFY A;  3DBA A;  4O8G A;  1YSQ A;  4IJG A;  4ME4 A;  5LBR A;  2VJW A;  5L8M A;  4ETX A;  2KOI A;  2O9C A;  2O0Y A;  2B18 A;  2G7U A;  2O9B A;  3NOP C;  3TRC A;  4BWI A;  4YOF A;  4RQ9 A;  1MC0 A;  3R4K A;  4EU0 A;  2HGV A;  3D3O A;  3IBR A;  4G3K A;  1YSP A;  2K31 A;  3E0Y A;  4R6L A;  3KSH A;  3KSI A;  3MMH A;  3KSG A;  4R70 A;  4MN7 A;  4Q0J A;  4G3V A;  4DMZ A;  1ZTU A;  3VV4 A;  2LB9 A;  4LRZ E;  4CQH A;  5DFX A;  2W1T B;  3LFV A;  4ETZ A;  3RFB A;  3BJN A;  2W3F A;  4LRX C;  4MMN A;  4Y5F A;  1MKM A;  4FOF A;  2OOL A;  2O9A A;  2M7U A;  2W3G A;  1TF1 A;  4MDZ A;  4Q0I A;  4MCW A;  2W3H A;  2ZMF A; 
#chains in the Genus database with same CATH topology
 1H0M A;  3T4K A;  3ZG5 A;  4GKU A;  4U0X A;  4Y0T A;  2WZX A;  3OBF A;  4O7D A;  4E3K A;  3IQA A;  4WF0 A;  4MBH A;  5DKL A;  3H82 B;  1XP4 A;  1DJB A;  3EEA A;  3E2K A;  5CER A;  3VP0 A;  4NXE A;  4NXB A;  5HX9 A;  5HFO A;  2PYP A;  4GD6 A;  2XDM A;  5EM1 A;  3GR2 A;  5EE8 A;  5L07 A;  2ZC5 B;  1ALQ A;  4IED A;  4X68 A;  4HJ6 A;  3OCN A;  3GDI A;  3S7N A;  4DDY A;  2WKQ A;  4JBF A;  3DTM A;  3C2W A;  3IF6 C;  3O88 A;  2HF6 A;  4FD8 A;  4EW7 A;  3U2A A;  3DW0 A;  4E3J A;  1YSQ A;  3TOI A;  4CLC D;  1SKF A;  5AQB A;  4GCZ A;  4PKY G;  5DJU A;  4N9L A;  1H8M A;  1MZU A;  1UWP X;  2G7U A;  4QY5 A;  3MZD A;  4P6Z S;  3VFH A;  4MN7 A;  2W27 A;  3RJU A;  1ZTU A;  2JE5 A;  1T18 A;  3GV9 A;  5CRF A;  4ID4 A;  3Q7V B;  1F98 A;  4LRX C;  3FKV A;  4Q8I A;  5CGW A;  1KGG A;  3LY4 A;  2XD5 A;  2Y2I A;  3BYD A;  5HZH A;  2WKR A;  5CHJ A;  3P7N A;  2HP5 A;  4M4X A;  1K56 D;  3JVU A;  4YFM A;  4LFU A;  4KZB A;  4WEJ A;  3HUO A;  1Q2P A;  1ES4 A;  5EFW A;  1NWZ A;  3ICY A;  5F1F A;  4A5R A;  2HDR A;  5EVE A;  2X01 A;  2X02 A;  4HOI A;  5AQ7 A;  1CF0 A;  3GMW A;  4JGQ A;  4DN0 A;  3B47 A;  4JKT A;  1PI4 A;  1OT6 A;  1Y4O A;  3T1X A;  3QHY A;  4R4R A;  5U47 A;  3W2Z A;  1L0G A;  3IBJ A;  3ZVW A;  1FQG A;  1C3B A;  5EVI B;  4KZ3 A;  4RVA A;  5AJG A;  3LCE A;  4S2L A;  3HL9 A;  4HIA A;  1CI9 A;  5JYP A;  2A49 A;  4PM6 A;  2HP9 A;  3GEC A;  4KZ7 A;  4R1G A;  2KOI A;  3A3D A;  1JWZ A;  4GJ4 A;  4EQ1 A;  1LT0 A;  4QY6 A;  3MBZ A;  1MC0 A;  1MPL A;  1RCJ A;  1VET A;  1GCE A;  4ZAM A;  2J8Y A;  1H8Z A;  2ZMV A;  3IS2 B;  2PD8 A;  2P08 A;  4OQH A;  3SH8 A;  1EI5 A;  4Y17 A;  1MBL A;  4C3Q A;  2Y2M A;  4CLC A;  5HAQ A;  4HH2 A;  4PMA A;  4BQM A;  3MFD A;  3C5A A;  1S6R A;  2B02 A;  4EEU A;  4C75 A;  1BLP A;  3LI8 A;  5HDS A;  3HLC A;  2WKP A;  1FSW A;  5CTN A;  2DCF A;  4JLF A;  1ODV A;  3LR0 A;  3IX3 A;  2PU2 A;  2ZQ9 A;  1YMX A;  3K2N A;  2HV1 A;  3LIF A;  4OLD A;  1P9R A;  5GLA A;  4PM7 A;  4GD8 A;  5HAI A;  4EBN A;  2W0N A;  3HCY A;  2M7V A;  2OAP 1;  2KLI A;  3MZE A;  5HSQ A;  1FR1 A;  5FQ9 A;  1OJ5 A;  1SDE A;  2ZQA A;  2EWW A;  4ARZ A;  1K56 A;  1P97 A;  2P9V B;  3O86 A;  4IUH A;  5E2F A;  2ZJ9 A;  4Q0H A;  3O5Y A;  4BBT A;  1MWU A;  1BLH A;  3B42 A;  2XH9 A;  4DXC A;  2Y8H A;  4K91 A;  3D9Y A;  2Y2O A;  5DTT A;  1G6O A;  4UA9 A;  1DJA A;  1OJG A;  1M40 A;  1NLZ A;  2HZ5 A;  1GSW A;  3C30 A;  2PYR A;  3OC2 A;  4ZTK A;  3M6H A;  3NJA A;  1VM1 A;  2XA7 S;  5E2H A;  3MSH A;  5G18 A;  2Y2Q A;  3JVV A;  3S1Y A;  3CMZ A;  3BEC A;  3VSK A;  2C6W B;  4H6J A;  4KEN B;  4WM9 A;  4WN5 A;  3CJM A;  1T1A A;  1VEU B;  4K0X A;  3WS5 A;  4LV3 A;  1L3L A;  4Y5F A;  1K0K A;  1OT9 A;  3IH9 A;  4Q0I A;  2A2L A;  2PHY A;  5TBM B;  2KX6 A;  3VP3 A;  1X0O A;  1W79 A;  2EXA A;  1XA1 A;  4Y2F A;  4UQI S;  4GB7 A;  3UN7 A;  4BEN A;  1S1Z A;  4EET B;  2OWH A;  1ES5 A;  3P09 A;  5A90 A;  4KZ5 A;  3L7H A;  3G6O A;  4YIN A;  1PI5 A;  2WAE A;  3V67 A;  2EXB A;  2UWX A;  2RCX A;  1EWZ A;  1OME A;  1AWI A;  4HJ3 A;  1E4D A;  2D02 A;  5JYO A;  4KQD A;  3MQO A;  3MXS A;  1JNU A;  3RH8 B;  3PBO A;  1XX2 A;  2PT7 A;  4ZRR A;  3UMD A;  2G2U A;  5HDD A;  2E8I A;  2ZM0 A;  1ACF A;  3S7P A;  2EX2 A;  1KOU A;  3OOV A;  1GSX A;  1RP5 A;  2IWC A;  2YKF A;  3WS1 A;  2A24 B;  1JWP A;  1SHV A;  2DMW A;  2VLG A;  4PHT A;  4NXG A;  4KQR A;  5DJT A;  1WE4 A;  3G32 A;  3UPN A;  3CPT A;  4G3K A;  3N4I A;  4NXF A;  3MKE A;  1N9N A;  1K6S A;  3P98 A;  3H82 A;  4L9F A;  4MBF A;  3A3E A;  3OPP A;  2VGL M;  1KVM A;  4P6B A;  4WEL A;  1Q2Q A;  3HBR A;  1LSV A;  2ZLY A;  5TFQ A;  1HTZ A;  2PR6 A;  1O7E A;  1LLB A;  4MDZ A;  2ZMF A;  3G34 A;  3W4Q A;  1I2W A;  2JKF A;  3HLD A;  3N8L A;  4OLG A;  2OSU A;  1BYW A;  1HZO A;  3F1P A;  1SZV A;  4LV0 A;  4JF5 A;  4KUK A;  1IYP A;  2J3T D;  3PBQ A;  3ZVT A;  4D2O A;  2WAD A;  4R0Q A;  3MXQ A;  3G2Z A;  1XFN A;  4ZJ3 A;  3Q7Z A;  1BSG A;  3VE3 A;  2QPN A;  1FOF A;  2Q0O A;  1PIO A;  3G35 A;  3HLE A;  2IA2 A;  5F82 A;  3C7U A;  4PM8 A;  2C5W B;  5GLC A;  3IXH A;  3DTE A;  4HNB A;  4OH0 A;  3V39 A;  1P9W A;  3EQU A;  1ZG6 A;  4GLQ A;  2ZC4 B;  5CHM A;  3Q7V A;  4S2O A;  3IF6 B;  3UE6 A;  1DY6 A;  3NDE A;  5DFY A;  4IJG A;  3ZCZ A;  1W7F A;  3WRZ A;  5HAR A;  3PYP A;  4OKP A;  1V9Z A;  5J7E A;  2ZL1 B;  4QU3 A;  4M3K A;  3IBR A;  5L09 A;  1KDW A;  3E0Y A;  1U60 A;  5E2E A;  2L0W A;  1IKG A;  5G4Y A;  3KSG A;  4DMZ A;  3CAX A;  2DNS A;  1YLP A;  5HD3 A;  1PYY A;  4I3I A;  3T4O A;  4OPZ A;  3BJN A;  5DTK A;  1KE0 A;  2W3F A;  1H8Y A;  5GL9 A;  1V9Y A;  1Z09 A;  4UHU A;  4CLC C;  4KG2 A;  2W3H A;  2ZD8 A;  5HPF A;  3OPH A;  4E6X A;  2NUT C;  1F5M A;  3OPL A;  4LPZ A;  3CZD A;  3ZG0 A;  1YLJ A;  2IWD A;  5I94 A;  3LIC A;  2HJE A;  2Z6D A;  1CJF A;  4GNU A;  3VP4 A;  1JVJ A;  4FCF A;  1BTL A;  3P01 A;  3BWL A;  1LSX A;  3A3J A;  4H8R A;  4F3L A;  1HVB A;  3HLF A;  1WYB A;  5M19 A;  3LI9 A;  1G6A A;  2QZ6 A;  4JXW A;  3VOY A;  3RXW A;  1KGF A;  4HJ4 A;  1ZKJ A;  4MNR A;  3QP8 A;  1D1J A;  4WZ5 A;  2V0W A;  1NLY A;  3ITB A;  2O0Y A;  3NOP C;  5GHX A;  1CK3 A;  3PXP A;  4BWI A;  4YOF A;  4ZBE A;  4EU0 A;  4NET A;  2WUQ A;  3VP1 A;  1ESU A;  2R9X A;  3H7W B;  3UNW A;  3BRM A;  3K3C A;  4R70 A;  1T1B A;  3IF5 A;  5M1A A;  1CI8 A;  2Z6C A;  3PHY A;  5F68 A;  2Y59 A;  1XGJ A;  3LR5 A;  2BG1 A;  4I38 A;  4S2P A;  2P9V A;  2Y91 A;  2PAV P;  4X56 A;  4JPM A;  5HDC A;  4JXV A;  5KSC A;  3PTE A;  1DP8 A;  3ZDJ A;  5FDS A;  4CLC E;  5F83 A;  4AFI A;  5IS1 A;  1KVL A;  1ZHH B;  4II7 A;  3JYI A;  5EVL A;  4FSF A;  3PAG A;  4DE0 A;  3F1N A;  1F9I A;  3OPR A;  3B3X A;  4JF4 A;  5GHY A;  1K6R A;  2VZW A;  1YKD A;  5FQQ A;  3S4X A;  3UE3 A;  4EQI A;  4DKI A;  4MLL A;  4BMW A;  2HP6 A;  3NEC A;  4R4S A;  1VEU A;  3K3D A;  5TR7 A;  2D01 A;  3MQQ A;  3UB5 P;  4KQO A;  1OTE A;  1TEM A;  4QB8 A;  3CWF A;  2PBY A;  2VJW A;  5L10 A;  3UME A;  1KE4 A;  1ERQ A;  1DJC A;  3Q1F A;  3LID A;  3R4K A;  1YPR A;  4X55 A;  2QJ5 A;  3A3F A;  2M1C A;  3IX4 A;  1YT4 A;  3ZYT A;  1TS6 A;  3IXG A;  3IWI A;  5A91 A;  3ZG7 B;  1GSV A;  4GZB A;  2QMI A;  2J7V A;  4B93 A;  2PD7 A;  2OOL A;  2XK1 A;  2XF3 A;  4MN6 A;  5HL6 A;  1JTD A;  3ZQ5 A;  4YNR A;  1PWD A;  3LY3 A;  3Q81 A;  3H9W A;  4E3L A;  1ES3 A;  3TJZ C;  2XEP A;  3GSG A;  4DDS A;  2MJ6 A;  4OPQ A;  2WGW A;  3C7V A;  3F1O A;  2VGL S;  1BUE A;  2HPB A;  4OP5 A;  2X71 A;  4RX3 A;  3L9K A;  4LCM A;  3BY9 A;  1T19 A;  3EGD C;  2XR0 A;  4GW9 A;  4UEY A;  4HP9 A;  3SH9 A;  5M18 A;  5FQK A;  1IEM A;  2J3W A;  2BTF P;  5EV0 A;  4E3O A;  2JC7 A;  4MBK A;  5DKK A;  4JXS A;  2UV0 E;  4NEE D;  5FAP A;  2I72 A;  4ZJ1 A;  3E4Q A;  3VSL A;  3VP2 A;  1ONH A;  2WKE A;  1I2S A;  3TG9 A;  3VOZ A;  4JXG A;  1K4E A;  2PBD P;  3T1Q B;  2VV8 A;  4QD4 A;  4WL9 A;  3MJQ A;  5CGX A;  4LLO B;  5DF7 A;  4PM9 A;  3QP6 A;  1XFQ A;  1WA9 A;  3LEQ A;  4X69 A;  1TS0 A;  1BLS A;  4KZ4 A;  1J3W A;  4HP4 A;  1LL9 A;  4ZDX A;  4GOG A;  1AXB A;  3GVB A;  4FH2 A;  3SOI A;  2OLU A;  4JGP A;  3ZGA B;  4OQ0 A;  1RGY A;  4NKP A;  4R38 A;  1NXY A;  2KDK A;  3MMH A;  2JN7 A;  5L2F A;  3VV4 A;  1BZA A;  2LB9 A;  2W1T B;  3UB7 A;  3MZF A;  2VGJ A;  4HH3 A;  4FOF A;  5FSR A;  4HHD A;  1TF1 A;  2WKH A;  1CQA A;  4FUW A;  3ZG9 B;  1S1Y A;  2OV5 A;  4E3N A;  2Y2N A;  2JBF A;  2QWS A;  1PNE A;  3S22 A;  3C38 A;  4IVI A;  4KZA A;  3LUQ A;  4X53 A;  2HJ9 C;  5KZH A;  5TJJ A;  1XJ3 A;  3UE0 A;  1VHM A;  4QJG A;  1NRF A;  5I5L A;  4Z9Q A;  4Y13 A;  3CIT A;  3UB8 A;  4OQI A;  2H0Y A;  3WS4 A;  1NJ4 A;  1TD5 A;  3N8S A;  2W1R A;  2ZL1 A;  4HBU A;  3V5M A;  3MFX A;  5HW3 A;  1GHI A;  2K2N A;  3KO6 A;  3U4L P;  4EBP A;  1FR6 A;  5KIZ A;  3LO7 A;  2ZOH A;  3JPU A;  3BM6 A;  1K4F A;  3ZG8 B;  3HLW A;  3TW8 A;  2EA9 A;  3NOT C;  1STZ A;  4Y3I A;  2J3T C;  4KZ6 A;  5KMW A;  4RA7 A;  3T4L A;  5G4Z A;  5LBR A;  4EWF A;  2VX8 A;  4WZ5 C;  2ZM8 A;  5J4E A;  5HAP A;  1D7E A;  3TRC A;  1E3U A;  4BL3 A;  4E3M A;  4PPR A;  3WS2 A;  5A93 A;  2R78 A;  2K31 A;  1XGI A;  4BD1 A;  4R3A A;  1VET B;  1SDN A;  1N9B A;  1W63 Q;  2XD1 A;  3T1R A;  2H5S A;  3BFE A;  3T4Q A;  4R23 A;  2JKR M;  2Q9N A;  2WK0 A;  3HJK A;  2V9A A;  5FAO A;  2PU4 A;  5EVI D;  4CLC B;  1BT5 A;  1GA9 A;  4RYE A;  1OTI A;  4XXR A;  1SKO B;  1YLY A;  1S4R A;  3FG8 A;  2PDR A;  3N6I A;  3W4P A;  4EEP A;  4N92 A;  4UAA A;  3PBN A;  2XGN A;  1ERM A;  3LGO A;  1UWN X;  4B9O A;  2O99 A;  3UO9 A;  3G4P A;  3BFG A;  2GJ3 A;  3G30 A;  2GX5 A;  2OLV A;  4MN5 A;  4HBT A;  3T4S A;  4KQQ A;  1PWG A;  4OP8 A;  5E43 A;  3Q07 A;  5CEB A;  3MXR A;  2JKG A;  2QJ7 A;  4C6Y A;  1PRQ A;  1G28 A;  3NUL A;  1TS8 A;  1HLU P;  4WMC D;  4ARZ B;  4Y0O A;  4K0W A;  4YWZ A;  1DP9 A;  1W63 M;  3UPO A;  2CC1 A;  2EFX A;  2B18 A;  2O9B A;  3T50 A;  3M2J A;  3G2Y A;  3CLO A;  2H0T A;  1GA0 A;  4KG6 A;  3R7W B;  4UA6 A;  4HI4 A;  4PKY A;  3SS3 A;  1PFL A;  3FZC A;  1VQQ A;  2WKI A;  3ZHH A;  4KUO A;  3UB6 A;  5J3W A;  3A3I A;  1DP6 A;  3VE4 A;  4ETZ A;  2WAF A;  2ZC7 A;  1XKZ A;  2XFT A;  4H6J B;  4RX2 A;  1MKM A;  2O9A A;  1ZG4 A;  3QP2 A;  4OPR A;  5FQJ A;  2L4R A;  3LR3 A;  4E04 A;  3PBT A;  3O3V A;  3LYX A;  2OAQ 1;  1N9O A;  2RL3 A;  4EUV A;  1K57 A;  1WYC A;  4QPR A;  1D06 A;  2Y2J A;  1UGU A;  1LHY A;  1FSY A;  2V8C A;  5MC7 A;  1YM1 A;  1YLT A;  3KSF A;  4IBX A;  1NZU A;  3A0V A;  3HUN A;  1GHM A;  3IH8 A;  3HLB A;  5EVI A;  1FIL A;  1N9L A;  4Y0U A;  5F6A A;  5CHU A;  1RGZ A;  4FH4 A;  1P0Z A;  5HWT A;  1F2K A;  2JKR I;  3E4O A;  3MQ0 A;  4XT2 B;  5TGF A;  3OZH A;  3BEB A;  2VA0 A;  4GN2 A;  1MWR A;  4Y7P A;  4OVD A;  3V3R A;  1KDS A;  4N1H A;  2V0U A;  3IXD A;  2L1M A;  1W8Y A;  2WGV A;  3EWK A;  2YKH A;  4ETX A;  4I3J A;  3MKF A;  4DE1 A;  1ERO A;  1SCW A;  4S2N A;  4RQ9 A;  3IS2 A;  3FKW A;  1Y28 A;  2WGI A;  3MS6 A;  4I39 A;  4WMC A;  4LEN A;  4FTX A;  1S4S A;  4LRZ E;  3CPT B;  3V3S A;  3IHA A;  3W8K A;  5EOO A;  3PBR A;  3RFB A;  4IVK A;  4CPK A;  5FA7 A;  3A0R A;  3SS5 A;  3IX8 A;  1LI9 A;  1JWV A;  2J9O A;  2W3G A;  4F94 A;  1IYQ A;  4DE2 A;  1L0D A;  2XSS A;  2Z2M B;  3C4O A;  2R9W A;  2I9V A;  4GS9 B;  3TE8 A;  2ZQ7 A;  3E2L A;  2G2W A;  5IHV A;  2Z2L B;  4I5S A;  3UPP A;  3MF0 A;  4O01 A;  3ISG A;  4EXO A;  3PR6 A;  5FQI A;  2K7S A;  1I5Q A;  3F1P B;  4U3T A;  3NHQ A;  1A0K A;  1TDL A;  4BBU A;  2W3E A;  4GHI B;  3UB9 A;  5EUA A;  4G3W A;  4R3J A;  3S7O A;  2W3D A;  4LV1 A;  1IYO A;  5HWW A;  2W1T A;  1IOU A;  3CUE A;  1NRJ A;  4ME4 A;  5L8M A;  3T12 B;  3D72 A;  1XA7 A;  5FAS A;  1K54 C;  3GQZ A;  1HD8 A;  4N9K A;  4WYY A;  3W4O A;  1KGE A;  5DF8 A;  3KSH A;  3LR4 A;  3IWO A;  2J9P A;  3BQ8 A;  2BLS A;  1E25 A;  2WZZ A;  3UDX A;  5TBM A;  1L0F A;  3OLO A;  1LL8 A;  3ZNY A;  2JHE A;  1PZP A;  2M7U A;  4JGR A;  1OPX A;  4MEZ A;  3NIA A;  3DAV A;  1NYY A;  3KX0 X;  2P74 A;  2AVX A;  4QWO A;  5AVF A;  3V50 A;  2XRN A;  5HWV A;  3BLM A;  2E8J A;  4PAU A;  2FZ0 A;  2ZBB A;  3BY8 A;  1TDG A;  2GDN A;  1XJ4 A;  3FYZ A;  3NOU C;  1LL5 A;  2VEA A;  4P0M A;  3E98 A;  3I7J A;  1H3Q A;  3NBL A;  3LIA A;  4Y15 A;  4UA7 A;  4OOM A;  5IU1 A;  3CI6 A;  2PR5 A;  3CG5 A;  2IWB A;  4JGO A;  1CEG A;  4P85 A;  5CED A;  1ESI A;  1PZO A;  4K08 A;  5HD5 A;  2A24 A;  4F3L B;  5FAQ A;  4JF6 A;  3WRT A;  1PW8 A;  1N4O A;  4P87 A;  3BW6 A;  1TVF A;  3QNB A;  4X1M A;  4X1L A;  3AGE A;  4BD0 A;  3CHW P;  1E3U D;  2Y2P A;  4S2K A;  5EM0 A;  3SZT A;  4N1X A;  1NY0 A;  1SKO A;  3GRJ A;  3MR0 A;  3EQV A;  2ZQC A;  5F5Y A;  2DRW A;  2P04 A;  3QP4 A;  5FI7 A;  1MKI A;  5GHZ A;  4QHC A;  2FFF B;  1NZO A;  2NUP C;  2ZMA A;  4DF6 A;  3UE1 A;  4L9G A;  5DFX A;  3QNC A;  3FWL A;  4X6T A;  1OTB A;  4E3I A;  4XUX A;  1K55 C;  3T1S A;  2HDU A;  3UY6 A;  3O87 A;  5AVE A;  5CEC A;  5DVA A;  1GHP A;  1BUL A;  4B4X A;  4ZJ2 A;  3B33 A;  3OCL A;  4KG5 A;  2JKT M;  4OON A;  1PW1 A;  3ZNT A;  2Y2G A;  3HJI A;  4O0P A;  2EX8 A;  1W8Q A;  3GTC A;  3SS4 A;  2Y4A A;  5K5B A;  3WS0 A;  5CTM A;  1Z6F A;  4LRY C;  3SW1 A;  1K57 C;  5AQA A;  1FCM A;  4BL2 A;  4IUK A;  3ULF A;  3UDI A;  5F1G A;  3NI9 A;  2BAS A;  4DXB A;  1BLC A;  3IWQ A;  3R7W A;  3F1N B;  2LB5 A;  5FEF A;  2XLN A;  4OPY A;  3PAE A;  5EVI C;  2WYX A;  3IF6 A;  5FDH A;  3IT9 A;  5C5K A;  2EX9 A;  4P6Z M;  2GZA A;  2Y2L A;  2QYB A;  5CXW A;  1QMF A;  4KZ8 A;  3T4J A;  4WZ4 A;  5A92 A;  1DRM A;  2H10 A;  4LCL A;  3DTI A;  3NDG A;  2B95 A;  5EOE A;  1XJ6 A;  2XQZ A;  4DE3 A;  5KSH A;  4XUZ A;  1K38 A;  1VB6 A;  2V2F F;  1XPB A;  3IHB A;  4WEK A;  2HGV A;  4EV4 A;  4EUZ A;  5F69 A;  3M2K A;  1YLZ A;  4WUJ A;  4S2N C;  1MXO A;  1NYM A;  3HLG A;  1IEL A;  3QP5 A;  4Q0J A;  4WBG A;  3UDF A;  3A0S A;  3NC8 A;  4R3B A;  3PBS A;  3LFV A;  2OWJ A;  1K54 A;  1G68 A;  3N7W A;  2B5R A;  5AQ9 A;  5D3O A;  4MMN A;  2HDS A;  5FAT A;  1Y54 A;  2ACG A;  5FQM A;  3FC7 A;  4MCW A;  3SH7 A;  1XXM A;  3BLS A;  4EER A;  1S67 L;  3VMA A;  5FI6 A;  2EX6 A;  1ZC2 A;  4XT2 A;  5HPI A;  1H5X A;  1YAX A;  3BQA A;  3RXX A;  4GDB A;  3S7Q A;  1OTD A;  4L9E A;  5FEG A;  2QHK A;  3FPV A;  2WGW B;  3F1O B;  1MY8 A;  4I3A A;  4DJ3 A;  4X25 A;  4EES A;  4U0T A;  5IT5 A;  1XJ2 A;  2Y79 A;  4OOY A;  2V1B A;  1S66 L;  2J80 A;  1YQS A;  3TSG A;  1T1C A;  1MWS A;  5J8X A;  3C4P A;  2PRF A;  4GDN A;  3DWK A;  2JKT I;  3LIB A;  4O8G A;  3KYQ A;  1CEF A;  3CUE C;  1K25 A;  1ONG A;  3NY4 A;  4S2I A;  3H7W A;  4GS9 A;  5CX7 A;  4OOL A;  5FI2 A;  3EOI A;  5FL3 A;  3M6B A;  4HQA A;  4BJP A;  1OTA A;  1YLW A;  3NCK A;  3LEZ A;  1O07 A;  5GLB A;  1QME A;  5EPH A;  4NK3 A;  1FCO A;  2JCH A;  1LSW A;  4B88 A;  3KSI A;  3E4P A;  4G3V A;  5E2G A;  2FFY A;  3EEH A;  3FPW A;  4HY8 A;  4ESP A;  2V8F A;  4GHI A;  5HL1 A;  1W5D A;  3G31 A;  3LIE A;  5A8B A;  1S0W A;  2INW A;  4WLA A;  3D4F A;  2VV6 A;  4NG2 A;  1ES2 A;  3BFF A;  1YMS A;  4IBR A;  2H28 A;  3HUM A;  1K55 A;  3KYE A;  1FCN A;  4S2J A;  4CJN A;  2V1A A;  1L2S A;  2VKS A;  2ZC3 B;  1LI0 A;  4IHQ A;  4HEF A;  1MWT A;  4D60 A;  2V20 A;  4Z1W A;  3AGF A;  2XRO A;  2A3U A;  2Y2K A;  1J9M A;  3KYZ A;  2ZQ8 A;  1IKI A;  3EGX C;  4L0L A;  1L0E A;  2EWV A;  2ZM2 A;  2XA7 M;  3Q82 A;  1FIK A;  5GLD A;  3BFD A;  3BFC A;  5DTS A;  3HRE A;  3DWZ A;  2VGK A;  2ZOI A;  1G5U A;  1TS7 A;  2Q9M A;  4DRT A;  3RTY A;  4BLM A;  5BOH A;  3VOL A;  3DBA A;  2CMN A;  2HDQ A;  1KE3 A;  4KZ9 A;  1JTG A;  2V1Z A;  3HVF A;  2O9C A;  1IYS A;  1IFQ A;  5DF9 A;  3DTK A;  4LV2 A;  3IXB A;  4E6W A;  4S2M A;  3D3O A;  1YSP A;  2P7J A;  3C8C A;  4UQI M;  4BBV A;  4EBL A;  2VK3 A;  3N8R A;  4R6L A;  3QP1 A;  2Y2H A;  3T4T A;  1EW0 A;  2XFS A;  4B4Z A;  4CQH A;  4PM5 A;  1M6K A;  4HES A;  2EFU A;  2Y55 A;  3ITA A;  3VFF A;  2FH5 A;  4DJ2 A;  2ZQD A;  2ZC6 B;  2GNX A;  5CGS A;  2QKP A;  5EEC A;  3WWX A;  1PWC A;  3ZFZ A;  2VV7 A;  3FV7 A;  4OQG A;  4LGW A;  3AGD A; 
#chains in the Genus database with same CATH homology
 1S1Y A;  3T4K A;  2QWS A;  1BYW A;  3F1P A;  3KX0 X;  3C38 A;  3LUQ A;  5AVF A;  2HJ9 C;  5TJJ A;  2XRN A;  5HWV A;  1XJ3 A;  3OBF A;  1VHM A;  4KUK A;  4PAU A;  2FZ0 A;  2J3T D;  2ZBB A;  3BY8 A;  3PBQ A;  4WF0 A;  5I5L A;  5DKL A;  3H82 B;  3MXQ A;  3CIT A;  3EEA A;  3UB8 A;  1XJ4 A;  3NOU C;  1XFN A;  2VEA A;  4NXE A;  3VE3 A;  3E98 A;  1TD5 A;  2W1R A;  4NXB A;  1H3Q A;  2IA2 A;  3LIA A;  2PYP A;  4OOM A;  5IU1 A;  3MFX A;  3CI6 A;  2PR5 A;  2K2N A;  4JGO A;  3KO6 A;  4HJ6 A;  4HNB A;  1P9W A;  3OCN A;  3EQU A;  5KIZ A;  2ZOH A;  4K08 A;  5HD5 A;  3GDI A;  4GLQ A;  3S7N A;  2WKQ A;  2EA9 A;  2A24 A;  3NOT C;  3TW8 A;  4F3L B;  3C2W A;  1STZ A;  2HF6 A;  4EW7 A;  4Y3I A;  2J3T C;  3U2A A;  3UE6 A;  3BW6 A;  5DFY A;  1YSQ A;  4IJG A;  3T4L A;  4CLC D;  5G4Z A;  4GCZ A;  5LBR A;  4PKY G;  5DJU A;  1H8M A;  2VX8 A;  1MZU A;  3PYP A;  1V9Z A;  1UWP X;  5J7E A;  5J4E A;  1D7E A;  2G7U A;  3TRC A;  3MR0 A;  3IBR A;  3EQV A;  5F5Y A;  2R78 A;  2K31 A;  2P04 A;  3E0Y A;  4P6Z S;  2L0W A;  5G4Y A;  3KSG A;  2NUP C;  4MN7 A;  2W27 A;  4DMZ A;  1ZTU A;  3CAX A;  4R3A A;  4L9G A;  5DFX A;  1T18 A;  1W63 Q;  5HD3 A;  1OTB A;  4I3I A;  3T4O A;  3BJN A;  2W3F A;  1F98 A;  4LRX C;  3T4Q A;  1V9Y A;  2JKR M;  5AVE A;  4CLC C;  3HJK A;  2W3H A;  2V9A A;  5HZH A;  2WKR A;  5HPF A;  4CLC B;  3P7N A;  1OTI A;  4M4X A;  3B33 A;  3OCL A;  2JKT M;  3JVU A;  2NUT C;  1F5M A;  4LPZ A;  1S4R A;  3FG8 A;  2PDR A;  3HJI A;  4O0P A;  4WEJ A;  5K5B A;  4EEP A;  3LIC A;  3PBN A;  5EFW A;  4LRY C;  1NWZ A;  3ICY A;  1UWN X;  3SW1 A;  4B9O A;  2HJE A;  2O99 A;  2Z6D A;  4IUK A;  3ULF A;  4HOI A;  3P01 A;  3BWL A;  1LSX A;  2BAS A;  2GJ3 A;  2GX5 A;  3R7W A;  4JGQ A;  4DN0 A;  3B47 A;  4MN5 A;  3T4S A;  1OT6 A;  3F1N B;  2LB5 A;  4F3L A;  3W2Z A;  3IBJ A;  2QJ7 A;  3LI9 A;  5C5K A;  1G28 A;  4P6Z M;  2GZA A;  2QYB A;  1TS8 A;  5AJG A;  4ARZ B;  4YWZ A;  4HJ4 A;  4HIA A;  3T4J A;  1DRM A;  1DP9 A;  2V0W A;  1W63 M;  3GEC A;  1NLY A;  2KOI A;  1XJ6 A;  5KSH A;  2O0Y A;  2B18 A;  2O9B A;  3NOP C;  4GJ4 A;  3T50 A;  1VB6 A;  4BWI A;  1LT0 A;  3PXP A;  4EQ1 A;  3CLO A;  4YOF A;  1MC0 A;  4EU0 A;  4WEK A;  2HGV A;  3R7W B;  5F69 A;  4HI4 A;  4PKY A;  4WUJ A;  3H7W B;  4KUO A;  3K3C A;  4R70 A;  1T1B A;  4Q0J A;  3IS2 B;  2ZMV A;  3UB6 A;  5J3W A;  3A0S A;  2PD8 A;  1DP6 A;  2P08 A;  3PBS A;  3LFV A;  3VE4 A;  4ETZ A;  2OWJ A;  2Z6C A;  3PHY A;  4CLC A;  4HH2 A;  4H6J B;  5F68 A;  4MMN A;  1MKM A;  2O9A A;  3LR5 A;  4I38 A;  2B02 A;  3FC7 A;  4EEU A;  2L4R A;  4MCW A;  3LI8 A;  5HDS A;  3LR3 A;  2WKP A;  4EER A;  4E04 A;  1S67 L;  3PBT A;  5HDC A;  1ODV A;  3LR0 A;  3LYX A;  4XT2 A;  1DP8 A;  2HV1 A;  3K2N A;  2OAQ 1;  1N9O A;  4CLC E;  5HPI A;  3LIF A;  4EUV A;  4AFI A;  1P9R A;  5IS1 A;  1YAX A;  3BQA A;  1ZHH B;  4II7 A;  4QPR A;  1D06 A;  4FSF A;  1UGU A;  3S7Q A;  1OTD A;  4L9E A;  2W0N A;  3HCY A;  2M7V A;  2OAP 1;  2KLI A;  5HSQ A;  5MC7 A;  3F1N A;  3KSF A;  1F9I A;  2QHK A;  3FPV A;  3F1O B;  2VZW A;  1OJ5 A;  1YKD A;  3A0V A;  4I3A A;  1N9L A;  5F6A A;  4DJ3 A;  2EWW A;  4ARZ A;  3UE3 A;  4EES A;  5IT5 A;  1P97 A;  1XJ2 A;  2Y79 A;  4IUH A;  1P0Z A;  4BMW A;  2V1B A;  5HWT A;  2JKR I;  3E4O A;  1S66 L;  2J80 A;  3O5Y A;  4Q0H A;  3K3D A;  3MQ0 A;  2D01 A;  4XT2 B;  4BBT A;  1T1C A;  3MQQ A;  3B42 A;  2VA0 A;  4KQO A;  2Y8H A;  1OTE A;  2JKT I;  3LIB A;  4O8G A;  2V0U A;  3KYQ A;  2L1M A;  3CUE C;  1G6O A;  3CWF A;  3EWK A;  2YKH A;  2VJW A;  4ETX A;  1OJG A;  1NLZ A;  3UME A;  4I3J A;  1GSW A;  3C30 A;  2PYR A;  3OC2 A;  3H7W A;  4GS9 A;  3NJA A;  4OOL A;  5CX7 A;  3EOI A;  3LID A;  5FL3 A;  4HQA A;  2XA7 S;  3IS2 A;  1OTA A;  3R4K A;  4RQ9 A;  4BJP A;  1Y28 A;  2QJ5 A;  2M1C A;  3JVV A;  4I39 A;  1LSW A;  4H6J A;  3KSI A;  4WN5 A;  3ZYT A;  3E4P A;  4G3V A;  1S4S A;  1T1A A;  4LRZ E;  1TS6 A;  3EEH A;  3FPW A;  3PBR A;  4HY8 A;  3RFB A;  1GSV A;  4GHI A;  3A0R A;  4B93 A;  4Y5F A;  2PD7 A;  2OOL A;  2W3G A;  1OT9 A;  3LIE A;  4Q0I A;  5A8B A;  2A2L A;  4MN6 A;  2PHY A;  5HL6 A;  2KX6 A;  5TBM B;  1X0O A;  3ZQ5 A;  2INW A;  4WLA A;  2XSS A;  4YNR A;  2VV6 A;  2I9V A;  3H9W A;  4Y2F A;  4GS9 B;  4UQI S;  3TE8 A;  3TJZ C;  2H28 A;  2MJ6 A;  1S1Z A;  4I5S A;  4EET B;  2OWH A;  3MF0 A;  4O01 A;  2V1A A;  3F1O A;  4EXO A;  3PR6 A;  2VGL S;  2K7S A;  2VKS A;  3F1P B;  4IHQ A;  3G6O A;  3V67 A;  3NHQ A;  3BY9 A;  1T19 A;  3EGD C;  4GW9 A;  4UEY A;  4HP9 A;  4Z1W A;  4BBU A;  2W3E A;  2XRO A;  2J3W A;  4GHI B;  3KYZ A;  3UB9 A;  3EGX C;  4HJ3 A;  4L0L A;  2EWV A;  2D02 A;  4G3W A;  4KQD A;  3MQO A;  5DKK A;  2XA7 M;  3S7O A;  4NEE D;  2W3D A;  1JNU A;  3RH8 B;  3E4Q A;  3PBO A;  2PT7 A;  4ZRR A;  5HWW A;  3UMD A;  5HDD A;  2W1T A;  2ZOI A;  1IOU A;  3S7P A;  1TS7 A;  3CUE A;  2VV8 A;  1KOU A;  4WL9 A;  3RTY A;  3MJQ A;  3OOV A;  1GSX A;  3VOL A;  2YKF A;  3DBA A;  4LLO B;  2A24 B;  1NRJ A;  1WA9 A;  1XFQ A;  2CMN A;  2DMW A;  4ME4 A;  5L8M A;  2VLG A;  4PHT A;  1TS0 A;  2O9C A;  1IFQ A;  5DF9 A;  4NXG A;  3D72 A;  4HP4 A;  5DJT A;  3D3O A;  4G3K A;  1YSP A;  2P7J A;  3C8C A;  4UQI M;  4BBV A;  4NXF A;  1N9N A;  4JGP A;  4R6L A;  3H82 A;  4L9F A;  4NKP A;  3KSH A;  4R38 A;  3LR4 A;  2KDK A;  3MMH A;  2JN7 A;  3VV4 A;  3T4T A;  2LB9 A;  2VGL M;  1EW0 A;  3BQ8 A;  4CQH A;  2W1T B;  3UB7 A;  5TBM A;  4WEL A;  2FH5 A;  4DJ2 A;  3OLO A;  1LL8 A;  1LSV A;  2GNX A;  2QKP A;  2JHE A;  4HH3 A;  2PR6 A;  4FOF A;  2VV7 A;  2M7U A;  4HHD A;  1TF1 A;  4JGR A;  4MDZ A;  1OPX A;  2ZMF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...