5HWVA

Crystal structure of pas1 complexed with toluene
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
124
structure length
124
Chain Sequence
ALYEFVGLLDAHGNVLEVNQVALEGGGITMEEIRGKPFWKARWWQISKKTEATQKRLVETASSGEFVRCDVEILGKSGGREVIAVDFSLLPICNEEGSIVYLLAEGRNITDKKKAEAMLALKNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Sensor histidine kinase TodS
publication title Molecular Insights into Toluene Sensing in the TodS/TodT Signal Transduction System.
pubmed doi rcsb
source organism Pseudomonas putida (strain f1 / atcc 700007)
total genus 36
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2016-01-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5hwvA00
2I9VA 4GW9A 4EEPA 2WKRA 4WF0A 4GS9B 3C2WA 3NHQA 4HIAA 2D02A 2OOLA 1F9IA 5HD5A 3HJIA 3EEHA 3UB6A 2PD8A 1XJ4A 4MN6A 3LICA 5DKKA 1XJ3A 1DP9A 3BY8A 3LUQA 4B9OA 4DJ2A 3LIAA 4NXBA 5HWWA 5DKLA 3VE4A 3LI9A 1GSWA 5G4YA 4WLAA 2OWJA 5HDCA 2PD7A 3MXQA 2W27A 1OJGA 2V0UA 2KDKA 3H7WA 5A8BA 3K3DA 1BYWA 5DJTA 1GSVA 1OTAA 4PKYA 3H9WA 3ICYA 4LRYC 2JN7A 2EA9A 4EESA 5TBMA 1TS0A 3RTYA 2L4RA 2V1BA 2J80A 2OWHA 3E4PA 2YKHA 2VEAA 2GJ3A 4HJ3A 4I3JA 1OT9A 3SW1A 2QJ7A 3HJKA 3C8CA 1XJ6A 3LIFA 2QKPA 1Y28A 4JGPA 4L9GA 1P97A 1S4RA 1D7EA 4HJ4A 1DP6A 5HDSA 3LIEA 1LSWA 5HDDA 3NOPC 3RH8B 5F5YA 1JNUA 3K3CA 4F3LB 1WA9A 4I3IA 4GCZA 5HSQA 3H82B 2PYPA 1XFQA 1NWZA 5HWVA 4KUKA 5I5LA 4HOIA 4WUJA 3MJQA 1S66L 3LYXA 3F1NA 4EETB 2P7JA 2M1CA 4L9EA 2A24B 1OTEA 4HQAA 3UB9A 2VV6A 2Z6CA 4R70A 2INWA 2JHEA 3D72A 5KIZA 3UE6A 4NXEA 1N9OA 4LPZA 3P7NA 3OLOA 1XJ2A 3BY9A 3IBRA 4WL9A 2VV7A 3LI8A 3A0VA 1OTBA 1S4SA 3UB8A 1ODVA 4JGOA 2PR6A 4NXGA 3E4QA 3H82A 2PR5A 5EFWA 4HH3A 2VV8A 1S67L 1T1BA 3B33A 5IS1A 2QWSA 1EW0A 4H6JB 4GS9A 3UMEA 3F1OB 3G6OA 4BBUA 4HP9A 4PKYG 2Z6DA 4L9FA 2ZOIA 3EWKA 3NJAA 4HHDA 4EW7A 3T50A 4YWZA 1N9LA 4I38A 4JGRA 3MQOA 4KQDA 1UGUA 1VB6A 1KOUA 2ZBBA 1T19A 1OTDA 3LIDA 3A0RA 3CLOA 3LIBA 1UWNX 2B02A 2V0WA 2QJ5A 5J7EA 1V9YA 2QHKA 5J4EA 2KX6A 1V9ZA 4I3AA 4EXOA 5AVFA 3MR0A 4DJ3A 5IU1A 2L1MA 3F1OA 1OT6A 4LRZE 1T18A 3ULFA 4HP4A 4LRXC 5F69A 4EQ1A 3FG8A 2WKQA 5F68A 5J3WA 4R38A 3GDIA 3CAXA 1S1ZA 3H7WB 5HZHA 1OJ5A 3PHYA 2VLGA 2CMNA 2K7SA 1X0OA 2L0WA 2ZOHA 5TBMB 3CWFA 2D01A 3F1PB 4HNBA 3IS2B 1UWPX 4EEUA 4XT2B 4I5SA 3GECA 4GHIB 3A0SA 2H28A 4R6LA 4WN5A 5G4ZA 5F6AA 4HY8A 2PYRA 1DP8A 4I39A 4F3LA 5DJUA 2WKPA 5AVEA 4HI4A 3E4OA 3BWLA 3VOLA 3MQQA 4MN5A 3ZQ5A 4LLOB 5HWTA 1N9NA 1G28A 4JGQA 4EERA 1OTIA 2PDRA 4BBTA 2A24A 1MZUA 3MFXA 4M4XA 1TS7A 1TS6A 3F1PA 2BASA 3IS2A 4XT2A 4GHIA 2PHYA 1D06A 1S1YA 1DRMA 4NXFA 3KX0X 4HJ6A 3F1NB 1LSVA 1F98A 3NOTC 2R78A 4E04A 2YKFA 1T1CA 5HD3A 2HV1A 3PYPA 4HH2A 3FC7A 2V1AA 3UMDA 4K08A 3VE3A 1LSXA 4H6JA 4RQ9A 4KUOA 2W0NA 1LT0A 1GSXA 1P0ZA 3UB7A 4BBVA 4R3AA 1T1AA 2V9AA 3NOUC 1TS8A 1LL8A 1XFNA
chains in the Genus database with same CATH superfamily
2ACGA 2HP5A 5FQQA 4EBNA 3MBZA 3ZG7B 4GS9B 2OOLA 5U47A 3AGDA 2ZL1B 5FQ9A 4GOGA 2J9PA 1NYMA 4H8RA 1XJ4A 1PYYA 4MN6A 3WS4A 4BWIA 2P9VA 3UE3A 3VV4A 3HREA 2C6WB 1XJ3A 1A0KA 4KZ3A 5AQBA 4UA7A 3VE4A 3PAEA 1GSWA 1BT5A 3HBRA 2LB9A 5HDCA 3SH9A 3UDXA 1K6SA 2H5SA 4NETA 4AFIA 3H7WA 1BYWA 1GSVA 3N8SA 4PKYA 5AQ9A 2EA9A 5TBMA 3A3EA 3HUNA 2L4RA 4OQ0A 4BD1A 4O7DA 3LR5A 2GJ3A 4HJ3A 3A3DA 1OT9A 2PRFA 4OQHA 3LIFA 2NUTC 4JGPA 4L9GA 5CEBA 2WUQA 1P97A 1U60A 4G3WA 1D7EA 4HJ4A 3BEBA 4QU3A 3ZG8B 2DNSA 3NOPC 2HDUA 3MKEA 3UY6A 2Y2OA 1YLPA 5HAPA 3K3CA 1YPRA 1FQGA 1DJCA 5DF9A 4Y7PA 2Z2LB 1WA9A 2IWDA 4I3IA 4GCZA 4HESA 4Z9QA 1KDSA 3H82B 1XFQA 4CLCB 2ZLYA 1CI9A 2EXAA 1ES4A 4KUKA 4HOIA 1W7FA 4WELA 3G2ZA 2XD1A 5J8XA 4G3VA 1EWZA 3Q1FA 1S66L 3LYXA 3F1NA 1L0GA 1KE0A 3C38A 1H8ZA 3BQ8A 1TEMA 2A24B 1FR6A 1CEGA 4HQAA 2VV6A 2Z6CA 4R70A 5EE8A 3GTCA 1S6RA 1H8MA 1EROA 5E2FA 1K4FA 1N9OA 1ZHHB 2WKHA 1CF0A 4WZ5C 1IFQA 3WRTA 1E25A 1XJ2A 3LI8A 4HBUA 1OTBA 2A2LA 5CEDA 3UB8A 1FCMA 2OSUA 3IH8A 2PR6A 2PAVP 2ZMVA 5EVIA 1S67L 1PIOA 4LV0A 4KG2A 4QY6A 2QWSA 4PM6A 1O7EA 2JE5A 1IYQA 4OP5A 3KSGA 4NG2A 4S2OA 4P6BA 3UMEA 3F1OB 4N92A 5CERA 4E3IA 3V3SA 5FSRA 4PAUA 3UDFA 3EWKA 3NC8A 4Y13A 2DMWA 2J3WA 4EW7A 2XA7S 4YWZA 3L7HA 2E8IA 2OLVA 1GCEA 1TDGA 2GX5A 4Y0UA 4CQHA 3PBRA 1TVFA 3N4IA 5FEFA 3ZG5A 1KE4A 1KOUA 1MKIA 4R4RA 4JXVA 1JVJA 4N9LA 4DF6A 5EM0A 3IQAA 3FZCA 3A0RA 3MKFA 3IWOA 1UWNX 2V0WA 3MZEA 2VZWA 2QJ5A 3V5MA 3OCLA 4EWFA 2P9VB 1V9ZA 3SOIA 1BUEA 4JXWA 3KSFA 1BLSA 2L1MA 1NYYA 4XXRA 2IA2A 1T18A 2HP6A 4WMCD 3Q81A 4KZBA 3QHYA 4LRXC 5F69A 4EQIA 3VSLA 1YLWA 4EQ1A 1K25A 3IXGA 3LO7A 1QMEA 3OPLA 3ITAA 1K57A 1S1ZA 3H7WB 3CJMA 3IF6C 3B3XA 1K0KA 2VLGA 1FSWA 2K7SA 3ITBA 5TBMB 3CWFA 5CHMA 1YM1A 4YINA 3QNBA 4HNBA 4JPMA 1BULA 1SDNA 4GHIB 2PT7A 3KYEA 3A0SA 4IBXA 4LV3A 5G4ZA 4HY8A 2E8JA 3E0YA 4UQIM 4KQRA 4X6TA 4WEKA 2FFYA 4BJPA 3HUOA 2QPNA 5KMWA 4Y17A 5L07A 1YAXA 3Q7VA 2K31A 3I7JA 3M6BA 2WGVA 1W63Q 3KSIA 3E2LA 5CXWA 3NY4A 3W4OA 4EERA 3UE0A 4Y2FA 2PDRA 4OOMA 2Q0OA 1JWPA 3VMAA 4Z1WA 5GHZA 2BASA 1W8YA 1NRFA 3LCEA 4ME4A 1D1JA 1MBLA 1S1YA 1DRMA 4NXFA 3F1NB 1LSVA 2JKRI 1MWTA 5M1AA 4OQIA 4OH0A 4MBHA 2YKFA 1QMFA 4DDYA 5HD3A 1I5QA 4HH2A 1PW8A 1PZOA 3D3OA 3FC7A 3VOZA 2XRNA 4FTXA 4GN2A 1ESIA 2PBDP 2ZD8A 4QD4A 4OPQA 3MXRA 4X56A 4IVKA 1Q2PA 3SS3A 1LT0A 1PNEA 1CJFA 2O9CA 3CHWP 2LB5A 4X1LA 3EQVA 3IF5A 4EUVA 4R3AA 1T1AA 4ZJ3A 2XFSA 1YLTA 2XDMA 1KGFA 1YKDA 3B42A 2CC1A 4GW9A 2WKRA 2V2FF 3S22A 4S2LA 1BTLA 4G3KA 4X55A 4KZ6A 1ONGA 4LCLA 3GQZA 3C5AA 1NLZA 1PWCA 1TDLA 2G2WA 4Q0IA 3LY4A 5L09A 3S7PA 5DTKA 4II7A 3LUQA 4DJ2A 3LIAA 4NXBA 1BSGA 4BQMA 4IUKA 5CGSA 2J8YA 5CHJA 3LR0A 4OPRA 4GDNA 3TOIA 1YLYA 2JKGA 4B4ZA 3MXQA 1N4OA 2V0UA 2Y59A 3GMWA 1C3BA 3G32A 4X68A 5DJTA 3MSHA 3HL9A 4EESA 4S2NA 4JKTA 5CX7A 3GSGA 3IHBA 3BFFA 4Y3IA 1JWVA 3N8LA 2YKHA 1F2KA 2XQZA 2GDNA 1H5XA 2VEAA 4KG6A 4I3JA 4KZ7A 2ZC3B 1ACFA 1LLBA 2M7UA 1XJ6A 2XH9A 3OBFA 5AQAA 1VEUB 3VP2A 4RX3A 1S4RA 1K56D 1DP6A 3EOIA 1XGJA 3LIEA 3MQ0A 3NI9A 3RH8B 1IYSA 3BQAA 3E2KA 1PRQA 2W3DA 5F5YA 3IX3A 1NRJA 3OPRA 4B93A 5JYPA 1VETB 4GDBA 2PU2A 3SH7A 2J3TD 5MC7A 2PYPA 3C7UA 3Q7VB 3S7QA 1ZC2A 4FSFA 3V50A 2VGKA 5L8MA 1PWGA 2Y2MA 4WUJA 3VFHA 3MJQA 3OPPA 5IHVA 2P7JA 2W1RA 1KDWA 3IF6A 5EVEA 1O07A 2Y2LA 1BLCA 5HPIA 3BFDA 5EV0A 5D3OA 2VGLM 1K54A 1MWUA 2BTFP 4LPZA 3P7NA 3BFGA 1K55C 3OC2A 3VP4A 2NUPC 2FZ0A 4CLCD 3LFVA 4DE3A 4GNUA 3D9YA 3NULA 4M3KA 3A0VA 1E4DA 4BMWA 1MKMA 4YNRA 5KZHA 3L9KA 1ODVA 1L3LA 3LEZA 4IUHA 4MLLA 2P74A 4S2IA 1ES2A 2O99A 3IHAA 2GNXA 4KQQA 2WGWA 4O01A 3B33A 3UB5P 2HGVA 4MNRA 2OAQ1 3GV9A 1EW0A 1VM1A 1RGZA 3FKVA 4ID4A 3TE8A 4Q8IA 3OOVA 3G6OA 2ZQAA 5EVLA 2WADA 3NBLA 5AQ7A 3LR4A 2KLIA 2EFXA 4JGRA 4Y15A 3T4OA 4ZBEA 5CRFA 3MQOA 1SKOA 1UGUA 2ZM8A 2V1ZA 3G34A 5E2HA 3MXSA 2HJEA 2ZM0A 1T19A 3ZVWA 5F82A 5KSCA 1ZG6A 2V8FA 3LIBA 1SZVA 4OKPA 2W3GA 5DF8A 1MC0A 4JLFA 3RFBA 3QNCA 3WS5A 5J7EA 1NZUA 1V9YA 3PBNA 2KX6A 2A49A 4I3AA 4EXOA 3T1RA 2Y2PA 5AVFA 1HVBA 4DJ3A 3UPNA 4OONA 1F5MA 1M6KA 4LV1A 1OT6A 1G5UA 1KVMA 5K5BA 3FKWA 1FIKA 1YT4A 4P6ZS 4FUWA 1L0DA 3PXPA 4OPZA 2WKQA 4HEFA 5F68A 1LL5A 5J3WA 2J3TC 3CAXA 1HD8A 3LGOA 3Q7ZA 4U0XA 3HLCA 4WMCA 4RVAA 4WBGA 2P08A 3TSGA 1HLUP 3IS2B 2B95A 2EXBA 1UWPX 5DF7A 3GECA 4NKPA 2VJWA 4UA9A 5TFQA 5GLAA 2PYRA 4ETXA 1DP8A 4F3LA 1XXMA 1ZG4A 3MFDA 4EU0A 5FQIA 5TJJA 1L0FA 4C75A 4RYEA 4HI4A 2X02A 2EWVA 2PU4A 3BRMA 2R9XA 1FCOA 4B88A 2ZQDA 3ZQ5A 4CLCC 4FH2A 3MZFA 2Y79A 1NZOA 3Q82A 3PBTA 3HLEA 3ZNYA 4S2MA 4UEYA 3IXDA 4E3LA 4BBTA 3MFXA 3R7WB 2P04A 4M4XA 4R1GA 1TS6A 3U2AA 2Y2IA 3F1PA 4ZAMA 3VFFA 4QB8A 1JTDA 2Q9NA 3CMZA 4ZJ2A 3ZVTA 4XT2A 3TG9A 4ZTKA 2PHYA 5TGFA 2DCFA 4R23A 3CZDA 3WS1A 4BL2A 4KQOA 4ESPA 4DN0A 3FPVA 3NCKA 5CECA 4ZRRA 5EOEA 1NXYA 1P9RA 1FILA 4C6YA 2V1AA 5CGXA 2ZQ8A 4E6WA 5L10A 4UAAA 5HAQA 2FH5A 4RQ9A 3O87A 5AJGA 3P98A 4DXBA 1GSXA 3BFCA 5C5KA 2QZ6A 5BOHA 1M40A 3UB7A 3C7VA 2HPBA 4KZ5A 4RX2A 5EM1A 3BYDA 2V9AA 3NOUC 1TS8A 1LL8A 1MPLA 2WGWB 3DWZA 3KYZA 2XK1A 4OLGA 2EX8A 1KGEA 3IXBA 5JYOA 1I2SA 1DY6A 4WF0A 1GA9A 5HL6A 2RCXA 2D02A 1H0MA 3SS4A 5HD5A 4DE2A 5HAIA 3G2YA 4X53A 3EEHA 3G35A 4PM7A 1ERQA 2PD8A 1FOFA 4GZBA 1K4EA 1MXOA 2Y2QA 1K55A 2WYXA 3CI6A 5E2EA 5IT5A 3ZFZA 1SKOB 4JBFA 1BZAA 1TF1A 1DP9A 3GRJA 4UHUA 3UE1A 2VGJA 2XGNA 2Y2KA 4B9OA 1XPBA 1XP4A 4LFUA 5DKLA 3LI9A 4XUXA 2PD7A 4K0XA 2W27A 5F83A 2KDKA 5A8BA 3K3DA 4LRYC 1Q2QA 2OV5A 3E98A 1XA1A 2Y2NA 3ZDJA 3RTYA 3WS0A 3MF0A 4E6XA 2WZXA 2V1BA 2OWHA 4GD8A 4F94A 2V20A 3E4PA 2X01A 2RL3A 2EX2A 2G2UA 4FH4A 2ZQ7A 3SW1A 3EGXC 4OVDA 2Y4AA 2QKPA 2ZJ9A 1Y28A 2R9WA 3W2ZA 4GD6A 2QMIA 5HW3A 3N6IA 4DRTA 3V3RA 1FSYA 1LSWA 5HDDA 1L0EA 1W63M 2JC7A 4MEZA 4OPYA 3NIAA 3RXWA 4BD0A 2HDSA 1IKIA 2M7VA 3FYZA 4F3LB 1ZKJA 5GLDA 3C30A 3NDGA 3ZYTA 4MDZA 1PI5A 4WEJA 3B47A 4QWOA 4XUZA 5HX9A 5CHUA 1JTGA 1NWZA 5EVIB 4FCFA 1RCJA 3DW0A 2B5RA 2ZC6B 2IWCA 1PFLA 2H0YA 2EWWA 3JYIA 4K91A 3GR2A 1WYBA 3MZDA 2W3HA 3DTMA 3FV7A 1OTEA 3QP4A 1YMXA 3N8RA 3WWXA 2INWA 4WZ5A 2JHEA 1IKGA 2J7VA 4NXEA 3HCYA 4BENA 3GVBA 3IBRA 4WL9A 2VV7A 4ZJ1A 2HDQA 5A91A 1K6RA 4OP8A 3BM6A 4MBKA 1HTZA 3IXHA 3DTIA 4NXGA 3H82A 2WZZA 2PR5A 3A3IA 3KO6A 5EFWA 4HH3A 3C4OA 4MMNA 2VV8A 1T1BA 5EUAA 3T4LA 5IS1A 4S2KA 4ARZA 1ES3A 3UNWA 4PHTA 4MCWA 2WKEA 4OOYA 4IBRA 4BBUA 3HLDA 1PI4A 5FASA 3NECA 3IT9A 4E3NA 3MMHA 4DE0A 2Z6DA 2WKIA 2ZOIA 4L9FA 4E3OA 5EOOA 2BLSA 2Y55A 4X1MA 3T1SA 4MN7A 1W79A 4I38A 4YFMA 3G4PA 3VP1A 3QP6A 2EX9A 4S2JA 1VB6A 2XFTA 4Q0JA 3G31A 2PBYA 4FOFA 4Y5FA 1LHYA 1OTDA 3LIDA 4CLCE 2VK3A 4KZ4A 4YOFA 4PMAA 1YMSA 2ZQ9A 1SHVA 1PZPA 1TD5A 3JPUA 1K38A 3C4PA 1BLPA 1SCWA 3IH9A 4IHQA 3MR0A 4IJGA 4UQIS 3F1OA 3T4SA 4D60A 2OLUA 2XA7M 1LI9A 3R4KA 4OLDA 3ULFA 2ZC4B 4HP4A 4DXCA 3PBOA 2UV0E 2W1TA 3ZCZA 4ETZA 4N1XA 4R38A 5DFXA 5HZHA 1XKZA 3PHYA 2ZMAA 5FEGA 1CQAA 1K57C 1X0OA 2WK0A 4KZ8A 3PBQA 3S4XA 3PAGA 5FI7A 3SH8A 4E3KA 2JCHA 4I5SA 5CGWA 3DWKA 4R6LA 5FDHA 2A3UA 5F6AA 1E3UD 1WE4A 1FR1A 1Z6FA 4D2OA 4IVIA 5DJUA 4FD8A 2WKPA 1I2WA 4R3BA 5AVEA 2XD5A 3E4OA 3VOLA 3MQQA 3S1YA 4DMZA 3T4TA 2Y2GA 2H10A 4LENA 2O9BA 3IWQA 5FAPA 3SS5A 3CUEC 4JGQA 1OTIA 4WYYA 3N7WA 2ZC7A 1MZUA 1ES5A 5DTTA 5DTSA 3TJZC 5EPHA 2XF3A 3PBSA 3P09A 1TS7A 4U0TA 1NY0A 1OPXA 3VOYA 4GHIA 1ZTUA 5KSHA 4EBLA 4HJ6A 3SZTA 1F98A 2ZC5B 4P87A 4OOLA 1LL9A 1HZOA 4KZAA 2JKTI 3IX4A 1STZA 2Z2MB 4UA6A 3IWIA 4K08A 3VE3A 1W5DA 2WAEA 5E2GA 4H6JA 4R0QA 5FATA 5A93A 1G6OA 3BFEA 1YSPA 3DAVA 4KUOA 2JKRM 2W0NA 2HF6A 3UDIA 2O0YA 3ZNTA 3HLBA 3CPTA 1RP5A 4GLQA 2VA0A 3T4JA 3LR3A 4PM8A 5F1FA 1BLHA 4QPRA 3EQUA 1YLZA 4ARZB 2I9VA 4EEPA 4Y0OA 1XX2A 3P01A 5E43A 5DVAA 3C2WA 3NHQA 4HIAA 1CK3A 3BW6A 1F9IA 2Y91A 3A3JA 3HJIA 2XSSA 2HDRA 3UB6A 2G7UA 4CJNA 4U3TA 1JWZA 3TW8A 1PW1A 1DJBA 1GHPA 1XA7A 3LICA 5DKKA 3RJUA 4P0MA 3BY8A 1IELA 1VHMA 5HWWA 1AWIA 4EV4A 5G4YA 4WLAA 2OWJA 5FI2A 4CPKA 5GHXA 1OJGA 3DTKA 5FDSA 3RXXA 1WYCA 2Y2JA 3BJNA 3M6HA 1OTAA 3H9WA 3ICYA 1IEMA 5FQMA 3ZGAB 2JN7A 1TS0A 4K0WA 3V67A 4S2NC 3HLGA 2J80A 3WS2A 1ALQA 5A92A 3CG5A 4OQGA 5FQKA 2W1TB 4C3QA 3IF6B 1ONHA 2HP9A 3JVVA 3CITA 4KG5A 3M2JA 2QJ7A 3HJKA 1W8QA 4EUZA 3C8CA 4A5RA 5I94A 3EGDC 1P9WA 3VP3A 1NLYA 3T12B 2XEPA 4JF6A 5HDSA 5F1GA 4RA7A 1KVLA 4HBTA 3W4QA 5HFOA 4N9KA 2VGLS 3ZHHA 2W3FA 1JNUA 3FPWA 1H3QA 1J9MA 4L0LA 2I72A 3T4QA 5HSQA 2EFUA 3UPPA 1IYOA 4QHCA 4BL3A 5HWVA 5I5LA 4KZ9A 5FL3A 2VX8A 4E3MA 3ZG9B 3BLMA 2ZM2A 2B18A 2FFFB 4MBFA 4EETB 2M1CA 4L9EA 2WGIA 2XLNA 1N9BA 3IBJA 2W3EA 2C5WB 5L2FA 3UB9A 1VEUA 3AGFA 1S0WA 5HARA 5FAOA 3JVUA 3D72A 3HLFA 3S7NA 5KIZA 3IX8A 3UE6A 1NJ4A 2ZQCA 5GLCA 1K54C 2BG1A 4X25A 3OLOA 3BY9A 5EVID 3PR6A 4LCMA 5FAQA 3K2NA 1PWDA 1S4SA 4X69A 4JGOA 4DE1A 1VETA 3E4QA 1MY8A 2HJ9C 3QP5A 2J9OA 3O5YA 3PTEA 1KE3A 3CUEA 1SKFA 4H6JB 4GS9A 1CI8A 3OCNA 1OMEA 2ZL1A 4HP9A 4IEDA 3VSKA 1L2SA 4E3JA 3BECA 4PKYG 4QJGA 3CPTB 1Z09A 3EEAA 2JBFA 5A90A 4DDSA 2HZ5A 3NJAA 3Q07A 5FA7A 4HHDA 5LBRA 3T50A 1N9LA 1ESUA 4KQDA 1EI5A 3QP8A 4ZDXA 2Y2HA 3O86A 2ZBBA 2IWBA 3O88A 1GHIA 2JKFA 4GKUA 4JXSA 3CLOA 2WAFA 2GZAA 3W4PA 5GLBA 3AGEA 2B02A 4WZ4A 4LGWA 1K56A 2MJ6A 2Y8HA 2QHKA 5J4EA 1Y4OA 1SDEA 5IU1A 3UPOA 5GL9A 3M2KA 4R3JA 5TR7A 4LRZE 3HVFA 1RGYA 3FG8A 2JKTM 2QYBA 3VP0A 3KSHA 3GDIA 3HUMA 4B4XA 1OJ5A 4KENB 5FQJA 2CMNA 3LY3A 2L0WA 3QP2A 4R4SA 2ZOHA 1ERMA 1MWRA 2EX6A 3OPHA 1DJAA 3D4FA 2D01A 3F1PB 5CTNA 1LI0A 4EEUA 3OZHA 4BLMA 4XT2B 3UN7A 2H28A 2Q9MA 4WN5A 1IYPA 1G6AA 2XR0A 4I39A 4JF5A 4N1HA 1FCNA 3U4LP 3V39A 3W8KA 4S2PA 3WRZA 4WM9A 1XGIA 4CLCA 4P6ZM 5FI6A 3S7OA 3BWLA 3DTEA 4PPRA 3T1XA 1E3UA 3FWLA 4MN5A 3LEQA 4LLOB 5HWTA 1N9NA 5EVIC 5G18A 1G28A 1G68A 1YLJA 3QP1A 3HLWA 4LV2A 5GHYA 4NK3A 5HPFA 4PM5A 5HL1A 4EBPA 4DKIA 2V8CA 2OAP1 1YQSA 4JXGA 3T4KA 1IOUA 3TRCA 2A24A 3KYQA 3G30A 1VQQA 2UWXA 2ZMFA 2VKSA 4P85A 5M18A 1AXBA 1Y54A 3UO9A 5M19A 2KOIA 3IS2A 4NEED 1KGGA 3NDEA 5EECA 3DBAA 1GA0A 3ISGA 1GHMA 1D06A 3KX0X 3O3VA 3NOTC 2R78A 2DRWA 4Q0HA 4E04A 4O0PA 2XROA 3MS6A 2O9AA 1T1CA 3BLSA 2HV1A 3PYPA 3A3FA 3T1QB 3ZG0A 3UMDA 2X71A 1MWSA 5CTMA 4O8GA 1LSXA 4Y0TA 1CEFA 1YSQA 4GJ4A 1P0ZA 2H0TA 4BBVA 2K2NA 2AVXA 3R7WA 5DFYA 1H8YA 4GB7A 1J3WA 4QY5A 1XFNA 4JF4A 4PM9A
chains in the Genus database with same CATH topology
4ARZB 3B42A 2I9VA 4GW9A 4EEPA 2WKRA 3P01A 4WF0A 4GS9B 5HL6A 3C2WA 3NHQA 4G3KA 4HIAA 2D02A 2OOLA 3BW6A 1F9IA 5HD5A 3HJIA 2XSSA 1NLZA 3EEHA 3UB6A 2G7UA 4Q0IA 3TW8A 2PD8A 1XJ4A 3S7PA 4MN6A 4BWIA 3LICA 3CI6A 5DKKA 3UE3A 3VV4A 5IT5A 1XJ3A 1TF1A 1DP9A 4II7A 3BY8A 3LUQA 1VHMA 4B9OA 4DJ2A 3LIAA 4NXBA 5HWWA 5DKLA 3VE4A 4IUKA 3LI9A 1GSWA 5G4YA 4WLAA 2OWJA 3LR0A 2LB9A 5HDCA 2PD7A 3MXQA 2W27A 1OJGA 2V0UA 4AFIA 2KDKA 3H7WA 5A8BA 3K3DA 3BJNA 1BYWA 5DJTA 1GSVA 1OTAA 4PKYA 3H9WA 3ICYA 4LRYC 2JN7A 2EA9A 4EESA 5TBMA 3E98A 1TS0A 5CX7A 3RTYA 3V67A 3MF0A 2L4RA 4Y3IA 2V1BA 2J80A 2OWHA 3E4PA 2YKHA 3LR5A 2VEAA 2GJ3A 4HJ3A 2W1TB 4I3JA 1OT9A 3SW1A 3JVVA 3CITA 2QJ7A 3HJKA 3EGXC 2M7UA 3C8CA 1XJ6A 3LIFA 2QKPA 2NUTC 3EGDC 1Y28A 3OBFA 4JGPA 4L9GA 1P9WA 3W2ZA 1NLYA 1P97A 4G3WA 1S4RA 1D7EA 4HJ4A 1DP6A 3EOIA 5HDSA 3LIEA 3MQ0A 1LSWA 5HDDA 3NOPC 1W63M 3RH8B 3BQAA 2VGLS 2W3DA 2W3FA 5F5YA 1JNUA 3K3CA 2M7VA 1NRJA 3FPWA 1H3QA 4F3LB 5DF9A 3C30A 4B93A 4L0LA 3ZYTA 4MDZA 4WEJA 1WA9A 3B47A 3T4QA 4I3IA 4GCZA 5HSQA 2J3TD 3H82B 5MC7A 2PYPA 1XFQA 3S7QA 4CLCB 4FSFA 1NWZA 5HWVA 4KUKA 5I5LA 5FL3A 5L8MA 4HOIA 2VX8A 4WELA 4WUJA 4G3VA 3MJQA 2B18A 1S66L 3LYXA 3F1NA 2EWWA 2P7JA 2M1CA 4EETB 3C38A 4L9EA 2W1RA 3BQ8A 3IBJA 2W3HA 2W3EA 2A24B 1OTEA 5HPIA 4HQAA 3UB9A 2VV6A 2Z6CA 4R70A 2INWA 3JVUA 2JHEA 2VGLM 3D72A 3S7NA 5KIZA 1H8MA 3UE6A 4NXEA 3HCYA 1N9OA 1ZHHB 1IFQA 4LPZA 3P7NA 3OC2A 2NUPC 2FZ0A 3OLOA 1XJ2A 3BY9A 3IBRA 3LFVA 4WL9A 4CLCD 3PR6A 2VV7A 3LI8A 3A0VA 3K2NA 1OTBA 2A2LA 4BMWA 1MKMA 1S4SA 4YNRA 3UB8A 1ODVA 4JGOA 2PR6A 4IUHA 4NXGA 3E4QA 3H82A 2ZMVA 2PR5A 2HJ9C 5EFWA 3KO6A 4HH3A 2O99A 3O5YA 2GNXA 4MMNA 4O01A 2VV8A 1S67L 1T1BA 3B33A 3T4LA 5IS1A 2HGVA 3CUEA 4ARZA 2OAQ1 2QWSA 1EW0A 4PHTA 4MCWA 4H6JB 4GS9A 3KSGA 3TE8A 3OOVA 3OCNA 3F1OB 3UMEA 3G6OA 4BBUA 4HP9A 3MMHA 4PKYG 2Z6DA 4L9FA 2ZOIA 3EEAA 4PAUA 3EWKA 3LR4A 2KLIA 3NJAA 4MN7A 4HHDA 2DMWA 2J3WA 5LBRA 2XA7S 4EW7A 3T50A 4YWZA 1N9LA 4I38A 4JGRA 3T4OA 2GX5A 4CQHA 3MQOA 3PBRA 4KQDA 1UGUA 1VB6A 1KOUA 4Q0JA 4FOFA 4Y5FA 2ZBBA 2HJEA 1T19A 1OTDA 3LIDA 4CLCE 3A0RA 3CLOA 3LIBA 2W3GA 1UWNX 2GZAA 4YOFA 1MC0A 2B02A 2V0WA 3RFBA 2VZWA 2MJ6A 1TD5A 2QJ5A 5J7EA 2Y8HA 3OCLA 1V9YA 3PBNA 2QHKA 5J4EA 2KX6A 1V9ZA 4I3AA 4IHQA 4EXOA 5AVFA 3MR0A 3KSFA 4IJGA 4DJ3A 5IU1A 4UQIS 2L1MA 1F5MA 3F1OA 3T4SA 1OT6A 4LRZE 2IA2A 2XA7M 5K5BA 1T18A 3R4KA 3ULFA 4HP4A 4LRXC 4P6ZS 5F69A 3PBOA 2W1TA 3PXPA 4EQ1A 3FG8A 2JKTM 2WKQA 4ETZA 2QYBA 5F68A 3KSHA 4R38A 2J3TC 3GDIA 5J3WA 3CAXA 5DFXA 1S1ZA 3H7WB 5HZHA 1OJ5A 3PHYA 2VLGA 2CMNA 2K7SA 1X0OA 2L0WA 2ZOHA 5TBMB 3CWFA 3PBQA 2P08A 2D01A 3F1PB 4HNBA 3IS2B 1UWPX 4EEUA 4XT2B 4I5SA 3GECA 4GHIB 2PT7A 4NKPA 3A0SA 2VJWA 2H28A 4R6LA 4WN5A 5G4ZA 5F6AA 4HY8A 2PYRA 4ETXA 1DP8A 4I39A 4F3LA 3E0YA 4UQIM 5DJUA 2WKPA 4EU0A 5TJJA 4WEKA 4BJPA 5AVEA 4HI4A 1YAXA 2EWVA 4CLCA 4P6ZM 3E4OA 3S7OA 3BWLA 3VOLA 3MQQA 4MN5A 2K31A 3ZQ5A 4LLOB 4CLCC 5HWTA 4DMZA 1N9NA 3T4TA 1G28A 2O9BA 2Y79A 5HPFA 1W63Q 3CUEC 3KSIA 3PBTA 4JGQA 2OAP1 4EERA 4UEYA 1OTIA 4Y2FA 3T4KA 2PDRA 1IOUA 4OOMA 3TRCA 4BBTA 2A24A 1MZUA 3KYQA 3MFXA 3TJZC 3R7WB 2P04A 4Z1WA 2ZMFA 3PBSA 2VKSA 4M4XA 1TS7A 3U2AA 1TS6A 3F1PA 1OPXA 2BASA 2KOIA 3IS2A 4NEED 4ME4A 3DBAA 4XT2A 4GHIA 1ZTUA 5KSHA 2PHYA 1D06A 1S1YA 1DRMA 4NXFA 3KX0X 4HJ6A 3F1NB 1LSVA 4KQOA 1F98A 3NOTC 2R78A 4Q0HA 2JKRI 4E04A 4DN0A 4OOLA 3FPVA 2YKFA 4O0PA 4ZRRA 2XROA 2O9AA 1T1CA 5HD3A 1P9RA 2HV1A 3PYPA 4HH2A 3D3OA 3FC7A 2JKTI 2XRNA 2V1AA 1STZA 3UMDA 4K08A 3VE3A 4O8GA 1LSXA 4H6JA 2FH5A 4RQ9A 1G6OA 1YSPA 1YSQA 4KUOA 2JKRM 2W0NA 2HF6A 5AJGA 1LT0A 4GJ4A 1GSXA 1P0ZA 5C5KA 2O0YA 2O9CA 2LB5A 3UB7A 4BBVA 2K2NA 3EQVA 4EUVA 4R3AA 3R7WA 5DFYA 4GLQA 2VA0A 1T1AA 3T4JA 3LR3A 2V9AA 3NOUC 1TS8A 1LL8A 1XFNA 4QPRA 3EQUA 3KYZA 1YKDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I9V A;  4GW9 A;  4EEP A;  2WKR A;  4WF0 A;  4GS9 B;  3C2W A;  3NHQ A;  4HIA A;  2D02 A;  2OOL A;  1F9I A;  5HD5 A;  3HJI A;  3EEH A;  3UB6 A;  2PD8 A;  1XJ4 A;  4MN6 A;  3LIC A;  5DKK A;  1XJ3 A;  1DP9 A;  3BY8 A;  3LUQ A;  4B9O A;  4DJ2 A;  3LIA A;  4NXB A;  5HWW A;  5DKL A;  3VE4 A;  3LI9 A;  1GSW A;  5G4Y A;  4WLA A;  2OWJ A;  5HDC A;  2PD7 A;  3MXQ A;  2W27 A;  1OJG A;  2V0U A;  2KDK A;  3H7W A;  5A8B A;  3K3D A;  1BYW A;  5DJT A;  1GSV A;  1OTA A;  4PKY A;  3H9W A;  3ICY A;  4LRY C;  2JN7 A;  2EA9 A;  4EES A;  5TBM A;  1TS0 A;  3RTY A;  2L4R A;  2V1B A;  2J80 A;  2OWH A;  3E4P A;  2YKH A;  2VEA A;  2GJ3 A;  4HJ3 A;  4I3J A;  1OT9 A;  3SW1 A;  2QJ7 A;  3HJK A;  3C8C A;  1XJ6 A;  3LIF A;  2QKP A;  1Y28 A;  4JGP A;  4L9G A;  1P97 A;  1S4R A;  1D7E A;  4HJ4 A;  1DP6 A;  5HDS A;  3LIE A;  1LSW A;  5HDD A;  3NOP C;  3RH8 B;  5F5Y A;  1JNU A;  3K3C A;  4F3L B;  1WA9 A;  4I3I A;  4GCZ A;  5HSQ A;  3H82 B;  2PYP A;  1XFQ A;  1NWZ A;  5HWV A;  4KUK A;  5I5L A;  4HOI A;  4WUJ A;  3MJQ A;  1S66 L;  3LYX A;  3F1N A;  4EET B;  2P7J A;  2M1C A;  4L9E A;  2A24 B;  1OTE A;  4HQA A;  3UB9 A;  2VV6 A;  2Z6C A;  4R70 A;  2INW A;  2JHE A;  3D72 A;  5KIZ A;  3UE6 A;  4NXE A;  1N9O A;  4LPZ A;  3P7N A;  3OLO A;  1XJ2 A;  3BY9 A;  3IBR A;  4WL9 A;  2VV7 A;  3LI8 A;  3A0V A;  1OTB A;  1S4S A;  3UB8 A;  1ODV A;  4JGO A;  2PR6 A;  4NXG A;  3E4Q A;  3H82 A;  2PR5 A;  5EFW A;  4HH3 A;  2VV8 A;  1S67 L;  1T1B A;  3B33 A;  5IS1 A;  2QWS A;  1EW0 A;  4H6J B;  4GS9 A;  3UME A;  3F1O B;  3G6O A;  4BBU A;  4HP9 A;  4PKY G;  2Z6D A;  4L9F A;  2ZOI A;  3EWK A;  3NJA A;  4HHD A;  4EW7 A;  3T50 A;  4YWZ A;  1N9L A;  4I38 A;  4JGR A;  3MQO A;  4KQD A;  1UGU A;  1VB6 A;  1KOU A;  2ZBB A;  1T19 A;  1OTD A;  3LID A;  3A0R A;  3CLO A;  3LIB A;  1UWN X;  2B02 A;  2V0W A;  2QJ5 A;  5J7E A;  1V9Y A;  2QHK A;  5J4E A;  2KX6 A;  1V9Z A;  4I3A A;  4EXO A;  5AVF A;  3MR0 A;  4DJ3 A;  5IU1 A;  2L1M A;  3F1O A;  1OT6 A;  4LRZ E;  1T18 A;  3ULF A;  4HP4 A;  4LRX C;  5F69 A;  4EQ1 A;  3FG8 A;  2WKQ A;  5F68 A;  5J3W A;  4R38 A;  3GDI A;  3CAX A;  1S1Z A;  3H7W B;  5HZH A;  1OJ5 A;  3PHY A;  2VLG A;  2CMN A;  2K7S A;  1X0O A;  2L0W A;  2ZOH A;  5TBM B;  3CWF A;  2D01 A;  3F1P B;  4HNB A;  3IS2 B;  1UWP X;  4EEU A;  4XT2 B;  4I5S A;  3GEC A;  4GHI B;  3A0S A;  2H28 A;  4R6L A;  4WN5 A;  5G4Z A;  5F6A A;  4HY8 A;  2PYR A;  1DP8 A;  4I39 A;  4F3L A;  5DJU A;  2WKP A;  5AVE A;  4HI4 A;  3E4O A;  3BWL A;  3VOL A;  3MQQ A;  4MN5 A;  3ZQ5 A;  4LLO B;  5HWT A;  1N9N A;  1G28 A;  4JGQ A;  4EER A;  1OTI A;  2PDR A;  4BBT A;  2A24 A;  1MZU A;  3MFX A;  4M4X A;  1TS7 A;  1TS6 A;  3F1P A;  2BAS A;  3IS2 A;  4XT2 A;  4GHI A;  2PHY A;  1D06 A;  1S1Y A;  1DRM A;  4NXF A;  3KX0 X;  4HJ6 A;  3F1N B;  1LSV A;  1F98 A;  3NOT C;  2R78 A;  4E04 A;  2YKF A;  1T1C A;  5HD3 A;  2HV1 A;  3PYP A;  4HH2 A;  3FC7 A;  2V1A A;  3UMD A;  4K08 A;  3VE3 A;  1LSX A;  4H6J A;  4RQ9 A;  4KUO A;  2W0N A;  1LT0 A;  1GSX A;  1P0Z A;  3UB7 A;  4BBV A;  4R3A A;  1T1A A;  2V9A A;  3NOU C;  1TS8 A;  1LL8 A;  1XFN A; 
#chains in the Genus database with same CATH topology
 2ACG A;  2HP5 A;  5FQQ A;  4EBN A;  3MBZ A;  3ZG7 B;  4GS9 B;  2OOL A;  5U47 A;  3AGD A;  2ZL1 B;  5FQ9 A;  4GOG A;  2J9P A;  1NYM A;  4H8R A;  1XJ4 A;  1PYY A;  4MN6 A;  3WS4 A;  4BWI A;  2P9V A;  3UE3 A;  3VV4 A;  3HRE A;  2C6W B;  1XJ3 A;  1A0K A;  4KZ3 A;  5AQB A;  4UA7 A;  3VE4 A;  3PAE A;  1GSW A;  1BT5 A;  3HBR A;  2LB9 A;  5HDC A;  3SH9 A;  3UDX A;  1K6S A;  2H5S A;  4NET A;  4AFI A;  3H7W A;  1BYW A;  1GSV A;  3N8S A;  4PKY A;  5AQ9 A;  2EA9 A;  5TBM A;  3A3E A;  3HUN A;  2L4R A;  4OQ0 A;  4BD1 A;  4O7D A;  3LR5 A;  2GJ3 A;  4HJ3 A;  3A3D A;  1OT9 A;  2PRF A;  4OQH A;  3LIF A;  2NUT C;  4JGP A;  4L9G A;  5CEB A;  2WUQ A;  1P97 A;  1U60 A;  4G3W A;  1D7E A;  4HJ4 A;  3BEB A;  4QU3 A;  3ZG8 B;  2DNS A;  3NOP C;  2HDU A;  3MKE A;  3UY6 A;  2Y2O A;  1YLP A;  5HAP A;  3K3C A;  1YPR A;  1FQG A;  1DJC A;  5DF9 A;  4Y7P A;  2Z2L B;  1WA9 A;  2IWD A;  4I3I A;  4GCZ A;  4HES A;  4Z9Q A;  1KDS A;  3H82 B;  1XFQ A;  4CLC B;  2ZLY A;  1CI9 A;  2EXA A;  1ES4 A;  4KUK A;  4HOI A;  1W7F A;  4WEL A;  3G2Z A;  2XD1 A;  5J8X A;  4G3V A;  1EWZ A;  3Q1F A;  1S66 L;  3LYX A;  3F1N A;  1L0G A;  1KE0 A;  3C38 A;  1H8Z A;  3BQ8 A;  1TEM A;  2A24 B;  1FR6 A;  1CEG A;  4HQA A;  2VV6 A;  2Z6C A;  4R70 A;  5EE8 A;  3GTC A;  1S6R A;  1H8M A;  1ERO A;  5E2F A;  1K4F A;  1N9O A;  1ZHH B;  2WKH A;  1CF0 A;  4WZ5 C;  1IFQ A;  3WRT A;  1E25 A;  1XJ2 A;  3LI8 A;  4HBU A;  1OTB A;  2A2L A;  5CED A;  3UB8 A;  1FCM A;  2OSU A;  3IH8 A;  2PR6 A;  2PAV P;  2ZMV A;  5EVI A;  1S67 L;  1PIO A;  4LV0 A;  4KG2 A;  4QY6 A;  2QWS A;  4PM6 A;  1O7E A;  2JE5 A;  1IYQ A;  4OP5 A;  3KSG A;  4NG2 A;  4S2O A;  4P6B A;  3UME A;  3F1O B;  4N92 A;  5CER A;  4E3I A;  3V3S A;  5FSR A;  4PAU A;  3UDF A;  3EWK A;  3NC8 A;  4Y13 A;  2DMW A;  2J3W A;  4EW7 A;  2XA7 S;  4YWZ A;  3L7H A;  2E8I A;  2OLV A;  1GCE A;  1TDG A;  2GX5 A;  4Y0U A;  4CQH A;  3PBR A;  1TVF A;  3N4I A;  5FEF A;  3ZG5 A;  1KE4 A;  1KOU A;  1MKI A;  4R4R A;  4JXV A;  1JVJ A;  4N9L A;  4DF6 A;  5EM0 A;  3IQA A;  3FZC A;  3A0R A;  3MKF A;  3IWO A;  1UWN X;  2V0W A;  3MZE A;  2VZW A;  2QJ5 A;  3V5M A;  3OCL A;  4EWF A;  2P9V B;  1V9Z A;  3SOI A;  1BUE A;  4JXW A;  3KSF A;  1BLS A;  2L1M A;  1NYY A;  4XXR A;  2IA2 A;  1T18 A;  2HP6 A;  4WMC D;  3Q81 A;  4KZB A;  3QHY A;  4LRX C;  5F69 A;  4EQI A;  3VSL A;  1YLW A;  4EQ1 A;  1K25 A;  3IXG A;  3LO7 A;  1QME A;  3OPL A;  3ITA A;  1K57 A;  1S1Z A;  3H7W B;  3CJM A;  3IF6 C;  3B3X A;  1K0K A;  2VLG A;  1FSW A;  2K7S A;  3ITB A;  5TBM B;  3CWF A;  5CHM A;  1YM1 A;  4YIN A;  3QNB A;  4HNB A;  4JPM A;  1BUL A;  1SDN A;  4GHI B;  2PT7 A;  3KYE A;  3A0S A;  4IBX A;  4LV3 A;  5G4Z A;  4HY8 A;  2E8J A;  3E0Y A;  4UQI M;  4KQR A;  4X6T A;  4WEK A;  2FFY A;  4BJP A;  3HUO A;  2QPN A;  5KMW A;  4Y17 A;  5L07 A;  1YAX A;  3Q7V A;  2K31 A;  3I7J A;  3M6B A;  2WGV A;  1W63 Q;  3KSI A;  3E2L A;  5CXW A;  3NY4 A;  3W4O A;  4EER A;  3UE0 A;  4Y2F A;  2PDR A;  4OOM A;  2Q0O A;  1JWP A;  3VMA A;  4Z1W A;  5GHZ A;  2BAS A;  1W8Y A;  1NRF A;  3LCE A;  4ME4 A;  1D1J A;  1MBL A;  1S1Y A;  1DRM A;  4NXF A;  3F1N B;  1LSV A;  2JKR I;  1MWT A;  5M1A A;  4OQI A;  4OH0 A;  4MBH A;  2YKF A;  1QMF A;  4DDY A;  5HD3 A;  1I5Q A;  4HH2 A;  1PW8 A;  1PZO A;  3D3O A;  3FC7 A;  3VOZ A;  2XRN A;  4FTX A;  4GN2 A;  1ESI A;  2PBD P;  2ZD8 A;  4QD4 A;  4OPQ A;  3MXR A;  4X56 A;  4IVK A;  1Q2P A;  3SS3 A;  1LT0 A;  1PNE A;  1CJF A;  2O9C A;  3CHW P;  2LB5 A;  4X1L A;  3EQV A;  3IF5 A;  4EUV A;  4R3A A;  1T1A A;  4ZJ3 A;  2XFS A;  1YLT A;  2XDM A;  1KGF A;  1YKD A;  3B42 A;  2CC1 A;  4GW9 A;  2WKR A;  2V2F F;  3S22 A;  4S2L A;  1BTL A;  4G3K A;  4X55 A;  4KZ6 A;  1ONG A;  4LCL A;  3GQZ A;  3C5A A;  1NLZ A;  1PWC A;  1TDL A;  2G2W A;  4Q0I A;  3LY4 A;  5L09 A;  3S7P A;  5DTK A;  4II7 A;  3LUQ A;  4DJ2 A;  3LIA A;  4NXB A;  1BSG A;  4BQM A;  4IUK A;  5CGS A;  2J8Y A;  5CHJ A;  3LR0 A;  4OPR A;  4GDN A;  3TOI A;  1YLY A;  2JKG A;  4B4Z A;  3MXQ A;  1N4O A;  2V0U A;  2Y59 A;  3GMW A;  1C3B A;  3G32 A;  4X68 A;  5DJT A;  3MSH A;  3HL9 A;  4EES A;  4S2N A;  4JKT A;  5CX7 A;  3GSG A;  3IHB A;  3BFF A;  4Y3I A;  1JWV A;  3N8L A;  2YKH A;  1F2K A;  2XQZ A;  2GDN A;  1H5X A;  2VEA A;  4KG6 A;  4I3J A;  4KZ7 A;  2ZC3 B;  1ACF A;  1LLB A;  2M7U A;  1XJ6 A;  2XH9 A;  3OBF A;  5AQA A;  1VEU B;  3VP2 A;  4RX3 A;  1S4R A;  1K56 D;  1DP6 A;  3EOI A;  1XGJ A;  3LIE A;  3MQ0 A;  3NI9 A;  3RH8 B;  1IYS A;  3BQA A;  3E2K A;  1PRQ A;  2W3D A;  5F5Y A;  3IX3 A;  1NRJ A;  3OPR A;  4B93 A;  5JYP A;  1VET B;  4GDB A;  2PU2 A;  3SH7 A;  2J3T D;  5MC7 A;  2PYP A;  3C7U A;  3Q7V B;  3S7Q A;  1ZC2 A;  4FSF A;  3V50 A;  2VGK A;  5L8M A;  1PWG A;  2Y2M A;  4WUJ A;  3VFH A;  3MJQ A;  3OPP A;  5IHV A;  2P7J A;  2W1R A;  1KDW A;  3IF6 A;  5EVE A;  1O07 A;  2Y2L A;  1BLC A;  5HPI A;  3BFD A;  5EV0 A;  5D3O A;  2VGL M;  1K54 A;  1MWU A;  2BTF P;  4LPZ A;  3P7N A;  3BFG A;  1K55 C;  3OC2 A;  3VP4 A;  2NUP C;  2FZ0 A;  4CLC D;  3LFV A;  4DE3 A;  4GNU A;  3D9Y A;  3NUL A;  4M3K A;  3A0V A;  1E4D A;  4BMW A;  1MKM A;  4YNR A;  5KZH A;  3L9K A;  1ODV A;  1L3L A;  3LEZ A;  4IUH A;  4MLL A;  2P74 A;  4S2I A;  1ES2 A;  2O99 A;  3IHA A;  2GNX A;  4KQQ A;  2WGW A;  4O01 A;  3B33 A;  3UB5 P;  2HGV A;  4MNR A;  2OAQ 1;  3GV9 A;  1EW0 A;  1VM1 A;  1RGZ A;  3FKV A;  4ID4 A;  3TE8 A;  4Q8I A;  3OOV A;  3G6O A;  2ZQA A;  5EVL A;  2WAD A;  3NBL A;  5AQ7 A;  3LR4 A;  2KLI A;  2EFX A;  4JGR A;  4Y15 A;  3T4O A;  4ZBE A;  5CRF A;  3MQO A;  1SKO A;  1UGU A;  2ZM8 A;  2V1Z A;  3G34 A;  5E2H A;  3MXS A;  2HJE A;  2ZM0 A;  1T19 A;  3ZVW A;  5F82 A;  5KSC A;  1ZG6 A;  2V8F A;  3LIB A;  1SZV A;  4OKP A;  2W3G A;  5DF8 A;  1MC0 A;  4JLF A;  3RFB A;  3QNC A;  3WS5 A;  5J7E A;  1NZU A;  1V9Y A;  3PBN A;  2KX6 A;  2A49 A;  4I3A A;  4EXO A;  3T1R A;  2Y2P A;  5AVF A;  1HVB A;  4DJ3 A;  3UPN A;  4OON A;  1F5M A;  1M6K A;  4LV1 A;  1OT6 A;  1G5U A;  1KVM A;  5K5B A;  3FKW A;  1FIK A;  1YT4 A;  4P6Z S;  4FUW A;  1L0D A;  3PXP A;  4OPZ A;  2WKQ A;  4HEF A;  5F68 A;  1LL5 A;  5J3W A;  2J3T C;  3CAX A;  1HD8 A;  3LGO A;  3Q7Z A;  4U0X A;  3HLC A;  4WMC A;  4RVA A;  4WBG A;  2P08 A;  3TSG A;  1HLU P;  3IS2 B;  2B95 A;  2EXB A;  1UWP X;  5DF7 A;  3GEC A;  4NKP A;  2VJW A;  4UA9 A;  5TFQ A;  5GLA A;  2PYR A;  4ETX A;  1DP8 A;  4F3L A;  1XXM A;  1ZG4 A;  3MFD A;  4EU0 A;  5FQI A;  5TJJ A;  1L0F A;  4C75 A;  4RYE A;  4HI4 A;  2X02 A;  2EWV A;  2PU4 A;  3BRM A;  2R9X A;  1FCO A;  4B88 A;  2ZQD A;  3ZQ5 A;  4CLC C;  4FH2 A;  3MZF A;  2Y79 A;  1NZO A;  3Q82 A;  3PBT A;  3HLE A;  3ZNY A;  4S2M A;  4UEY A;  3IXD A;  4E3L A;  4BBT A;  3MFX A;  3R7W B;  2P04 A;  4M4X A;  4R1G A;  1TS6 A;  3U2A A;  2Y2I A;  3F1P A;  4ZAM A;  3VFF A;  4QB8 A;  1JTD A;  2Q9N A;  3CMZ A;  4ZJ2 A;  3ZVT A;  4XT2 A;  3TG9 A;  4ZTK A;  2PHY A;  5TGF A;  2DCF A;  4R23 A;  3CZD A;  3WS1 A;  4BL2 A;  4KQO A;  4ESP A;  4DN0 A;  3FPV A;  3NCK A;  5CEC A;  4ZRR A;  5EOE A;  1NXY A;  1P9R A;  1FIL A;  4C6Y A;  2V1A A;  5CGX A;  2ZQ8 A;  4E6W A;  5L10 A;  4UAA A;  5HAQ A;  2FH5 A;  4RQ9 A;  3O87 A;  5AJG A;  3P98 A;  4DXB A;  1GSX A;  3BFC A;  5C5K A;  2QZ6 A;  5BOH A;  1M40 A;  3UB7 A;  3C7V A;  2HPB A;  4KZ5 A;  4RX2 A;  5EM1 A;  3BYD A;  2V9A A;  3NOU C;  1TS8 A;  1LL8 A;  1MPL A;  2WGW B;  3DWZ A;  3KYZ A;  2XK1 A;  4OLG A;  2EX8 A;  1KGE A;  3IXB A;  5JYO A;  1I2S A;  1DY6 A;  4WF0 A;  1GA9 A;  5HL6 A;  2RCX A;  2D02 A;  1H0M A;  3SS4 A;  5HD5 A;  4DE2 A;  5HAI A;  3G2Y A;  4X53 A;  3EEH A;  3G35 A;  4PM7 A;  1ERQ A;  2PD8 A;  1FOF A;  4GZB A;  1K4E A;  1MXO A;  2Y2Q A;  1K55 A;  2WYX A;  3CI6 A;  5E2E A;  5IT5 A;  3ZFZ A;  1SKO B;  4JBF A;  1BZA A;  1TF1 A;  1DP9 A;  3GRJ A;  4UHU A;  3UE1 A;  2VGJ A;  2XGN A;  2Y2K A;  4B9O A;  1XPB A;  1XP4 A;  4LFU A;  5DKL A;  3LI9 A;  4XUX A;  2PD7 A;  4K0X A;  2W27 A;  5F83 A;  2KDK A;  5A8B A;  3K3D A;  4LRY C;  1Q2Q A;  2OV5 A;  3E98 A;  1XA1 A;  2Y2N A;  3ZDJ A;  3RTY A;  3WS0 A;  3MF0 A;  4E6X A;  2WZX A;  2V1B A;  2OWH A;  4GD8 A;  4F94 A;  2V20 A;  3E4P A;  2X01 A;  2RL3 A;  2EX2 A;  2G2U A;  4FH4 A;  2ZQ7 A;  3SW1 A;  3EGX C;  4OVD A;  2Y4A A;  2QKP A;  2ZJ9 A;  1Y28 A;  2R9W A;  3W2Z A;  4GD6 A;  2QMI A;  5HW3 A;  3N6I A;  4DRT A;  3V3R A;  1FSY A;  1LSW A;  5HDD A;  1L0E A;  1W63 M;  2JC7 A;  4MEZ A;  4OPY A;  3NIA A;  3RXW A;  4BD0 A;  2HDS A;  1IKI A;  2M7V A;  3FYZ A;  4F3L B;  1ZKJ A;  5GLD A;  3C30 A;  3NDG A;  3ZYT A;  4MDZ A;  1PI5 A;  4WEJ A;  3B47 A;  4QWO A;  4XUZ A;  5HX9 A;  5CHU A;  1JTG A;  1NWZ A;  5EVI B;  4FCF A;  1RCJ A;  3DW0 A;  2B5R A;  2ZC6 B;  2IWC A;  1PFL A;  2H0Y A;  2EWW A;  3JYI A;  4K91 A;  3GR2 A;  1WYB A;  3MZD A;  2W3H A;  3DTM A;  3FV7 A;  1OTE A;  3QP4 A;  1YMX A;  3N8R A;  3WWX A;  2INW A;  4WZ5 A;  2JHE A;  1IKG A;  2J7V A;  4NXE A;  3HCY A;  4BEN A;  3GVB A;  3IBR A;  4WL9 A;  2VV7 A;  4ZJ1 A;  2HDQ A;  5A91 A;  1K6R A;  4OP8 A;  3BM6 A;  4MBK A;  1HTZ A;  3IXH A;  3DTI A;  4NXG A;  3H82 A;  2WZZ A;  2PR5 A;  3A3I A;  3KO6 A;  5EFW A;  4HH3 A;  3C4O A;  4MMN A;  2VV8 A;  1T1B A;  5EUA A;  3T4L A;  5IS1 A;  4S2K A;  4ARZ A;  1ES3 A;  3UNW A;  4PHT A;  4MCW A;  2WKE A;  4OOY A;  4IBR A;  4BBU A;  3HLD A;  1PI4 A;  5FAS A;  3NEC A;  3IT9 A;  4E3N A;  3MMH A;  4DE0 A;  2Z6D A;  2WKI A;  2ZOI A;  4L9F A;  4E3O A;  5EOO A;  2BLS A;  2Y55 A;  4X1M A;  3T1S A;  4MN7 A;  1W79 A;  4I38 A;  4YFM A;  3G4P A;  3VP1 A;  3QP6 A;  2EX9 A;  4S2J A;  1VB6 A;  2XFT A;  4Q0J A;  3G31 A;  2PBY A;  4FOF A;  4Y5F A;  1LHY A;  1OTD A;  3LID A;  4CLC E;  2VK3 A;  4KZ4 A;  4YOF A;  4PMA A;  1YMS A;  2ZQ9 A;  1SHV A;  1PZP A;  1TD5 A;  3JPU A;  1K38 A;  3C4P A;  1BLP A;  1SCW A;  3IH9 A;  4IHQ A;  3MR0 A;  4IJG A;  4UQI S;  3F1O A;  3T4S A;  4D60 A;  2OLU A;  2XA7 M;  1LI9 A;  3R4K A;  4OLD A;  3ULF A;  2ZC4 B;  4HP4 A;  4DXC A;  3PBO A;  2UV0 E;  2W1T A;  3ZCZ A;  4ETZ A;  4N1X A;  4R38 A;  5DFX A;  5HZH A;  1XKZ A;  3PHY A;  2ZMA A;  5FEG A;  1CQA A;  1K57 C;  1X0O A;  2WK0 A;  4KZ8 A;  3PBQ A;  3S4X A;  3PAG A;  5FI7 A;  3SH8 A;  4E3K A;  2JCH A;  4I5S A;  5CGW A;  3DWK A;  4R6L A;  5FDH A;  2A3U A;  5F6A A;  1E3U D;  1WE4 A;  1FR1 A;  1Z6F A;  4D2O A;  4IVI A;  5DJU A;  4FD8 A;  2WKP A;  1I2W A;  4R3B A;  5AVE A;  2XD5 A;  3E4O A;  3VOL A;  3MQQ A;  3S1Y A;  4DMZ A;  3T4T A;  2Y2G A;  2H10 A;  4LEN A;  2O9B A;  3IWQ A;  5FAP A;  3SS5 A;  3CUE C;  4JGQ A;  1OTI A;  4WYY A;  3N7W A;  2ZC7 A;  1MZU A;  1ES5 A;  5DTT A;  5DTS A;  3TJZ C;  5EPH A;  2XF3 A;  3PBS A;  3P09 A;  1TS7 A;  4U0T A;  1NY0 A;  1OPX A;  3VOY A;  4GHI A;  1ZTU A;  5KSH A;  4EBL A;  4HJ6 A;  3SZT A;  1F98 A;  2ZC5 B;  4P87 A;  4OOL A;  1LL9 A;  1HZO A;  4KZA A;  2JKT I;  3IX4 A;  1STZ A;  2Z2M B;  4UA6 A;  3IWI A;  4K08 A;  3VE3 A;  1W5D A;  2WAE A;  5E2G A;  4H6J A;  4R0Q A;  5FAT A;  5A93 A;  1G6O A;  3BFE A;  1YSP A;  3DAV A;  4KUO A;  2JKR M;  2W0N A;  2HF6 A;  3UDI A;  2O0Y A;  3ZNT A;  3HLB A;  3CPT A;  1RP5 A;  4GLQ A;  2VA0 A;  3T4J A;  3LR3 A;  4PM8 A;  5F1F A;  1BLH A;  4QPR A;  3EQU A;  1YLZ A;  4ARZ B;  2I9V A;  4EEP A;  4Y0O A;  1XX2 A;  3P01 A;  5E43 A;  5DVA A;  3C2W A;  3NHQ A;  4HIA A;  1CK3 A;  3BW6 A;  1F9I A;  2Y91 A;  3A3J A;  3HJI A;  2XSS A;  2HDR A;  3UB6 A;  2G7U A;  4CJN A;  4U3T A;  1JWZ A;  3TW8 A;  1PW1 A;  1DJB A;  1GHP A;  1XA7 A;  3LIC A;  5DKK A;  3RJU A;  4P0M A;  3BY8 A;  1IEL A;  1VHM A;  5HWW A;  1AWI A;  4EV4 A;  5G4Y A;  4WLA A;  2OWJ A;  5FI2 A;  4CPK A;  5GHX A;  1OJG A;  3DTK A;  5FDS A;  3RXX A;  1WYC A;  2Y2J A;  3BJN A;  3M6H A;  1OTA A;  3H9W A;  3ICY A;  1IEM A;  5FQM A;  3ZGA B;  2JN7 A;  1TS0 A;  4K0W A;  3V67 A;  4S2N C;  3HLG A;  2J80 A;  3WS2 A;  1ALQ A;  5A92 A;  3CG5 A;  4OQG A;  5FQK A;  2W1T B;  4C3Q A;  3IF6 B;  1ONH A;  2HP9 A;  3JVV A;  3CIT A;  4KG5 A;  3M2J A;  2QJ7 A;  3HJK A;  1W8Q A;  4EUZ A;  3C8C A;  4A5R A;  5I94 A;  3EGD C;  1P9W A;  3VP3 A;  1NLY A;  3T12 B;  2XEP A;  4JF6 A;  5HDS A;  5F1G A;  4RA7 A;  1KVL A;  4HBT A;  3W4Q A;  5HFO A;  4N9K A;  2VGL S;  3ZHH A;  2W3F A;  1JNU A;  3FPW A;  1H3Q A;  1J9M A;  4L0L A;  2I72 A;  3T4Q A;  5HSQ A;  2EFU A;  3UPP A;  1IYO A;  4QHC A;  4BL3 A;  5HWV A;  5I5L A;  4KZ9 A;  5FL3 A;  2VX8 A;  4E3M A;  3ZG9 B;  3BLM A;  2ZM2 A;  2B18 A;  2FFF B;  4MBF A;  4EET B;  2M1C A;  4L9E A;  2WGI A;  2XLN A;  1N9B A;  3IBJ A;  2W3E A;  2C5W B;  5L2F A;  3UB9 A;  1VEU A;  3AGF A;  1S0W A;  5HAR A;  5FAO A;  3JVU A;  3D72 A;  3HLF A;  3S7N A;  5KIZ A;  3IX8 A;  3UE6 A;  1NJ4 A;  2ZQC A;  5GLC A;  1K54 C;  2BG1 A;  4X25 A;  3OLO A;  3BY9 A;  5EVI D;  3PR6 A;  4LCM A;  5FAQ A;  3K2N A;  1PWD A;  1S4S A;  4X69 A;  4JGO A;  4DE1 A;  1VET A;  3E4Q A;  1MY8 A;  2HJ9 C;  3QP5 A;  2J9O A;  3O5Y A;  3PTE A;  1KE3 A;  3CUE A;  1SKF A;  4H6J B;  4GS9 A;  1CI8 A;  3OCN A;  1OME A;  2ZL1 A;  4HP9 A;  4IED A;  3VSK A;  1L2S A;  4E3J A;  3BEC A;  4PKY G;  4QJG A;  3CPT B;  1Z09 A;  3EEA A;  2JBF A;  5A90 A;  4DDS A;  2HZ5 A;  3NJA A;  3Q07 A;  5FA7 A;  4HHD A;  5LBR A;  3T50 A;  1N9L A;  1ESU A;  4KQD A;  1EI5 A;  3QP8 A;  4ZDX A;  2Y2H A;  3O86 A;  2ZBB A;  2IWB A;  3O88 A;  1GHI A;  2JKF A;  4GKU A;  4JXS A;  3CLO A;  2WAF A;  2GZA A;  3W4P A;  5GLB A;  3AGE A;  2B02 A;  4WZ4 A;  4LGW A;  1K56 A;  2MJ6 A;  2Y8H A;  2QHK A;  5J4E A;  1Y4O A;  1SDE A;  5IU1 A;  3UPO A;  5GL9 A;  3M2K A;  4R3J A;  5TR7 A;  4LRZ E;  3HVF A;  1RGY A;  3FG8 A;  2JKT M;  2QYB A;  3VP0 A;  3KSH A;  3GDI A;  3HUM A;  4B4X A;  1OJ5 A;  4KEN B;  5FQJ A;  2CMN A;  3LY3 A;  2L0W A;  3QP2 A;  4R4S A;  2ZOH A;  1ERM A;  1MWR A;  2EX6 A;  3OPH A;  1DJA A;  3D4F A;  2D01 A;  3F1P B;  5CTN A;  1LI0 A;  4EEU A;  3OZH A;  4BLM A;  4XT2 B;  3UN7 A;  2H28 A;  2Q9M A;  4WN5 A;  1IYP A;  1G6A A;  2XR0 A;  4I39 A;  4JF5 A;  4N1H A;  1FCN A;  3U4L P;  3V39 A;  3W8K A;  4S2P A;  3WRZ A;  4WM9 A;  1XGI A;  4CLC A;  4P6Z M;  5FI6 A;  3S7O A;  3BWL A;  3DTE A;  4PPR A;  3T1X A;  1E3U A;  3FWL A;  4MN5 A;  3LEQ A;  4LLO B;  5HWT A;  1N9N A;  5EVI C;  5G18 A;  1G28 A;  1G68 A;  1YLJ A;  3QP1 A;  3HLW A;  4LV2 A;  5GHY A;  4NK3 A;  5HPF A;  4PM5 A;  5HL1 A;  4EBP A;  4DKI A;  2V8C A;  2OAP 1;  1YQS A;  4JXG A;  3T4K A;  1IOU A;  3TRC A;  2A24 A;  3KYQ A;  3G30 A;  1VQQ A;  2UWX A;  2ZMF A;  2VKS A;  4P85 A;  5M18 A;  1AXB A;  1Y54 A;  3UO9 A;  5M19 A;  2KOI A;  3IS2 A;  4NEE D;  1KGG A;  3NDE A;  5EEC A;  3DBA A;  1GA0 A;  3ISG A;  1GHM A;  1D06 A;  3KX0 X;  3O3V A;  3NOT C;  2R78 A;  2DRW A;  4Q0H A;  4E04 A;  4O0P A;  2XRO A;  3MS6 A;  2O9A A;  1T1C A;  3BLS A;  2HV1 A;  3PYP A;  3A3F A;  3T1Q B;  3ZG0 A;  3UMD A;  2X71 A;  1MWS A;  5CTM A;  4O8G A;  1LSX A;  4Y0T A;  1CEF A;  1YSQ A;  4GJ4 A;  1P0Z A;  2H0T A;  4BBV A;  2K2N A;  2AVX A;  3R7W A;  5DFY A;  1H8Y A;  4GB7 A;  1J3W A;  4QY5 A;  1XFN A;  4JF4 A;  4PM9 A; 
#chains in the Genus database with same CATH homology
 4ARZ B;  3B42 A;  2I9V A;  4GW9 A;  4EEP A;  2WKR A;  3P01 A;  4WF0 A;  4GS9 B;  5HL6 A;  3C2W A;  3NHQ A;  4G3K A;  4HIA A;  2D02 A;  2OOL A;  3BW6 A;  1F9I A;  5HD5 A;  3HJI A;  2XSS A;  1NLZ A;  3EEH A;  3UB6 A;  2G7U A;  4Q0I A;  3TW8 A;  2PD8 A;  1XJ4 A;  3S7P A;  4MN6 A;  4BWI A;  3LIC A;  3CI6 A;  5DKK A;  3UE3 A;  3VV4 A;  5IT5 A;  1XJ3 A;  1TF1 A;  1DP9 A;  4II7 A;  3BY8 A;  3LUQ A;  1VHM A;  4B9O A;  4DJ2 A;  3LIA A;  4NXB A;  5HWW A;  5DKL A;  3VE4 A;  4IUK A;  3LI9 A;  1GSW A;  5G4Y A;  4WLA A;  2OWJ A;  3LR0 A;  2LB9 A;  5HDC A;  2PD7 A;  3MXQ A;  2W27 A;  1OJG A;  2V0U A;  4AFI A;  2KDK A;  3H7W A;  5A8B A;  3K3D A;  3BJN A;  1BYW A;  5DJT A;  1GSV A;  1OTA A;  4PKY A;  3H9W A;  3ICY A;  4LRY C;  2JN7 A;  2EA9 A;  4EES A;  5TBM A;  3E98 A;  1TS0 A;  5CX7 A;  3RTY A;  3V67 A;  3MF0 A;  2L4R A;  4Y3I A;  2V1B A;  2J80 A;  2OWH A;  3E4P A;  2YKH A;  3LR5 A;  2VEA A;  2GJ3 A;  4HJ3 A;  2W1T B;  4I3J A;  1OT9 A;  3SW1 A;  3JVV A;  3CIT A;  2QJ7 A;  3HJK A;  3EGX C;  2M7U A;  3C8C A;  1XJ6 A;  3LIF A;  2QKP A;  2NUT C;  3EGD C;  1Y28 A;  3OBF A;  4JGP A;  4L9G A;  1P9W A;  3W2Z A;  1NLY A;  1P97 A;  4G3W A;  1S4R A;  1D7E A;  4HJ4 A;  1DP6 A;  3EOI A;  5HDS A;  3LIE A;  3MQ0 A;  1LSW A;  5HDD A;  3NOP C;  1W63 M;  3RH8 B;  3BQA A;  2VGL S;  2W3D A;  2W3F A;  5F5Y A;  1JNU A;  3K3C A;  2M7V A;  1NRJ A;  3FPW A;  1H3Q A;  4F3L B;  5DF9 A;  3C30 A;  4B93 A;  4L0L A;  3ZYT A;  4MDZ A;  4WEJ A;  1WA9 A;  3B47 A;  3T4Q A;  4I3I A;  4GCZ A;  5HSQ A;  2J3T D;  3H82 B;  5MC7 A;  2PYP A;  1XFQ A;  3S7Q A;  4CLC B;  4FSF A;  1NWZ A;  5HWV A;  4KUK A;  5I5L A;  5FL3 A;  5L8M A;  4HOI A;  2VX8 A;  4WEL A;  4WUJ A;  4G3V A;  3MJQ A;  2B18 A;  1S66 L;  3LYX A;  3F1N A;  2EWW A;  2P7J A;  2M1C A;  4EET B;  3C38 A;  4L9E A;  2W1R A;  3BQ8 A;  3IBJ A;  2W3H A;  2W3E A;  2A24 B;  1OTE A;  5HPI A;  4HQA A;  3UB9 A;  2VV6 A;  2Z6C A;  4R70 A;  2INW A;  3JVU A;  2JHE A;  2VGL M;  3D72 A;  3S7N A;  5KIZ A;  1H8M A;  3UE6 A;  4NXE A;  3HCY A;  1N9O A;  1ZHH B;  1IFQ A;  4LPZ A;  3P7N A;  3OC2 A;  2NUP C;  2FZ0 A;  3OLO A;  1XJ2 A;  3BY9 A;  3IBR A;  3LFV A;  4WL9 A;  4CLC D;  3PR6 A;  2VV7 A;  3LI8 A;  3A0V A;  3K2N A;  1OTB A;  2A2L A;  4BMW A;  1MKM A;  1S4S A;  4YNR A;  3UB8 A;  1ODV A;  4JGO A;  2PR6 A;  4IUH A;  4NXG A;  3E4Q A;  3H82 A;  2ZMV A;  2PR5 A;  2HJ9 C;  5EFW A;  3KO6 A;  4HH3 A;  2O99 A;  3O5Y A;  2GNX A;  4MMN A;  4O01 A;  2VV8 A;  1S67 L;  1T1B A;  3B33 A;  3T4L A;  5IS1 A;  2HGV A;  3CUE A;  4ARZ A;  2OAQ 1;  2QWS A;  1EW0 A;  4PHT A;  4MCW A;  4H6J B;  4GS9 A;  3KSG A;  3TE8 A;  3OOV A;  3OCN A;  3F1O B;  3UME A;  3G6O A;  4BBU A;  4HP9 A;  3MMH A;  4PKY G;  2Z6D A;  4L9F A;  2ZOI A;  3EEA A;  4PAU A;  3EWK A;  3LR4 A;  2KLI A;  3NJA A;  4MN7 A;  4HHD A;  2DMW A;  2J3W A;  5LBR A;  2XA7 S;  4EW7 A;  3T50 A;  4YWZ A;  1N9L A;  4I38 A;  4JGR A;  3T4O A;  2GX5 A;  4CQH A;  3MQO A;  3PBR A;  4KQD A;  1UGU A;  1VB6 A;  1KOU A;  4Q0J A;  4FOF A;  4Y5F A;  2ZBB A;  2HJE A;  1T19 A;  1OTD A;  3LID A;  4CLC E;  3A0R A;  3CLO A;  3LIB A;  2W3G A;  1UWN X;  2GZA A;  4YOF A;  1MC0 A;  2B02 A;  2V0W A;  3RFB A;  2VZW A;  2MJ6 A;  1TD5 A;  2QJ5 A;  5J7E A;  2Y8H A;  3OCL A;  1V9Y A;  3PBN A;  2QHK A;  5J4E A;  2KX6 A;  1V9Z A;  4I3A A;  4IHQ A;  4EXO A;  5AVF A;  3MR0 A;  3KSF A;  4IJG A;  4DJ3 A;  5IU1 A;  4UQI S;  2L1M A;  1F5M A;  3F1O A;  3T4S A;  1OT6 A;  4LRZ E;  2IA2 A;  2XA7 M;  5K5B A;  1T18 A;  3R4K A;  3ULF A;  4HP4 A;  4LRX C;  4P6Z S;  5F69 A;  3PBO A;  2W1T A;  3PXP A;  4EQ1 A;  3FG8 A;  2JKT M;  2WKQ A;  4ETZ A;  2QYB A;  5F68 A;  3KSH A;  4R38 A;  2J3T C;  3GDI A;  5J3W A;  3CAX A;  5DFX A;  1S1Z A;  3H7W B;  5HZH A;  1OJ5 A;  3PHY A;  2VLG A;  2CMN A;  2K7S A;  1X0O A;  2L0W A;  2ZOH A;  5TBM B;  3CWF A;  3PBQ A;  2P08 A;  2D01 A;  3F1P B;  4HNB A;  3IS2 B;  1UWP X;  4EEU A;  4XT2 B;  4I5S A;  3GEC A;  4GHI B;  2PT7 A;  4NKP A;  3A0S A;  2VJW A;  2H28 A;  4R6L A;  4WN5 A;  5G4Z A;  5F6A A;  4HY8 A;  2PYR A;  4ETX A;  1DP8 A;  4I39 A;  4F3L A;  3E0Y A;  4UQI M;  5DJU A;  2WKP A;  4EU0 A;  5TJJ A;  4WEK A;  4BJP A;  5AVE A;  4HI4 A;  1YAX A;  2EWV A;  4CLC A;  4P6Z M;  3E4O A;  3S7O A;  3BWL A;  3VOL A;  3MQQ A;  4MN5 A;  2K31 A;  3ZQ5 A;  4LLO B;  4CLC C;  5HWT A;  4DMZ A;  1N9N A;  3T4T A;  1G28 A;  2O9B A;  2Y79 A;  5HPF A;  1W63 Q;  3CUE C;  3KSI A;  3PBT A;  4JGQ A;  2OAP 1;  4EER A;  4UEY A;  1OTI A;  4Y2F A;  3T4K A;  2PDR A;  1IOU A;  4OOM A;  3TRC A;  4BBT A;  2A24 A;  1MZU A;  3KYQ A;  3MFX A;  3TJZ C;  3R7W B;  2P04 A;  4Z1W A;  2ZMF A;  3PBS A;  2VKS A;  4M4X A;  1TS7 A;  3U2A A;  1TS6 A;  3F1P A;  1OPX A;  2BAS A;  2KOI A;  3IS2 A;  4NEE D;  4ME4 A;  3DBA A;  4XT2 A;  4GHI A;  1ZTU A;  5KSH A;  2PHY A;  1D06 A;  1S1Y A;  1DRM A;  4NXF A;  3KX0 X;  4HJ6 A;  3F1N B;  1LSV A;  4KQO A;  1F98 A;  3NOT C;  2R78 A;  4Q0H A;  2JKR I;  4E04 A;  4DN0 A;  4OOL A;  3FPV A;  2YKF A;  4O0P A;  4ZRR A;  2XRO A;  2O9A A;  1T1C A;  5HD3 A;  1P9R A;  2HV1 A;  3PYP A;  4HH2 A;  3D3O A;  3FC7 A;  2JKT I;  2XRN A;  2V1A A;  1STZ A;  3UMD A;  4K08 A;  3VE3 A;  4O8G A;  1LSX A;  4H6J A;  2FH5 A;  4RQ9 A;  1G6O A;  1YSP A;  1YSQ A;  4KUO A;  2JKR M;  2W0N A;  2HF6 A;  5AJG A;  1LT0 A;  4GJ4 A;  1GSX A;  1P0Z A;  5C5K A;  2O0Y A;  2O9C A;  2LB5 A;  3UB7 A;  4BBV A;  2K2N A;  3EQV A;  4EUV A;  4R3A A;  3R7W A;  5DFY A;  4GLQ A;  2VA0 A;  1T1A A;  3T4J A;  3LR3 A;  2V9A A;  3NOU C;  1TS8 A;  1LL8 A;  1XFN A;  4QPR A;  3EQU A;  3KYZ A;  1YKD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...