5HWWA

Crystal structure of pas1 complexed with 1,2,4-tmb
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
128
structure length
128
Chain Sequence
GAMALYEFVGLLDAHGNVLEVNQVALEGGGITLEEIRGKPFWKARWWQISKKTEATQKRLVETASSGEFVRCDVEILGKSGGREVIAVDFSLLPICNEEGSIVYLLAEGRNITDKKKAEAMLALKNQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Sensor histidine kinase TodS
publication title Molecular Insights into Toluene Sensing in the TodS/TodT Signal Transduction System.
pubmed doi rcsb
source organism Pseudomonas putida (strain f1 / atcc 700007)
total genus 38
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2016-01-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5hwwA00
1XJ3A 3P7NA 2OWHA 5J3WA 4EERA 5I5LA 4HJ6A 3KX0X 1P0ZA 3IBRA 3T50A 2ZOHA 3UB9A 4R70A 4GCZA 1OT9A 4HY8A 2OOLA 1LSVA 2W27A 5F68A 4HQAA 3VE3A 2QWSA 4PKYG 2V1AA 3LI9A 4I38A 4MN5A 4EW7A 2H28A 1LT0A 2OWJA 2PR6A 4I39A 1DP9A 3UB8A 3GDIA 1GSWA 3OLOA 3FC7A 5J4EA 5IS1A 4NXFA 1OTEA 2PD8A 3E4OA 4YWZA 2B02A 1P97A 2W0NA 5J7EA 4KQDA 3LUQA 5G4ZA 3MJQA 3LIFA 3F1OA 4GS9A 5HDSA 4WF0A 4EETB 4M4XA 2QJ5A 3C8CA 2L0WA 3GECA 1KOUA 5G4YA 4WN5A 3UE6A 3NHQA 1V9ZA 2INWA 4L9GA 1V9YA 5HD3A 1UWPX 4MN6A 1T1BA 3HJIA 5DKLA 4I3IA 3BY9A 5TBMA 4R3AA 4BBUA 1Y28A 4JGPA 3VE4A 4JGOA 1XJ6A 2ZOIA 3VOLA 3PYPA 3UMEA 3H82B 2JN7A 5TBMB 1S67L 1OTDA 1TS7A 5EFWA 4EEUA 2V1BA 3D72A 1GSVA 3HJKA 1UGUA 2VEAA 4HP4A 1JNUA 4BBTA 4B9OA 3NJAA 2PR5A 4GW9A 5AVFA 2EA9A 4BBVA 4EESA 2VV6A 1XJ4A 2PHYA 4WLAA 4EEPA 2YKHA 4I5SA 1N9OA 4H6JB 4KUOA 3F1PB 3LIAA 1S66L 5HDDA 3F1NB 4HJ4A 2QJ7A 1N9LA 2R78A 4E04A 3K3DA 2Z6DA 2PDRA 4XT2B 2V0WA 5A8BA 1TS8A 1DRMA 1X0OA 2HV1A 4F3LB 5HZHA 4DJ2A 2K7SA 1DP8A 2L4RA 1TS6A 3ZQ5A 4K08A 1OTAA 1DP6A 4LLOB 4PKYA 2PYRA 1OTBA 1WA9A 4NXEA 1EW0A 2A24B 5F5YA 1D7EA 2QKPA 4EQ1A 2VV7A 3UB7A 3NOUC 4HJ3A 3BWLA 3E4PA 3MQQA 4EXOA 3H9WA 5KIZA 1OJGA 2D01A 5DJUA 4DJ3A 3H82A 2V9AA 4R38A 4WL9A 1LSXA 3G6OA 3IS2B 3LIDA 4R6LA 4I3AA 2PYPA 1T19A 2GJ3A 2I9VA 4LRZE 3EEHA 2WKPA 1S4SA 1GSXA 3FG8A 1LSWA 3LIEA 3NOPC 2VLGA 5IU1A 1TS0A 5HWVA 3CLOA 3UB6A 4KUKA 1S4RA 3UMDA 4HNBA 2JHEA 2PD7A 2YKFA 2KX6A 3MR0A 2ZBBA 4H6JA 4LPZA 3F1PA 1T1CA 2L1MA 4JGQA 3H7WA 1XFQA 3F1NA 4L9FA 3LI8A 4GHIB 1ODVA 1XJ2A 2VV8A 4HOIA 3E4QA 2BASA 3H7WB 4XT2A 5HWWA 4F3LA 1UWNX 4JGRA 3CWFA 5F6AA 3PHYA 2QHKA 4HH2A 4HH3A 3EWKA 1T18A 3MFXA 1D06A 1OT6A 4HP9A 3MXQA 3C2WA 3MQOA 2A24A 1S1ZA 3LIBA 1BYWA 5F69A 2CMNA 2V0UA 4HI4A 2J80A 3BY8A 3A0VA 1XFNA 3LYXA 1S1YA 4WUJA 2WKQA 2Z6CA 3A0SA 3SW1A 4LRXC 5DJTA 5HD5A 4I3JA 3F1OB 1G28A 4GS9B 1OTIA 3IS2A 3LICA 4RQ9A 1NWZA 5AVEA 5HSQA 5HDCA 1LL8A 4HHDA 1OJ5A 4HIAA 3ULFA 2KDKA 1F98A 1VB6A 2M1CA 3CAXA 5HWTA 3ICYA 1T1AA 1F9IA 3NOTC 3A0RA 3RH8B 1N9NA 1MZUA 4NXBA 2P7JA 4L9EA 2D02A 3B33A 4GHIA 2WKRA 4NXGA 4LRYC 5DKKA 3K3CA 3RTYA
chains in the Genus database with same CATH superfamily
5FQJA 3P7NA 1K54A 4A5RA 4EWFA 5IT5A 3QP8A 3KX0X 4KZ5A 2ZMFA 1KE3A 1PI4A 4R70A 2HDRA 3MS6A 3O3VA 1OT9A 3OPLA 4GCZA 5BOHA 2W27A 5F68A 2FH5A 1K4EA 3HLWA 2K31A 5CX7A 2Z2LB 4UA9A 2V1AA 4RA7A 4H8RA 2X02A 4X55A 5CGXA 5KSCA 4PM8A 2OWJA 3IXDA 3RXWA 2HDUA 3NULA 4KQQA 1WYBA 2Z2MB 4S2MA 3UDIA 4E6XA 1KVMA 3DTIA 3GR2A 3GV9A 3C7UA 1YPRA 3C4OA 4GLQA 5KSHA 4JF4A 3E4OA 2HDQA 3T4LA 2B02A 4MBFA 3S7OA 3ZVTA 2JE5A 2V8FA 5G4ZA 3LIFA 3F1OA 2XD1A 2Y2KA 2JKTM 1YLWA 5HDSA 2W3DA 4Q0IA 2WK0A 3HLEA 2QJ5A 2L0WA 5AQ9A 2XLNA 2JBFA 5TFQA 1AWIA 5D3OA 3UE6A 4WMCD 4ID4A 4OP5A 3C7VA 4GDNA 4HEFA 1RCJA 2INWA 4OONA 2XD5A 2DMWA 2XH9A 4L9GA 3EQUA 3QP4A 1CI8A 3ZGAB 4JKTA 5DKLA 3WWXA 4I3IA 3UDXA 1Y28A 1F5MA 4BQMA 3PBTA 3UMEA 5F83A 1ERMA 1TS7A 5L09A 2Y2PA 3HLBA 3NBLA 4BLMA 1L0DA 3BQ8A 3D72A 3U2AA 3HJKA 3N4IA 1JNUA 4BBTA 4MLLA 4N1XA 3NJAA 2NUPC 2VZWA 3CI6A 2EA9A 3ZNYA 4WM9A 2HZ5A 5HPIA 4WMCA 4EESA 5FATA 4CQHA 3CJMA 2HDSA 3SS5A 1TD5A 1YAXA 4CJNA 4I5SA 4KUOA 4NEED 3VOZA 2LB5A 1SDNA 3E98A 3BLMA 3K3DA 4HESA 2Z6DA 5GHYA 5DFXA 5FI2A 2V0WA 2B95A 2VGLS 3MSHA 2K7SA 3SH9A 1DP8A 3Q1FA 3ZQ5A 2VGJA 1DP6A 3NIAA 1W63M 2OAP1 5GHZA 1JWPA 5HL6A 2XQZA 1NZOA 1D7EA 2QKPA 4QY6A 5E2EA 3O87A 4K0XA 1K25A 2W3HA 2A2LA 3E4PA 3MQQA 4EXOA 3H9WA 3BFGA 5FDSA 1MWUA 4IUKA 1N9BA 2E8IA 2BTFP 4Y15A 1I5QA 3PR6A 1IYQA 1IEMA 2WZZA 2K2NA 2ZC7A 3OOVA 2V9AA 3M6HA 4PM7A 4L0LA 4Y0UA 3LFVA 1LSXA 1ACFA 4KZBA 4R6LA 2PYPA 4U0XA 4ZTKA 3VFHA 2GJ3A 2I9VA 3ZDJA 1EI5A 5E2GA 2ZC5B 1VETB 3NCKA 2IA2A 3JYIA 3UB6A 1S4RA 4UQIS 4P6ZM 2KX6A 5L8MA 1VM1A 4GD6A 5MC7A 3F1PA 4JGQA 5CGWA 2C6WB 1XJ2A 1YLJA 4R0QA 1TDGA 2VV8A 3E4QA 3CHWP 4M3KA 1QMFA 5CXWA 2A3UA 3FZCA 3Q7ZA 5CEBA 3WS5A 3EEAA 1UWNX 1N4OA 4JGRA 3V39A 3FPVA 4Y7PA 2QHKA 1IKIA 5EVIA 3PBOA 4HH2A 4YOFA 2EFXA 4FUWA 1T18A 3MFXA 1D06A 1OT6A 5JYOA 1K55A 5EVEA 2EX2A 1BYWA 1GHMA 3G34A 3A3FA 2Y2IA 5TGFA 1ONHA 2CMNA 5DF7A 2V0UA 2QPNA 4S2NC 2J7VA 3O5YA 1RP5A 3BY8A 5FA7A 2OSUA 2BG1A 1S1YA 4WUJA 3M2JA 3A0SA 1IYPA 3BW6A 2G2WA 3IF6C 4LFUA 2Y2HA 3BRMA 1O7EA 3F1OB 4KENB 3OCLA 3GVBA 3IS2A 3LICA 1KE4A 3IX3A 1NWZA 5AVEA 5HDCA 2P9VA 3P09A 1SZVA 3Q81A 4E3KA 3S22A 5U47A 1YKDA 3FWLA 4KQRA 3TSGA 4QHCA 2WADA 2A49A 5E2HA 1VB6A 3DAVA 2M1CA 4JXWA 5EECA 4ZAMA 1VHMA 3A0RA 1KGGA 2Y79A 4L9EA 2D02A 4IBXA 1EROA 4GHIA 4OQGA 1CI9A 5AQAA 4EBPA 2WKRA 4RX3A 4IUHA 1MKMA 2KLIA 4Q0HA 3K3CA 3UPPA 5CTMA 4X25A 1IOUA 2P08A 2WGVA 4MEZA 2RL3A 4HJ6A 4DE1A 1XA7A 1IFQA 1BLCA 5HX9A 2ZOHA 1FCMA 3BEBA 3L7HA 4JXSA 3CUEC 1LSVA 3DWZA 4N92A 1E4DA 3UNWA 2PBDP 2QWSA 2PRFA 4PKYG 3LI9A 1Y4OA 4I38A 4BL3A 4MN5A 1ZHHB 3T4KA 4X6TA 3DTEA 1SKOA 1GA0A 3BQAA 2C5WB 3UB8A 5A93A 3A3JA 3GDIA 3HUOA 4IHQA 3LR5A 3OLOA 3EGXC 3KSGA 3L9KA 4Y5FA 3FC7A 5DVAA 2IWDA 4ZJ3A 2PD8A 5CEDA 4RX2A 4YINA 3N8LA 1P97A 5GLAA 4KQDA 4QPRA 4MCWA 5FQKA 2QYBA 4IBRA 4GNUA 3M2KA 3PTEA 4WF0A 4M4XA 1ALQA 1S6RA 4B93A 2PU2A 2HJEA 4GDBA 5G4YA 2ACGA 2Y2QA 4K91A 3BFFA 3LY4A 5FSRA 3NHQA 1V9ZA 5CHUA 1P9RA 1KGFA 4MN7A 2VKSA 1UWPX 2EX6A 1T1BA 2ZC3B 2P74A 2X71A 5TR7A 2H10A 4JBFA 4BBUA 4CLCD 2ZOIA 3KYQA 2XFTA 1WE4A 1W63Q 5TBMB 1YQSA 1S67L 1NJ4A 1OTDA 2WAFA 2FFYA 5FQQA 2EWVA 4GJ4A 4EEUA 1LI0A 1PZPA 3IQAA 3A3DA 3ZG7B 3E2KA 5EM0A 2VEAA 3EOIA 4IEDA 3IXHA 2JKGA 3N8RA 2EX9A 5FQ9A 3HLFA 3GQZA 3T1XA 1NLYA 4NKPA 3GRJA 4CLCC 3RJUA 4KZ3A 2PHYA 4WLAA 2CC1A 1TVFA 3F1PB 2IWCA 3LIAA 1S66L 3QP5A 4ME4A 1K6SA 1OPXA 2JC7A 4OPQA 2QJ7A 4GB7A 1ESUA 1MY8A 1N9LA 3UPNA 2R78A 3GSGA 4WZ4A 2QMIA 1NYYA 5A8BA 1TF1A 1TS8A 2BLSA 1YMXA 2HV1A 1DJBA 1TEMA 2Q9NA 3LO7A 4OQHA 4DJ2A 2J9OA 3UPOA 2L4RA 2WGWA 1TS6A 5EVIB 1OTAA 1DY6A 3OZHA 4PPRA 2XDMA 2PT7A 1G5UA 4ZRRA 4P6BA 2PYRA 3HVFA 1MWSA 3V5MA 3ZHHA 3BM6A 4NXEA 1EW0A 2ZM0A 2ZQAA 2HP9A 3HUNA 3HL9A 3Q7VA 1S0WA 1ZC2A 4KZAA 4E3IA 5EUAA 2VV7A 4BD1A 1PWCA 4DRTA 3NOUC 4MMNA 3HLDA 3LCEA 3ZG8B 2NUTC 4E6WA 4Y17A 2PAVP 3K2NA 5FASA 3E2LA 1J3WA 3OBFA 1L3LA 3WS2A 1YSPA 2JKTI 4C6YA 3CITA 4UA7A 4EQIA 4XUZA 5HARA 3ZG0A 4WELA 4OH0A 3IS2B 3UE3A 2JKRM 4LV1A 4LRZE 2P9VB 2WKPA 1S4SA 1GSXA 1G6AA 2M7UA 1LSWA 3UN7A 2VLGA 5IU1A 1JWVA 4BMWA 1YLPA 4HNBA 2JHEA 4EBNA 3KYZA 2YKFA 2GNXA 4AFIA 2WKEA 3MR0A 4UEYA 3DBAA 3HREA 4S2IA 4LPZA 1T1CA 3BYDA 1J9MA 3H7WA 3QNBA 2XFSA 4GHIB 2AVXA 4II7A 5A90A 1HLUP 3SH7A 3LEQA 3VSKA 5KMWA 4N9KA 4XT2A 3UO9A 2V20A 3CMZA 4F3LA 2ZM8A 2VGKA 1FR1A 2Y8HA 3CWFA 5F82A 2RCXA 3QP6A 4EV4A 1FIKA 2W3EA 4U0TA 1FSWA 5CHMA 3MXQA 1LL5A 1IELA 2A24A 2B18A 2V1ZA 3CPTA 4PAUA 5KZHA 1GHPA 2ZMAA 1SKOB 4X1MA 5F69A 3IWOA 1GA9A 4R1GA 1H8MA 4LGWA 4KQOA 5F1FA 1JWZA 5AQ7A 2J80A 1PW1A 2O9BA 3G2ZA 1KVLA 4XUXA 3HUMA 1K56D 2Z6CA 1FR6A 3SW1A 4LRXC 4OPRA 3RXXA 4YNRA 2W1TA 3TE8A 4MBHA 4QU3A 1DJAA 4PHTA 3N8SA 4RYEA 3GTCA 4QJGA 3VSLA 4ARZA 1PWGA 3WS4A 2XA7S 1YLZA 1SKFA 2KOIA 2WZXA 3M6BA 2LB9A 1OJ5A 2XEPA 3MZEA 4FSFA 4X69A 2B5RA 3BFCA 2HJ9C 1VEUA 1F98A 4R4SA 1L2SA 1YT4A 1PRQA 4X68A 2W3FA 1T1AA 1N9NA 4OOYA 4NXBA 2P7JA 1SDEA 1HZOA 4Y3IA 3B33A 4ETXA 4IVKA 3OCNA 1K38A 4OOLA 1JTDA 1E3UD 5DKKA 3CZDA 2HP5A 3MF0A 5I5LA 4MNRA 2ZQ9A 5LBRA 3MBZA 1P0ZA 1XGJA 5HAPA 3IBRA 2ZLYA 3EQVA 3UB9A 3FPWA 4HY8A 4KG2A 4JXVA 2OOLA 1ONGA 2Y4AA 1KDWA 4MBKA 2WKIA 5CHJA 3VE3A 3MMHA 4OVDA 1PFLA 1IYSA 5FAPA 1NRJA 4EW7A 4LCLA 1LT0A 2PR6A 4I39A 3UE0A 4C75A 1TDLA 5M18A 2VK3A 1H5XA 4FTXA 3QP1A 1GSWA 2V2FF 1VQQA 3ZVWA 2ZQ8A 4IJGA 5IS1A 4R4RA 1OTEA 1E3UA 2EX8A 4FD8A 3NC8A 4YWZA 5J7EA 4EBLA 1BT5A 3LUQA 1XGIA 2JCHA 2XF3A 2R9WA 4OLGA 3VP4A 1FCNA 4WZ5C 3MJQA 4S2NA 4GS9A 1U60A 4EETB 2OLVA 1MC0A 1HD8A 1FSYA 4E3JA 2VX8A 3NDEA 4JF6A 4ZJ2A 3JVUA 1W7FA 1GCEA 4FH4A 1XX2A 3VP1A 3CG5A 3IF6A 1V9YA 5HD3A 1ZKJA 3UY6A 3HJIA 4E3OA 4XXRA 2M7VA 3IBJA 4OP8A 2OV5A 1W8QA 3VE4A 4JGOA 4X1LA 2H0TA 2J3WA 1CJFA 2ZQDA 3PYPA 4NG2A 1PIOA 3D9YA 5DTKA 5EFWA 3VP0A 3T4SA 1BLHA 2UWXA 3SS4A 2JKFA 4EU0A 1YLTA 3QHYA 1M6KA 3FKVA 2DRWA 4ZBEA 1BLSA 2Y2JA 1UGUA 5FEGA 3V50A 2XR0A 4DE2A 4B9OA 2ZMVA 4GW9A 1D1JA 5AVFA 4BBVA 3VMAA 3ITBA 3W2ZA 4BWIA 2VV6A 2XSSA 4CLCE 2Y2GA 5M1AA 3IT9A 5DTTA 3HCYA 2Y2MA 1N9OA 4DDYA 3LR0A 2R9XA 3PXPA 2J9PA 4N9LA 4R3BA 4HJ4A 2Y59A 4S2KA 2FZ0A 5AQBA 2VGLM 2Y91A 3KO6A 3QNCA 4XT2B 3CUEA 4KG5A 4O7DA 1DJCA 1X0OA 4F3LB 1G68A 2VA0A 1W79A 3G2YA 1K57C 4KZ4A 3T1RA 5CTNA 1MBLA 1Y54A 5DF9A 1FCOA 1OMEA 3IH9A 4LLOB 1GHIA 2H5SA 4NETA 3DW0A 4D60A 2A24B 3CPTB 1K6RA 1ZTUA 4EQ1A 3UB7A 3C38A 5K5BA 4LENA 3VOYA 3BWLA 1XPBA 3W4QA 4WYYA 4Y13A 5KIZA 4KZ7A 2D01A 4ZJ1A 5DJUA 5G18A 3PAEA 4DJ3A 1RGZA 2XA7M 3H82A 1BSGA 4R38A 3G32A 2J3TC 4FH2A 4WL9A 1PNEA 2W1TB 5L2FA 1STZA 3S7NA 1M40A 3LIDA 3WS1A 1H8YA 4GOGA 1L0GA 4ARZB 3EEHA 2HPBA 4Z1WA 3FG8A 3W4OA 3LIEA 3NOPC 4UQIM 3PAGA 1TS0A 5EPHA 5HWVA 1W8YA 4DF6A 3UMDA 1VEUB 1K54C 2PD7A 4LCMA 1CEGA 4R3JA 3IWIA 1NXYA 4H6JA 2X01A 2L1MA 3F1NA 2ZQCA 3LI8A 1ODVA 5FI7A 1EWZA 2W3GA 1I2WA 1F2KA 5CECA 1FOFA 1Z6FA 4CLCA 1A0KA 4P87A 3A3IA 4JXGA 5HWWA 4P0MA 3Q82A 1KE0A 1CQAA 1YMSA 4HH3A 1JVJA 1CF0A 3ZYTA 4LV3A 4E3LA 2ZJ9A 3W8KA 3C2WA 3VFFA 3MKEA 1NYMA 1S1ZA 1YM1A 5FI6A 3LIBA 3V3SA 5CGSA 3MXRA 4MDZA 3V3RA 1PWDA 4BD0A 5E43A 2HGVA 2WAEA 1LLBA 4ESPA 4HI4A 3E0YA 3NECA 3DTMA 1YLYA 5FL3A 4QB8A 3TOIA 2EFUA 3IX8A 5HFOA 2MJ6A 5DTSA 1L0EA 5C5KA 2PU4A 3T4JA 4WBGA 1H8ZA 3C30A 3LGOA 5A91A 4I3JA 4KZ6A 4GS9B 1OTIA 5CERA 3B47A 3BFDA 5HW3A 3R7WA 2DNSA 3LR4A 5EOOA 4RQ9A 3KYEA 2W1RA 4WEJA 5JYPA 4S2LA 1LL8A 1MWRA 3I7JA 3VV4A 3IF6B 4YFMA 3HBRA 3PBNA 3A3EA 4DXCA 4Q8IA 5TJJA 3S1YA 3CAXA 4NK3A 3ICYA 1F9IA 2O9AA 3RH8B 1MZUA 4O8GA 1I2SA 3HLCA 1P9WA 3IWQA 3VP3A 4S2OA 1CK3A 2ZM2A 1NY0A 2G7UA 2JKRI 4LRYC 3IHAA 4DKIA 3RTYA 1XJ3A 2OWHA 5J3WA 4EERA 3MFDA 4U3TA 4OOMA 3VP2A 1ES5A 1ES3A 4GKUA 3T50A 4FCFA 2XGNA 5EVLA 1NLZA 3IXGA 5EOEA 4HQAA 3GMWA 4E3MA 1HVBA 1ES4A 1G6OA 3NI9A 3LEZA 1MWTA 1MPLA 2XRNA 2H28A 1SHVA 3R4KA 3LY3A 1Q2QA 1DP9A 4D2OA 3P01A 4BJPA 3T4QA 4BENA 3ZNTA 3FKWA 3TG9A 2PBYA 3ITAA 4P85A 2ZL1A 4EUZA 3WRTA 5J4EA 4QD4A 4NXFA 4B4ZA 4O0PA 2W0NA 1ERQA 1K0KA 5FEFA 2WGIA 4R23A 4GD8A 4OLDA 4DE0A 1Z09A 1NRFA 2FFFB 4JLFA 3TW8A 3C8CA 3DWKA 2GZAA 1H3QA 2ZD8A 1PYYA 3GECA 2ZC4B 4LV0A 1KOUA 5FDHA 4WN5A 1FQGA 4PMAA 3BLSA 3IH8A 3ZG9B 3BECA 2HP6A 3C5AA 1JTGA 2Y2NA 4OPYA 1XKZA 4N1HA 3QP2A 2Y2LA 4Y2FA 4X56A 5FAQA 4QWOA 4MN6A 1LI9A 5A92A 4EUVA 1LL9A 4GN2A 1O07A 4JF5A 3T1SA 2G2UA 3BY9A 5TBMA 4R3AA 3AGFA 4JGPA 4JPMA 5L07A 4LV2A 1XJ6A 3VOLA 3H82B 5FQMA 2JN7A 3RFBA 3KSIA 5EVID 4ZDXA 1PW8A 4PM9A 2V1BA 1K56A 2WKHA 4KZ9A 1GSVA 4HP4A 3FV7A 2PR5A 1FILA 3S4XA 3AGEA 2J8YA 5GHXA 4Y0TA 1XJ4A 5IHVA 2P04A 4EEPA 4B88A 2YKHA 1RGYA 4H6JB 3UDFA 3ZCZA 2XK1A 1XA1A 5AJGA 5HDDA 3F1NB 3G35A 5HPFA 5EVIC 1W5DA 4E04A 2GX5A 4Y0OA 3MKFA 5F1GA 4OQIA 2PDRA 4HBTA 3T1QB 1KDSA 4O01A 1K55C 5L10A 4CLCB 5GLDA 2Y2OA 1DRMA 4BL2A 3BJNA 5I94A 4E3NA 5HZHA 3S7PA 4UAAA 1C3BA 3AGDA 3ZG5A 4K08A 4S2PA 4HBUA 4CPKA 2Y55A 5EE8A 2H0YA 3T4TA 5CRFA 4PKYA 3W4PA 1WYCA 4KG6A 2WGWB 1OTBA 4DMZA 1WA9A 1PZOA 3MXSA 3PBSA 3G31A 5F5YA 3B42A 5HL1A 3KSFA 3Q7VB 3UB5P 4WZ5A 4UHUA 3JVVA 3O88A 3SZTA 4HJ3A 2QZ6A 1IKGA 3OPHA 4OQ0A 1BUEA 1OJGA 1SCWA 1QMEA 3IX4A 5FAOA 4FOFA 3PBRA 2GDNA 3O86A 3U4LP 2ZC6B 2EXBA 2EXAA 3D4FA 5E2FA 1ESIA 5GL9A 4G3WA 3G6OA 2OLUA 2Q9MA 3KSHA 3R7WB 3NY4A 4I3AA 4DE3A 1BLPA 4IVIA 1T19A 3OPPA 1L0FA 2VJWA 1NZUA 1BTLA 4OKPA 4PM5A 3IXBA 2ZQ7A 4Q0JA 4DDSA 2HF6A 3CLOA 3SOIA 1ES2A 4KUKA 3SH8A 3C4PA 5EV0A 5DF8A 1XP4A 3OC2A 3LR3A 2ZBBA 4KZ8A 5DFYA 5GLCA 3UE1A 2WUQA 1XFQA 4L9FA 1ZG4A 2O9CA 3B3XA 3OPRA 3MQ0A 3G30A 4HOIA 2IWBA 2BASA 3H7WB 3ZFZA 4OPZA 3IHBA 2OAQ1 1HTZA 3WS0A 1ZG6A 4WEKA 3P98A 5F6AA 3WRZA 3G4PA 4S2JA 3PHYA 1KGEA 1K4FA 2E8JA 3MZFA 3FYZA 3EWKA 3BFEA 1MKIA 1PI5A 4HP9A 2UV0E 1H0MA 3MQOA 3JPUA 3T12B 5HAIA 2J3TD 3N7WA 4ETZA 2Q0OA 3IF5A 1K57A 3DTKA 4G3VA 1XXMA 4QY5A 3NDGA 3T4OA 3N6IA 4K0WA 2I72A 2ZL1B 5J8XA 3MZDA 3A0VA 4UA6A 3V67A 4DN0A 1XFNA 3LYXA 1LHYA 5M19A 3EGDC 2WYXA 2WKQA 3S7QA 1E25A 3HLGA 3D3OA 5DJTA 5HD5A 4PM6A 3ISGA 4F94A 1G28A 1YSQA 5HSQA 3SS3A 1VETA 4HHDA 1AXBA 1IYOA 2XROA 5EM1A 2O99A 4Z9QA 4HIAA 4G3KA 3ULFA 5GLBA 3TJZC 1BULA 4B4XA 4X53A 1CEFA 2KDKA 2DCFA 1MXOA 2O0YA 5HAQA 3PBQA 1Q2PA 3TRCA 5HWTA 1BZAA 4C3QA 3NOTC 4RVAA 5FQIA 2EWWA 4GZBA 4DXBA 3Q07A 2V8CA 4P6ZS 4NXGA
chains in the Genus database with same CATH topology
1XJ3A 3P7NA 2OWHA 1IOUA 2P08A 5J3WA 4EERA 3MF0A 5I5LA 4OOMA 4HJ6A 5IT5A 5LBRA 3KX0X 1P0ZA 1IFQA 2ZMFA 3IBRA 3T50A 3EQVA 2ZOHA 3UB9A 3FPWA 4R70A 4GCZA 1OT9A 4HY8A 3CUEC 2OOLA 1LSVA 1NLZA 2W27A 5F68A 4HQAA 2FH5A 3VE3A 3MMHA 2K31A 1G6OA 2QWSA 5CX7A 4PKYG 1NRJA 2V1AA 3LI9A 4I38A 4MN5A 4EW7A 2XRNA 2H28A 1LT0A 1ZHHB 3R4KA 3T4KA 2OWJA 2PR6A 4I39A 1DP9A 3BQAA 3P01A 3UB8A 4BJPA 3T4QA 3GDIA 4IHQA 3LR5A 1GSWA 3OLOA 3EGXC 3KSGA 4Y5FA 3FC7A 5J4EA 4IJGA 5IS1A 4NXFA 1OTEA 2PD8A 4GLQA 5KSHA 3E4OA 4O0PA 3T4LA 4YWZA 2B02A 1P97A 2W0NA 5J7EA 4KQDA 4QPRA 4MCWA 3LUQA 3S7OA 2QYBA 5G4ZA 3MJQA 3LIFA 3F1OA 4GS9A 2JKTM 5HDSA 2W3DA 4WF0A 3TW8A 4Q0IA 4EETB 4M4XA 2QJ5A 3C8CA 4B93A 1MC0A 2L0WA 2GZAA 1H3QA 3GECA 2HJEA 1KOUA 2VX8A 5G4YA 4WN5A 3UE6A 3JVUA 3NHQA 1V9ZA 2INWA 2DMWA 1P9RA 4L9GA 3EQUA 4MN7A 1V9YA 5HD3A 4Y2FA 2VKSA 1UWPX 4MN6A 1T1BA 3HJIA 4EUVA 5DKLA 2M7VA 3IBJA 4I3IA 3BY9A 5TBMA 4R3AA 4BBUA 4CLCD 1Y28A 4JGPA 3VE4A 1F5MA 4JGOA 1XJ6A 2ZOIA 3VOLA 2J3WA 3KYQA 3PBTA 3PYPA 3UMEA 3H82B 2JN7A 1W63Q 5TBMB 1S67L 1OTDA 1TS7A 3RFBA 3KSIA 2EWVA 5EFWA 3T4SA 4GJ4A 4EEUA 4EU0A 2V1BA 3BQ8A 3D72A 3U2AA 1GSVA 3HJKA 1UGUA 2VEAA 3EOIA 4HP4A 1JNUA 4BBTA 4B9OA 2ZMVA 3NJAA 2NUPC 2VZWA 2PR5A 3CI6A 4GW9A 5AVFA 2EA9A 5HPIA 4BBVA 4EESA 1NLYA 4NKPA 3W2ZA 4BWIA 4CQHA 2VV6A 2XSSA 4CLCC 1XJ4A 4CLCE 2PHYA 4WLAA 1TD5A 1YAXA 2P04A 4EEPA 2YKHA 3HCYA 4I5SA 1N9OA 4H6JB 4KUOA 4NEED 3F1PB 3LR0A 3LIAA 1S66L 5AJGA 3PXPA 4ME4A 5HDDA 3F1NB 5HPFA 1OPXA 4HJ4A 2QJ7A 2LB5A 2FZ0A 1N9LA 2VGLM 2R78A 4E04A 2GX5A 3E98A 3KO6A 3K3DA 2Z6DA 2PDRA 5DFXA 4XT2B 2V0WA 3CUEA 5A8BA 2VGLS 1TF1A 1TS8A 4O01A 4CLCB 1DRMA 1X0OA 2HV1A 3BJNA 4F3LB 2VA0A 5HZHA 3S7PA 4DJ2A 2K7SA 1DP8A 2L4RA 1TS6A 3ZQ5A 4K08A 1OTAA 1DP6A 3T4TA 5DF9A 2PT7A 4ZRRA 4LLOB 1W63M 4PKYA 2PYRA 2OAP1 1OTBA 4DMZA 1WA9A 4NXEA 1EW0A 2A24B 3PBSA 5HL6A 5F5YA 3B42A 1D7EA 1ZTUA 2QKPA 4EQ1A 2VV7A 3C38A 3KSFA 3UB7A 3NOUC 5K5BA 4MMNA 3JVVA 4HJ3A 2W3HA 2A2LA 2NUTC 3BWLA 3E4PA 3MQQA 4EXOA 3K2NA 3H9WA 5KIZA 4IUKA 3OBFA 1OJGA 2D01A 1YSPA 5DJUA 2JKTI 3PR6A 4DJ3A 4FOFA 3CITA 3H82A 2XA7M 3OOVA 2K2NA 3PBRA 2V9AA 4R38A 2J3TC 4WL9A 4L0LA 3LFVA 2W1TB 1LSXA 1STZA 4WELA 3S7NA 4G3WA 3G6OA 3KSHA 3UE3A 3IS2B 3LIDA 3R7WB 4R6LA 4I3AA 2JKRM 2PYPA 4ARZB 1T19A 2GJ3A 2I9VA 4LRZE 3EEHA 2WKPA 1S4SA 1GSXA 4Z1WA 3FG8A 2VJWA 2M7UA 1LSWA 3LIEA 3NOPC 4UQIM 2VLGA 2IA2A 5IU1A 1TS0A 4Q0JA 5HWVA 4BMWA 2HF6A 3CLOA 3UB6A 4KUKA 1S4RA 3UMDA 4HNBA 2JHEA 4UQIS 4P6ZM 3KYZA 3OC2A 2PD7A 2YKFA 2KX6A 2GNXA 5L8MA 4AFIA 3MR0A 3LR3A 4UEYA 2ZBBA 3DBAA 5MC7A 5DFYA 4H6JA 4LPZA 3F1PA 1T1CA 2L1MA 4JGQA 3H7WA 1XFQA 3F1NA 4L9FA 3LI8A 4GHIB 4II7A 1ODVA 2O9CA 2W3GA 1XJ2A 3MQ0A 2VV8A 4HOIA 3E4QA 2BASA 3H7WB 4XT2A 4CLCA 2OAQ1 5HWWA 4F3LA 3EEAA 1UWNX 2Y8HA 4WEKA 4JGRA 3CWFA 5F6AA 3FPVA 3PHYA 2QHKA 3PBOA 4HH2A 4YOFA 4HH3A 3EWKA 1T18A 3MFXA 1D06A 1OT6A 2W3EA 4HP9A 3ZYTA 3MXQA 3C2WA 3MQOA 2A24A 2B18A 4PAUA 1S1ZA 2J3TD 4ETZA 3LIBA 1BYWA 4MDZA 2HGVA 4G3VA 5F69A 2CMNA 1H8MA 3T4OA 2V0UA 4HI4A 3E0YA 4KQOA 5FL3A 2J80A 3O5YA 3BY8A 2O9BA 3A0VA 3V67A 2MJ6A 4DN0A 1XFNA 3LYXA 1S1YA 3EGDC 4WUJA 2WKQA 2Z6CA 3A0SA 5C5KA 3SW1A 3BW6A 3T4JA 3S7QA 4LRXC 3D3OA 5DJTA 5HD5A 3C30A 4YNRA 2W1TA 4I3JA 3F1OB 1G28A 4GS9B 1OTIA 3OCLA 3TE8A 3B47A 1YSQA 3IS2A 4PHTA 3LICA 3R7WA 3LR4A 4RQ9A 1NWZA 5AVEA 4ARZA 5HSQA 5HDCA 2XA7S 2W1RA 4WEJA 2KOIA 1LL8A 4HHDA 2LB9A 1OJ5A 2XROA 2O99A 1YKDA 4FSFA 3VV4A 4HIAA 4G3KA 3ULFA 3TJZC 2HJ9C 2KDKA 3PBNA 1F98A 1VB6A 5TJJA 2O0YA 2M1CA 3PBQA 3CAXA 3TRCA 5HWTA 2W3FA 1VHMA 3ICYA 1T1AA 1F9IA 2O9AA 3NOTC 3A0RA 3RH8B 1N9NA 1MZUA 4NXBA 2P7JA 4O8GA 2Y79A 4L9EA 2EWWA 2D02A 4Y3IA 3B33A 4ETXA 1P9WA 4GHIA 3OCNA 4OOLA 2G7UA 2WKRA 4IUHA 1MKMA 2JKRI 4LRYC 4NXGA 4P6ZS 2KLIA 5DKKA 4Q0HA 3K3CA 3RTYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XJ3 A;  3P7N A;  2OWH A;  5J3W A;  4EER A;  5I5L A;  4HJ6 A;  3KX0 X;  1P0Z A;  3IBR A;  3T50 A;  2ZOH A;  3UB9 A;  4R70 A;  4GCZ A;  1OT9 A;  4HY8 A;  2OOL A;  1LSV A;  2W27 A;  5F68 A;  4HQA A;  3VE3 A;  2QWS A;  4PKY G;  2V1A A;  3LI9 A;  4I38 A;  4MN5 A;  4EW7 A;  2H28 A;  1LT0 A;  2OWJ A;  2PR6 A;  4I39 A;  1DP9 A;  3UB8 A;  3GDI A;  1GSW A;  3OLO A;  3FC7 A;  5J4E A;  5IS1 A;  4NXF A;  1OTE A;  2PD8 A;  3E4O A;  4YWZ A;  2B02 A;  1P97 A;  2W0N A;  5J7E A;  4KQD A;  3LUQ A;  5G4Z A;  3MJQ A;  3LIF A;  3F1O A;  4GS9 A;  5HDS A;  4WF0 A;  4EET B;  4M4X A;  2QJ5 A;  3C8C A;  2L0W A;  3GEC A;  1KOU A;  5G4Y A;  4WN5 A;  3UE6 A;  3NHQ A;  1V9Z A;  2INW A;  4L9G A;  1V9Y A;  5HD3 A;  1UWP X;  4MN6 A;  1T1B A;  3HJI A;  5DKL A;  4I3I A;  3BY9 A;  5TBM A;  4R3A A;  4BBU A;  1Y28 A;  4JGP A;  3VE4 A;  4JGO A;  1XJ6 A;  2ZOI A;  3VOL A;  3PYP A;  3UME A;  3H82 B;  2JN7 A;  5TBM B;  1S67 L;  1OTD A;  1TS7 A;  5EFW A;  4EEU A;  2V1B A;  3D72 A;  1GSV A;  3HJK A;  1UGU A;  2VEA A;  4HP4 A;  1JNU A;  4BBT A;  4B9O A;  3NJA A;  2PR5 A;  4GW9 A;  5AVF A;  2EA9 A;  4BBV A;  4EES A;  2VV6 A;  1XJ4 A;  2PHY A;  4WLA A;  4EEP A;  2YKH A;  4I5S A;  1N9O A;  4H6J B;  4KUO A;  3F1P B;  3LIA A;  1S66 L;  5HDD A;  3F1N B;  4HJ4 A;  2QJ7 A;  1N9L A;  2R78 A;  4E04 A;  3K3D A;  2Z6D A;  2PDR A;  4XT2 B;  2V0W A;  5A8B A;  1TS8 A;  1DRM A;  1X0O A;  2HV1 A;  4F3L B;  5HZH A;  4DJ2 A;  2K7S A;  1DP8 A;  2L4R A;  1TS6 A;  3ZQ5 A;  4K08 A;  1OTA A;  1DP6 A;  4LLO B;  4PKY A;  2PYR A;  1OTB A;  1WA9 A;  4NXE A;  1EW0 A;  2A24 B;  5F5Y A;  1D7E A;  2QKP A;  4EQ1 A;  2VV7 A;  3UB7 A;  3NOU C;  4HJ3 A;  3BWL A;  3E4P A;  3MQQ A;  4EXO A;  3H9W A;  5KIZ A;  1OJG A;  2D01 A;  5DJU A;  4DJ3 A;  3H82 A;  2V9A A;  4R38 A;  4WL9 A;  1LSX A;  3G6O A;  3IS2 B;  3LID A;  4R6L A;  4I3A A;  2PYP A;  1T19 A;  2GJ3 A;  2I9V A;  4LRZ E;  3EEH A;  2WKP A;  1S4S A;  1GSX A;  3FG8 A;  1LSW A;  3LIE A;  3NOP C;  2VLG A;  5IU1 A;  1TS0 A;  5HWV A;  3CLO A;  3UB6 A;  4KUK A;  1S4R A;  3UMD A;  4HNB A;  2JHE A;  2PD7 A;  2YKF A;  2KX6 A;  3MR0 A;  2ZBB A;  4H6J A;  4LPZ A;  3F1P A;  1T1C A;  2L1M A;  4JGQ A;  3H7W A;  1XFQ A;  3F1N A;  4L9F A;  3LI8 A;  4GHI B;  1ODV A;  1XJ2 A;  2VV8 A;  4HOI A;  3E4Q A;  2BAS A;  3H7W B;  4XT2 A;  5HWW A;  4F3L A;  1UWN X;  4JGR A;  3CWF A;  5F6A A;  3PHY A;  2QHK A;  4HH2 A;  4HH3 A;  3EWK A;  1T18 A;  3MFX A;  1D06 A;  1OT6 A;  4HP9 A;  3MXQ A;  3C2W A;  3MQO A;  2A24 A;  1S1Z A;  3LIB A;  1BYW A;  5F69 A;  2CMN A;  2V0U A;  4HI4 A;  2J80 A;  3BY8 A;  3A0V A;  1XFN A;  3LYX A;  1S1Y A;  4WUJ A;  2WKQ A;  2Z6C A;  3A0S A;  3SW1 A;  4LRX C;  5DJT A;  5HD5 A;  4I3J A;  3F1O B;  1G28 A;  4GS9 B;  1OTI A;  3IS2 A;  3LIC A;  4RQ9 A;  1NWZ A;  5AVE A;  5HSQ A;  5HDC A;  1LL8 A;  4HHD A;  1OJ5 A;  4HIA A;  3ULF A;  2KDK A;  1F98 A;  1VB6 A;  2M1C A;  3CAX A;  5HWT A;  3ICY A;  1T1A A;  1F9I A;  3NOT C;  3A0R A;  3RH8 B;  1N9N A;  1MZU A;  4NXB A;  2P7J A;  4L9E A;  2D02 A;  3B33 A;  4GHI A;  2WKR A;  4NXG A;  4LRY C;  5DKK A;  3K3C A;  3RTY A; 
#chains in the Genus database with same CATH topology
 5FQJ A;  3P7N A;  1K54 A;  4A5R A;  4EWF A;  5IT5 A;  3QP8 A;  3KX0 X;  4KZ5 A;  2ZMF A;  1KE3 A;  1PI4 A;  4R70 A;  2HDR A;  3MS6 A;  3O3V A;  1OT9 A;  3OPL A;  4GCZ A;  5BOH A;  2W27 A;  5F68 A;  2FH5 A;  1K4E A;  3HLW A;  2K31 A;  5CX7 A;  2Z2L B;  4UA9 A;  2V1A A;  4RA7 A;  4H8R A;  2X02 A;  4X55 A;  5CGX A;  5KSC A;  4PM8 A;  2OWJ A;  3IXD A;  3RXW A;  2HDU A;  3NUL A;  4KQQ A;  1WYB A;  2Z2M B;  4S2M A;  3UDI A;  4E6X A;  1KVM A;  3DTI A;  3GR2 A;  3GV9 A;  3C7U A;  1YPR A;  3C4O A;  4GLQ A;  5KSH A;  4JF4 A;  3E4O A;  2HDQ A;  3T4L A;  2B02 A;  4MBF A;  3S7O A;  3ZVT A;  2JE5 A;  2V8F A;  5G4Z A;  3LIF A;  3F1O A;  2XD1 A;  2Y2K A;  2JKT M;  1YLW A;  5HDS A;  2W3D A;  4Q0I A;  2WK0 A;  3HLE A;  2QJ5 A;  2L0W A;  5AQ9 A;  2XLN A;  2JBF A;  5TFQ A;  1AWI A;  5D3O A;  3UE6 A;  4WMC D;  4ID4 A;  4OP5 A;  3C7V A;  4GDN A;  4HEF A;  1RCJ A;  2INW A;  4OON A;  2XD5 A;  2DMW A;  2XH9 A;  4L9G A;  3EQU A;  3QP4 A;  1CI8 A;  3ZGA B;  4JKT A;  5DKL A;  3WWX A;  4I3I A;  3UDX A;  1Y28 A;  1F5M A;  4BQM A;  3PBT A;  3UME A;  5F83 A;  1ERM A;  1TS7 A;  5L09 A;  2Y2P A;  3HLB A;  3NBL A;  4BLM A;  1L0D A;  3BQ8 A;  3D72 A;  3U2A A;  3HJK A;  3N4I A;  1JNU A;  4BBT A;  4MLL A;  4N1X A;  3NJA A;  2NUP C;  2VZW A;  3CI6 A;  2EA9 A;  3ZNY A;  4WM9 A;  2HZ5 A;  5HPI A;  4WMC A;  4EES A;  5FAT A;  4CQH A;  3CJM A;  2HDS A;  3SS5 A;  1TD5 A;  1YAX A;  4CJN A;  4I5S A;  4KUO A;  4NEE D;  3VOZ A;  2LB5 A;  1SDN A;  3E98 A;  3BLM A;  3K3D A;  4HES A;  2Z6D A;  5GHY A;  5DFX A;  5FI2 A;  2V0W A;  2B95 A;  2VGL S;  3MSH A;  2K7S A;  3SH9 A;  1DP8 A;  3Q1F A;  3ZQ5 A;  2VGJ A;  1DP6 A;  3NIA A;  1W63 M;  2OAP 1;  5GHZ A;  1JWP A;  5HL6 A;  2XQZ A;  1NZO A;  1D7E A;  2QKP A;  4QY6 A;  5E2E A;  3O87 A;  4K0X A;  1K25 A;  2W3H A;  2A2L A;  3E4P A;  3MQQ A;  4EXO A;  3H9W A;  3BFG A;  5FDS A;  1MWU A;  4IUK A;  1N9B A;  2E8I A;  2BTF P;  4Y15 A;  1I5Q A;  3PR6 A;  1IYQ A;  1IEM A;  2WZZ A;  2K2N A;  2ZC7 A;  3OOV A;  2V9A A;  3M6H A;  4PM7 A;  4L0L A;  4Y0U A;  3LFV A;  1LSX A;  1ACF A;  4KZB A;  4R6L A;  2PYP A;  4U0X A;  4ZTK A;  3VFH A;  2GJ3 A;  2I9V A;  3ZDJ A;  1EI5 A;  5E2G A;  2ZC5 B;  1VET B;  3NCK A;  2IA2 A;  3JYI A;  3UB6 A;  1S4R A;  4UQI S;  4P6Z M;  2KX6 A;  5L8M A;  1VM1 A;  4GD6 A;  5MC7 A;  3F1P A;  4JGQ A;  5CGW A;  2C6W B;  1XJ2 A;  1YLJ A;  4R0Q A;  1TDG A;  2VV8 A;  3E4Q A;  3CHW P;  4M3K A;  1QMF A;  5CXW A;  2A3U A;  3FZC A;  3Q7Z A;  5CEB A;  3WS5 A;  3EEA A;  1UWN X;  1N4O A;  4JGR A;  3V39 A;  3FPV A;  4Y7P A;  2QHK A;  1IKI A;  5EVI A;  3PBO A;  4HH2 A;  4YOF A;  2EFX A;  4FUW A;  1T18 A;  3MFX A;  1D06 A;  1OT6 A;  5JYO A;  1K55 A;  5EVE A;  2EX2 A;  1BYW A;  1GHM A;  3G34 A;  3A3F A;  2Y2I A;  5TGF A;  1ONH A;  2CMN A;  5DF7 A;  2V0U A;  2QPN A;  4S2N C;  2J7V A;  3O5Y A;  1RP5 A;  3BY8 A;  5FA7 A;  2OSU A;  2BG1 A;  1S1Y A;  4WUJ A;  3M2J A;  3A0S A;  1IYP A;  3BW6 A;  2G2W A;  3IF6 C;  4LFU A;  2Y2H A;  3BRM A;  1O7E A;  3F1O B;  4KEN B;  3OCL A;  3GVB A;  3IS2 A;  3LIC A;  1KE4 A;  3IX3 A;  1NWZ A;  5AVE A;  5HDC A;  2P9V A;  3P09 A;  1SZV A;  3Q81 A;  4E3K A;  3S22 A;  5U47 A;  1YKD A;  3FWL A;  4KQR A;  3TSG A;  4QHC A;  2WAD A;  2A49 A;  5E2H A;  1VB6 A;  3DAV A;  2M1C A;  4JXW A;  5EEC A;  4ZAM A;  1VHM A;  3A0R A;  1KGG A;  2Y79 A;  4L9E A;  2D02 A;  4IBX A;  1ERO A;  4GHI A;  4OQG A;  1CI9 A;  5AQA A;  4EBP A;  2WKR A;  4RX3 A;  4IUH A;  1MKM A;  2KLI A;  4Q0H A;  3K3C A;  3UPP A;  5CTM A;  4X25 A;  1IOU A;  2P08 A;  2WGV A;  4MEZ A;  2RL3 A;  4HJ6 A;  4DE1 A;  1XA7 A;  1IFQ A;  1BLC A;  5HX9 A;  2ZOH A;  1FCM A;  3BEB A;  3L7H A;  4JXS A;  3CUE C;  1LSV A;  3DWZ A;  4N92 A;  1E4D A;  3UNW A;  2PBD P;  2QWS A;  2PRF A;  4PKY G;  3LI9 A;  1Y4O A;  4I38 A;  4BL3 A;  4MN5 A;  1ZHH B;  3T4K A;  4X6T A;  3DTE A;  1SKO A;  1GA0 A;  3BQA A;  2C5W B;  3UB8 A;  5A93 A;  3A3J A;  3GDI A;  3HUO A;  4IHQ A;  3LR5 A;  3OLO A;  3EGX C;  3KSG A;  3L9K A;  4Y5F A;  3FC7 A;  5DVA A;  2IWD A;  4ZJ3 A;  2PD8 A;  5CED A;  4RX2 A;  4YIN A;  3N8L A;  1P97 A;  5GLA A;  4KQD A;  4QPR A;  4MCW A;  5FQK A;  2QYB A;  4IBR A;  4GNU A;  3M2K A;  3PTE A;  4WF0 A;  4M4X A;  1ALQ A;  1S6R A;  4B93 A;  2PU2 A;  2HJE A;  4GDB A;  5G4Y A;  2ACG A;  2Y2Q A;  4K91 A;  3BFF A;  3LY4 A;  5FSR A;  3NHQ A;  1V9Z A;  5CHU A;  1P9R A;  1KGF A;  4MN7 A;  2VKS A;  1UWP X;  2EX6 A;  1T1B A;  2ZC3 B;  2P74 A;  2X71 A;  5TR7 A;  2H10 A;  4JBF A;  4BBU A;  4CLC D;  2ZOI A;  3KYQ A;  2XFT A;  1WE4 A;  1W63 Q;  5TBM B;  1YQS A;  1S67 L;  1NJ4 A;  1OTD A;  2WAF A;  2FFY A;  5FQQ A;  2EWV A;  4GJ4 A;  4EEU A;  1LI0 A;  1PZP A;  3IQA A;  3A3D A;  3ZG7 B;  3E2K A;  5EM0 A;  2VEA A;  3EOI A;  4IED A;  3IXH A;  2JKG A;  3N8R A;  2EX9 A;  5FQ9 A;  3HLF A;  3GQZ A;  3T1X A;  1NLY A;  4NKP A;  3GRJ A;  4CLC C;  3RJU A;  4KZ3 A;  2PHY A;  4WLA A;  2CC1 A;  1TVF A;  3F1P B;  2IWC A;  3LIA A;  1S66 L;  3QP5 A;  4ME4 A;  1K6S A;  1OPX A;  2JC7 A;  4OPQ A;  2QJ7 A;  4GB7 A;  1ESU A;  1MY8 A;  1N9L A;  3UPN A;  2R78 A;  3GSG A;  4WZ4 A;  2QMI A;  1NYY A;  5A8B A;  1TF1 A;  1TS8 A;  2BLS A;  1YMX A;  2HV1 A;  1DJB A;  1TEM A;  2Q9N A;  3LO7 A;  4OQH A;  4DJ2 A;  2J9O A;  3UPO A;  2L4R A;  2WGW A;  1TS6 A;  5EVI B;  1OTA A;  1DY6 A;  3OZH A;  4PPR A;  2XDM A;  2PT7 A;  1G5U A;  4ZRR A;  4P6B A;  2PYR A;  3HVF A;  1MWS A;  3V5M A;  3ZHH A;  3BM6 A;  4NXE A;  1EW0 A;  2ZM0 A;  2ZQA A;  2HP9 A;  3HUN A;  3HL9 A;  3Q7V A;  1S0W A;  1ZC2 A;  4KZA A;  4E3I A;  5EUA A;  2VV7 A;  4BD1 A;  1PWC A;  4DRT A;  3NOU C;  4MMN A;  3HLD A;  3LCE A;  3ZG8 B;  2NUT C;  4E6W A;  4Y17 A;  2PAV P;  3K2N A;  5FAS A;  3E2L A;  1J3W A;  3OBF A;  1L3L A;  3WS2 A;  1YSP A;  2JKT I;  4C6Y A;  3CIT A;  4UA7 A;  4EQI A;  4XUZ A;  5HAR A;  3ZG0 A;  4WEL A;  4OH0 A;  3IS2 B;  3UE3 A;  2JKR M;  4LV1 A;  4LRZ E;  2P9V B;  2WKP A;  1S4S A;  1GSX A;  1G6A A;  2M7U A;  1LSW A;  3UN7 A;  2VLG A;  5IU1 A;  1JWV A;  4BMW A;  1YLP A;  4HNB A;  2JHE A;  4EBN A;  3KYZ A;  2YKF A;  2GNX A;  4AFI A;  2WKE A;  3MR0 A;  4UEY A;  3DBA A;  3HRE A;  4S2I A;  4LPZ A;  1T1C A;  3BYD A;  1J9M A;  3H7W A;  3QNB A;  2XFS A;  4GHI B;  2AVX A;  4II7 A;  5A90 A;  1HLU P;  3SH7 A;  3LEQ A;  3VSK A;  5KMW A;  4N9K A;  4XT2 A;  3UO9 A;  2V20 A;  3CMZ A;  4F3L A;  2ZM8 A;  2VGK A;  1FR1 A;  2Y8H A;  3CWF A;  5F82 A;  2RCX A;  3QP6 A;  4EV4 A;  1FIK A;  2W3E A;  4U0T A;  1FSW A;  5CHM A;  3MXQ A;  1LL5 A;  1IEL A;  2A24 A;  2B18 A;  2V1Z A;  3CPT A;  4PAU A;  5KZH A;  1GHP A;  2ZMA A;  1SKO B;  4X1M A;  5F69 A;  3IWO A;  1GA9 A;  4R1G A;  1H8M A;  4LGW A;  4KQO A;  5F1F A;  1JWZ A;  5AQ7 A;  2J80 A;  1PW1 A;  2O9B A;  3G2Z A;  1KVL A;  4XUX A;  3HUM A;  1K56 D;  2Z6C A;  1FR6 A;  3SW1 A;  4LRX C;  4OPR A;  3RXX A;  4YNR A;  2W1T A;  3TE8 A;  4MBH A;  4QU3 A;  1DJA A;  4PHT A;  3N8S A;  4RYE A;  3GTC A;  4QJG A;  3VSL A;  4ARZ A;  1PWG A;  3WS4 A;  2XA7 S;  1YLZ A;  1SKF A;  2KOI A;  2WZX A;  3M6B A;  2LB9 A;  1OJ5 A;  2XEP A;  3MZE A;  4FSF A;  4X69 A;  2B5R A;  3BFC A;  2HJ9 C;  1VEU A;  1F98 A;  4R4S A;  1L2S A;  1YT4 A;  1PRQ A;  4X68 A;  2W3F A;  1T1A A;  1N9N A;  4OOY A;  4NXB A;  2P7J A;  1SDE A;  1HZO A;  4Y3I A;  3B33 A;  4ETX A;  4IVK A;  3OCN A;  1K38 A;  4OOL A;  1JTD A;  1E3U D;  5DKK A;  3CZD A;  2HP5 A;  3MF0 A;  5I5L A;  4MNR A;  2ZQ9 A;  5LBR A;  3MBZ A;  1P0Z A;  1XGJ A;  5HAP A;  3IBR A;  2ZLY A;  3EQV A;  3UB9 A;  3FPW A;  4HY8 A;  4KG2 A;  4JXV A;  2OOL A;  1ONG A;  2Y4A A;  1KDW A;  4MBK A;  2WKI A;  5CHJ A;  3VE3 A;  3MMH A;  4OVD A;  1PFL A;  1IYS A;  5FAP A;  1NRJ A;  4EW7 A;  4LCL A;  1LT0 A;  2PR6 A;  4I39 A;  3UE0 A;  4C75 A;  1TDL A;  5M18 A;  2VK3 A;  1H5X A;  4FTX A;  3QP1 A;  1GSW A;  2V2F F;  1VQQ A;  3ZVW A;  2ZQ8 A;  4IJG A;  5IS1 A;  4R4R A;  1OTE A;  1E3U A;  2EX8 A;  4FD8 A;  3NC8 A;  4YWZ A;  5J7E A;  4EBL A;  1BT5 A;  3LUQ A;  1XGI A;  2JCH A;  2XF3 A;  2R9W A;  4OLG A;  3VP4 A;  1FCN A;  4WZ5 C;  3MJQ A;  4S2N A;  4GS9 A;  1U60 A;  4EET B;  2OLV A;  1MC0 A;  1HD8 A;  1FSY A;  4E3J A;  2VX8 A;  3NDE A;  4JF6 A;  4ZJ2 A;  3JVU A;  1W7F A;  1GCE A;  4FH4 A;  1XX2 A;  3VP1 A;  3CG5 A;  3IF6 A;  1V9Y A;  5HD3 A;  1ZKJ A;  3UY6 A;  3HJI A;  4E3O A;  4XXR A;  2M7V A;  3IBJ A;  4OP8 A;  2OV5 A;  1W8Q A;  3VE4 A;  4JGO A;  4X1L A;  2H0T A;  2J3W A;  1CJF A;  2ZQD A;  3PYP A;  4NG2 A;  1PIO A;  3D9Y A;  5DTK A;  5EFW A;  3VP0 A;  3T4S A;  1BLH A;  2UWX A;  3SS4 A;  2JKF A;  4EU0 A;  1YLT A;  3QHY A;  1M6K A;  3FKV A;  2DRW A;  4ZBE A;  1BLS A;  2Y2J A;  1UGU A;  5FEG A;  3V50 A;  2XR0 A;  4DE2 A;  4B9O A;  2ZMV A;  4GW9 A;  1D1J A;  5AVF A;  4BBV A;  3VMA A;  3ITB A;  3W2Z A;  4BWI A;  2VV6 A;  2XSS A;  4CLC E;  2Y2G A;  5M1A A;  3IT9 A;  5DTT A;  3HCY A;  2Y2M A;  1N9O A;  4DDY A;  3LR0 A;  2R9X A;  3PXP A;  2J9P A;  4N9L A;  4R3B A;  4HJ4 A;  2Y59 A;  4S2K A;  2FZ0 A;  5AQB A;  2VGL M;  2Y91 A;  3KO6 A;  3QNC A;  4XT2 B;  3CUE A;  4KG5 A;  4O7D A;  1DJC A;  1X0O A;  4F3L B;  1G68 A;  2VA0 A;  1W79 A;  3G2Y A;  1K57 C;  4KZ4 A;  3T1R A;  5CTN A;  1MBL A;  1Y54 A;  5DF9 A;  1FCO A;  1OME A;  3IH9 A;  4LLO B;  1GHI A;  2H5S A;  4NET A;  3DW0 A;  4D60 A;  2A24 B;  3CPT B;  1K6R A;  1ZTU A;  4EQ1 A;  3UB7 A;  3C38 A;  5K5B A;  4LEN A;  3VOY A;  3BWL A;  1XPB A;  3W4Q A;  4WYY A;  4Y13 A;  5KIZ A;  4KZ7 A;  2D01 A;  4ZJ1 A;  5DJU A;  5G18 A;  3PAE A;  4DJ3 A;  1RGZ A;  2XA7 M;  3H82 A;  1BSG A;  4R38 A;  3G32 A;  2J3T C;  4FH2 A;  4WL9 A;  1PNE A;  2W1T B;  5L2F A;  1STZ A;  3S7N A;  1M40 A;  3LID A;  3WS1 A;  1H8Y A;  4GOG A;  1L0G A;  4ARZ B;  3EEH A;  2HPB A;  4Z1W A;  3FG8 A;  3W4O A;  3LIE A;  3NOP C;  4UQI M;  3PAG A;  1TS0 A;  5EPH A;  5HWV A;  1W8Y A;  4DF6 A;  3UMD A;  1VEU B;  1K54 C;  2PD7 A;  4LCM A;  1CEG A;  4R3J A;  3IWI A;  1NXY A;  4H6J A;  2X01 A;  2L1M A;  3F1N A;  2ZQC A;  3LI8 A;  1ODV A;  5FI7 A;  1EWZ A;  2W3G A;  1I2W A;  1F2K A;  5CEC A;  1FOF A;  1Z6F A;  4CLC A;  1A0K A;  4P87 A;  3A3I A;  4JXG A;  5HWW A;  4P0M A;  3Q82 A;  1KE0 A;  1CQA A;  1YMS A;  4HH3 A;  1JVJ A;  1CF0 A;  3ZYT A;  4LV3 A;  4E3L A;  2ZJ9 A;  3W8K A;  3C2W A;  3VFF A;  3MKE A;  1NYM A;  1S1Z A;  1YM1 A;  5FI6 A;  3LIB A;  3V3S A;  5CGS A;  3MXR A;  4MDZ A;  3V3R A;  1PWD A;  4BD0 A;  5E43 A;  2HGV A;  2WAE A;  1LLB A;  4ESP A;  4HI4 A;  3E0Y A;  3NEC A;  3DTM A;  1YLY A;  5FL3 A;  4QB8 A;  3TOI A;  2EFU A;  3IX8 A;  5HFO A;  2MJ6 A;  5DTS A;  1L0E A;  5C5K A;  2PU4 A;  3T4J A;  4WBG A;  1H8Z A;  3C30 A;  3LGO A;  5A91 A;  4I3J A;  4KZ6 A;  4GS9 B;  1OTI A;  5CER A;  3B47 A;  3BFD A;  5HW3 A;  3R7W A;  2DNS A;  3LR4 A;  5EOO A;  4RQ9 A;  3KYE A;  2W1R A;  4WEJ A;  5JYP A;  4S2L A;  1LL8 A;  1MWR A;  3I7J A;  3VV4 A;  3IF6 B;  4YFM A;  3HBR A;  3PBN A;  3A3E A;  4DXC A;  4Q8I A;  5TJJ A;  3S1Y A;  3CAX A;  4NK3 A;  3ICY A;  1F9I A;  2O9A A;  3RH8 B;  1MZU A;  4O8G A;  1I2S A;  3HLC A;  1P9W A;  3IWQ A;  3VP3 A;  4S2O A;  1CK3 A;  2ZM2 A;  1NY0 A;  2G7U A;  2JKR I;  4LRY C;  3IHA A;  4DKI A;  3RTY A;  1XJ3 A;  2OWH A;  5J3W A;  4EER A;  3MFD A;  4U3T A;  4OOM A;  3VP2 A;  1ES5 A;  1ES3 A;  4GKU A;  3T50 A;  4FCF A;  2XGN A;  5EVL A;  1NLZ A;  3IXG A;  5EOE A;  4HQA A;  3GMW A;  4E3M A;  1HVB A;  1ES4 A;  1G6O A;  3NI9 A;  3LEZ A;  1MWT A;  1MPL A;  2XRN A;  2H28 A;  1SHV A;  3R4K A;  3LY3 A;  1Q2Q A;  1DP9 A;  4D2O A;  3P01 A;  4BJP A;  3T4Q A;  4BEN A;  3ZNT A;  3FKW A;  3TG9 A;  2PBY A;  3ITA A;  4P85 A;  2ZL1 A;  4EUZ A;  3WRT A;  5J4E A;  4QD4 A;  4NXF A;  4B4Z A;  4O0P A;  2W0N A;  1ERQ A;  1K0K A;  5FEF A;  2WGI A;  4R23 A;  4GD8 A;  4OLD A;  4DE0 A;  1Z09 A;  1NRF A;  2FFF B;  4JLF A;  3TW8 A;  3C8C A;  3DWK A;  2GZA A;  1H3Q A;  2ZD8 A;  1PYY A;  3GEC A;  2ZC4 B;  4LV0 A;  1KOU A;  5FDH A;  4WN5 A;  1FQG A;  4PMA A;  3BLS A;  3IH8 A;  3ZG9 B;  3BEC A;  2HP6 A;  3C5A A;  1JTG A;  2Y2N A;  4OPY A;  1XKZ A;  4N1H A;  3QP2 A;  2Y2L A;  4Y2F A;  4X56 A;  5FAQ A;  4QWO A;  4MN6 A;  1LI9 A;  5A92 A;  4EUV A;  1LL9 A;  4GN2 A;  1O07 A;  4JF5 A;  3T1S A;  2G2U A;  3BY9 A;  5TBM A;  4R3A A;  3AGF A;  4JGP A;  4JPM A;  5L07 A;  4LV2 A;  1XJ6 A;  3VOL A;  3H82 B;  5FQM A;  2JN7 A;  3RFB A;  3KSI A;  5EVI D;  4ZDX A;  1PW8 A;  4PM9 A;  2V1B A;  1K56 A;  2WKH A;  4KZ9 A;  1GSV A;  4HP4 A;  3FV7 A;  2PR5 A;  1FIL A;  3S4X A;  3AGE A;  2J8Y A;  5GHX A;  4Y0T A;  1XJ4 A;  5IHV A;  2P04 A;  4EEP A;  4B88 A;  2YKH A;  1RGY A;  4H6J B;  3UDF A;  3ZCZ A;  2XK1 A;  1XA1 A;  5AJG A;  5HDD A;  3F1N B;  3G35 A;  5HPF A;  5EVI C;  1W5D A;  4E04 A;  2GX5 A;  4Y0O A;  3MKF A;  5F1G A;  4OQI A;  2PDR A;  4HBT A;  3T1Q B;  1KDS A;  4O01 A;  1K55 C;  5L10 A;  4CLC B;  5GLD A;  2Y2O A;  1DRM A;  4BL2 A;  3BJN A;  5I94 A;  4E3N A;  5HZH A;  3S7P A;  4UAA A;  1C3B A;  3AGD A;  3ZG5 A;  4K08 A;  4S2P A;  4HBU A;  4CPK A;  2Y55 A;  5EE8 A;  2H0Y A;  3T4T A;  5CRF A;  4PKY A;  3W4P A;  1WYC A;  4KG6 A;  2WGW B;  1OTB A;  4DMZ A;  1WA9 A;  1PZO A;  3MXS A;  3PBS A;  3G31 A;  5F5Y A;  3B42 A;  5HL1 A;  3KSF A;  3Q7V B;  3UB5 P;  4WZ5 A;  4UHU A;  3JVV A;  3O88 A;  3SZT A;  4HJ3 A;  2QZ6 A;  1IKG A;  3OPH A;  4OQ0 A;  1BUE A;  1OJG A;  1SCW A;  1QME A;  3IX4 A;  5FAO A;  4FOF A;  3PBR A;  2GDN A;  3O86 A;  3U4L P;  2ZC6 B;  2EXB A;  2EXA A;  3D4F A;  5E2F A;  1ESI A;  5GL9 A;  4G3W A;  3G6O A;  2OLU A;  2Q9M A;  3KSH A;  3R7W B;  3NY4 A;  4I3A A;  4DE3 A;  1BLP A;  4IVI A;  1T19 A;  3OPP A;  1L0F A;  2VJW A;  1NZU A;  1BTL A;  4OKP A;  4PM5 A;  3IXB A;  2ZQ7 A;  4Q0J A;  4DDS A;  2HF6 A;  3CLO A;  3SOI A;  1ES2 A;  4KUK A;  3SH8 A;  3C4P A;  5EV0 A;  5DF8 A;  1XP4 A;  3OC2 A;  3LR3 A;  2ZBB A;  4KZ8 A;  5DFY A;  5GLC A;  3UE1 A;  2WUQ A;  1XFQ A;  4L9F A;  1ZG4 A;  2O9C A;  3B3X A;  3OPR A;  3MQ0 A;  3G30 A;  4HOI A;  2IWB A;  2BAS A;  3H7W B;  3ZFZ A;  4OPZ A;  3IHB A;  2OAQ 1;  1HTZ A;  3WS0 A;  1ZG6 A;  4WEK A;  3P98 A;  5F6A A;  3WRZ A;  3G4P A;  4S2J A;  3PHY A;  1KGE A;  1K4F A;  2E8J A;  3MZF A;  3FYZ A;  3EWK A;  3BFE A;  1MKI A;  1PI5 A;  4HP9 A;  2UV0 E;  1H0M A;  3MQO A;  3JPU A;  3T12 B;  5HAI A;  2J3T D;  3N7W A;  4ETZ A;  2Q0O A;  3IF5 A;  1K57 A;  3DTK A;  4G3V A;  1XXM A;  4QY5 A;  3NDG A;  3T4O A;  3N6I A;  4K0W A;  2I72 A;  2ZL1 B;  5J8X A;  3MZD A;  3A0V A;  4UA6 A;  3V67 A;  4DN0 A;  1XFN A;  3LYX A;  1LHY A;  5M19 A;  3EGD C;  2WYX A;  2WKQ A;  3S7Q A;  1E25 A;  3HLG A;  3D3O A;  5DJT A;  5HD5 A;  4PM6 A;  3ISG A;  4F94 A;  1G28 A;  1YSQ A;  5HSQ A;  3SS3 A;  1VET A;  4HHD A;  1AXB A;  1IYO A;  2XRO A;  5EM1 A;  2O99 A;  4Z9Q A;  4HIA A;  4G3K A;  3ULF A;  5GLB A;  3TJZ C;  1BUL A;  4B4X A;  4X53 A;  1CEF A;  2KDK A;  2DCF A;  1MXO A;  2O0Y A;  5HAQ A;  3PBQ A;  1Q2P A;  3TRC A;  5HWT A;  1BZA A;  4C3Q A;  3NOT C;  4RVA A;  5FQI A;  2EWW A;  4GZB A;  4DXB A;  3Q07 A;  2V8C A;  4P6Z S;  4NXG A; 
#chains in the Genus database with same CATH homology
 1XJ3 A;  3P7N A;  2OWH A;  1IOU A;  2P08 A;  5J3W A;  4EER A;  3MF0 A;  5I5L A;  4OOM A;  4HJ6 A;  5IT5 A;  5LBR A;  3KX0 X;  1P0Z A;  1IFQ A;  2ZMF A;  3IBR A;  3T50 A;  3EQV A;  2ZOH A;  3UB9 A;  3FPW A;  4R70 A;  4GCZ A;  1OT9 A;  4HY8 A;  3CUE C;  2OOL A;  1LSV A;  1NLZ A;  2W27 A;  5F68 A;  4HQA A;  2FH5 A;  3VE3 A;  3MMH A;  2K31 A;  1G6O A;  2QWS A;  5CX7 A;  4PKY G;  1NRJ A;  2V1A A;  3LI9 A;  4I38 A;  4MN5 A;  4EW7 A;  2XRN A;  2H28 A;  1LT0 A;  1ZHH B;  3R4K A;  3T4K A;  2OWJ A;  2PR6 A;  4I39 A;  1DP9 A;  3BQA A;  3P01 A;  3UB8 A;  4BJP A;  3T4Q A;  3GDI A;  4IHQ A;  3LR5 A;  1GSW A;  3OLO A;  3EGX C;  3KSG A;  4Y5F A;  3FC7 A;  5J4E A;  4IJG A;  5IS1 A;  4NXF A;  1OTE A;  2PD8 A;  4GLQ A;  5KSH A;  3E4O A;  4O0P A;  3T4L A;  4YWZ A;  2B02 A;  1P97 A;  2W0N A;  5J7E A;  4KQD A;  4QPR A;  4MCW A;  3LUQ A;  3S7O A;  2QYB A;  5G4Z A;  3MJQ A;  3LIF A;  3F1O A;  4GS9 A;  2JKT M;  5HDS A;  2W3D A;  4WF0 A;  3TW8 A;  4Q0I A;  4EET B;  4M4X A;  2QJ5 A;  3C8C A;  4B93 A;  1MC0 A;  2L0W A;  2GZA A;  1H3Q A;  3GEC A;  2HJE A;  1KOU A;  2VX8 A;  5G4Y A;  4WN5 A;  3UE6 A;  3JVU A;  3NHQ A;  1V9Z A;  2INW A;  2DMW A;  1P9R A;  4L9G A;  3EQU A;  4MN7 A;  1V9Y A;  5HD3 A;  4Y2F A;  2VKS A;  1UWP X;  4MN6 A;  1T1B A;  3HJI A;  4EUV A;  5DKL A;  2M7V A;  3IBJ A;  4I3I A;  3BY9 A;  5TBM A;  4R3A A;  4BBU A;  4CLC D;  1Y28 A;  4JGP A;  3VE4 A;  1F5M A;  4JGO A;  1XJ6 A;  2ZOI A;  3VOL A;  2J3W A;  3KYQ A;  3PBT A;  3PYP A;  3UME A;  3H82 B;  2JN7 A;  1W63 Q;  5TBM B;  1S67 L;  1OTD A;  1TS7 A;  3RFB A;  3KSI A;  2EWV A;  5EFW A;  3T4S A;  4GJ4 A;  4EEU A;  4EU0 A;  2V1B A;  3BQ8 A;  3D72 A;  3U2A A;  1GSV A;  3HJK A;  1UGU A;  2VEA A;  3EOI A;  4HP4 A;  1JNU A;  4BBT A;  4B9O A;  2ZMV A;  3NJA A;  2NUP C;  2VZW A;  2PR5 A;  3CI6 A;  4GW9 A;  5AVF A;  2EA9 A;  5HPI A;  4BBV A;  4EES A;  1NLY A;  4NKP A;  3W2Z A;  4BWI A;  4CQH A;  2VV6 A;  2XSS A;  4CLC C;  1XJ4 A;  4CLC E;  2PHY A;  4WLA A;  1TD5 A;  1YAX A;  2P04 A;  4EEP A;  2YKH A;  3HCY A;  4I5S A;  1N9O A;  4H6J B;  4KUO A;  4NEE D;  3F1P B;  3LR0 A;  3LIA A;  1S66 L;  5AJG A;  3PXP A;  4ME4 A;  5HDD A;  3F1N B;  5HPF A;  1OPX A;  4HJ4 A;  2QJ7 A;  2LB5 A;  2FZ0 A;  1N9L A;  2VGL M;  2R78 A;  4E04 A;  2GX5 A;  3E98 A;  3KO6 A;  3K3D A;  2Z6D A;  2PDR A;  5DFX A;  4XT2 B;  2V0W A;  3CUE A;  5A8B A;  2VGL S;  1TF1 A;  1TS8 A;  4O01 A;  4CLC B;  1DRM A;  1X0O A;  2HV1 A;  3BJN A;  4F3L B;  2VA0 A;  5HZH A;  3S7P A;  4DJ2 A;  2K7S A;  1DP8 A;  2L4R A;  1TS6 A;  3ZQ5 A;  4K08 A;  1OTA A;  1DP6 A;  3T4T A;  5DF9 A;  2PT7 A;  4ZRR A;  4LLO B;  1W63 M;  4PKY A;  2PYR A;  2OAP 1;  1OTB A;  4DMZ A;  1WA9 A;  4NXE A;  1EW0 A;  2A24 B;  3PBS A;  5HL6 A;  5F5Y A;  3B42 A;  1D7E A;  1ZTU A;  2QKP A;  4EQ1 A;  2VV7 A;  3C38 A;  3KSF A;  3UB7 A;  3NOU C;  5K5B A;  4MMN A;  3JVV A;  4HJ3 A;  2W3H A;  2A2L A;  2NUT C;  3BWL A;  3E4P A;  3MQQ A;  4EXO A;  3K2N A;  3H9W A;  5KIZ A;  4IUK A;  3OBF A;  1OJG A;  2D01 A;  1YSP A;  5DJU A;  2JKT I;  3PR6 A;  4DJ3 A;  4FOF A;  3CIT A;  3H82 A;  2XA7 M;  3OOV A;  2K2N A;  3PBR A;  2V9A A;  4R38 A;  2J3T C;  4WL9 A;  4L0L A;  3LFV A;  2W1T B;  1LSX A;  1STZ A;  4WEL A;  3S7N A;  4G3W A;  3G6O A;  3KSH A;  3UE3 A;  3IS2 B;  3LID A;  3R7W B;  4R6L A;  4I3A A;  2JKR M;  2PYP A;  4ARZ B;  1T19 A;  2GJ3 A;  2I9V A;  4LRZ E;  3EEH A;  2WKP A;  1S4S A;  1GSX A;  4Z1W A;  3FG8 A;  2VJW A;  2M7U A;  1LSW A;  3LIE A;  3NOP C;  4UQI M;  2VLG A;  2IA2 A;  5IU1 A;  1TS0 A;  4Q0J A;  5HWV A;  4BMW A;  2HF6 A;  3CLO A;  3UB6 A;  4KUK A;  1S4R A;  3UMD A;  4HNB A;  2JHE A;  4UQI S;  4P6Z M;  3KYZ A;  3OC2 A;  2PD7 A;  2YKF A;  2KX6 A;  2GNX A;  5L8M A;  4AFI A;  3MR0 A;  3LR3 A;  4UEY A;  2ZBB A;  3DBA A;  5MC7 A;  5DFY A;  4H6J A;  4LPZ A;  3F1P A;  1T1C A;  2L1M A;  4JGQ A;  3H7W A;  1XFQ A;  3F1N A;  4L9F A;  3LI8 A;  4GHI B;  4II7 A;  1ODV A;  2O9C A;  2W3G A;  1XJ2 A;  3MQ0 A;  2VV8 A;  4HOI A;  3E4Q A;  2BAS A;  3H7W B;  4XT2 A;  4CLC A;  2OAQ 1;  5HWW A;  4F3L A;  3EEA A;  1UWN X;  2Y8H A;  4WEK A;  4JGR A;  3CWF A;  5F6A A;  3FPV A;  3PHY A;  2QHK A;  3PBO A;  4HH2 A;  4YOF A;  4HH3 A;  3EWK A;  1T18 A;  3MFX A;  1D06 A;  1OT6 A;  2W3E A;  4HP9 A;  3ZYT A;  3MXQ A;  3C2W A;  3MQO A;  2A24 A;  2B18 A;  4PAU A;  1S1Z A;  2J3T D;  4ETZ A;  3LIB A;  1BYW A;  4MDZ A;  2HGV A;  4G3V A;  5F69 A;  2CMN A;  1H8M A;  3T4O A;  2V0U A;  4HI4 A;  3E0Y A;  4KQO A;  5FL3 A;  2J80 A;  3O5Y A;  3BY8 A;  2O9B A;  3A0V A;  3V67 A;  2MJ6 A;  4DN0 A;  1XFN A;  3LYX A;  1S1Y A;  3EGD C;  4WUJ A;  2WKQ A;  2Z6C A;  3A0S A;  5C5K A;  3SW1 A;  3BW6 A;  3T4J A;  3S7Q A;  4LRX C;  3D3O A;  5DJT A;  5HD5 A;  3C30 A;  4YNR A;  2W1T A;  4I3J A;  3F1O B;  1G28 A;  4GS9 B;  1OTI A;  3OCL A;  3TE8 A;  3B47 A;  1YSQ A;  3IS2 A;  4PHT A;  3LIC A;  3R7W A;  3LR4 A;  4RQ9 A;  1NWZ A;  5AVE A;  4ARZ A;  5HSQ A;  5HDC A;  2XA7 S;  2W1R A;  4WEJ A;  2KOI A;  1LL8 A;  4HHD A;  2LB9 A;  1OJ5 A;  2XRO A;  2O99 A;  1YKD A;  4FSF A;  3VV4 A;  4HIA A;  4G3K A;  3ULF A;  3TJZ C;  2HJ9 C;  2KDK A;  3PBN A;  1F98 A;  1VB6 A;  5TJJ A;  2O0Y A;  2M1C A;  3PBQ A;  3CAX A;  3TRC A;  5HWT A;  2W3F A;  1VHM A;  3ICY A;  1T1A A;  1F9I A;  2O9A A;  3NOT C;  3A0R A;  3RH8 B;  1N9N A;  1MZU A;  4NXB A;  2P7J A;  4O8G A;  2Y79 A;  4L9E A;  2EWW A;  2D02 A;  4Y3I A;  3B33 A;  4ETX A;  1P9W A;  4GHI A;  3OCN A;  4OOL A;  2G7U A;  2WKR A;  4IUH A;  1MKM A;  2JKR I;  4LRY C;  4NXG A;  4P6Z S;  2KLI A;  5DKK A;  4Q0H A;  3K3C A;  3RTY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...