5IS1A

Crystal structure of the extracellular domain of sensor histidine kinase yycg from staphylococcus aureus at 2.0 angstrom resolution
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
143
structure length
142
Chain Sequence
NNLEKELLDNFKKNITQYAKQLEISIEKVYDEKGSNAQKDIQNLLSEYANRQEIGEIRFIDKDQIIIATTKQSNRSLINQKANDSSVQKALSLGQSNDHLILKDYGGGKDRVWVYNIPVKVDKKVIGNIYIESKINDVYNQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Histidine kinase
publication title Structural Studies on the Extracellular Domain of Sensor Histidine Kinase YycG from Staphylococcus aureus and Its Functional Implications
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 44
structure length 142
sequence length 143
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2016-03-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5is1A00
4JGOA 1F9IA 3HJIA 3LUQA 3EEHA 4EERA 3UB6A 5AVFA 3VE3A 1OTEA 4KQDA 4JGPA 5J7EA 4I38A 4NXBA 5HDDA 4RQ9A 5HZHA 5HDCA 3RTYA 4HHDA 2V1BA 1T1BA 4GHIA 4EXOA 4GW9A 5TBMB 4BBTA 4YWZA 4HY8A 1Y28A 2Z6CA 1N9NA 2V0WA 4WF0A 2W27A 3NOTC 4R3AA 3T50A 1WA9A 2YKHA 1LSVA 3FC7A 3LIAA 1DP9A 5HSQA 3G6OA 1MZUA 3BY9A 3H9WA 1DRMA 1OTDA 3K3DA 2L1MA 5J4EA 5HD3A 5F69A 2A24A 3IS2A 4I3JA 2R78A 1XJ4A 2V9AA 1OTBA 1OTAA 2ZOIA 3CWFA 3LIBA 3UB7A 2VV7A 1XJ3A 4L9FA 3MXQA 1BYWA 2PYRA 1LSWA 3H7WB 3LIEA 3VE4A 2WKQA 1S1ZA 3F1OA 1G28A 3UB9A 4HJ4A 2P7JA 4K08A 2QJ5A 2PR5A 5DKKA 3C2WA 1T18A 4HJ3A 3B33A 3A0SA 3LIDA 1UWNX 3EWKA 5AVEA 1GSVA 4XT2A 2PD7A 3A0VA 2H28A 2J80A 5HWVA 3GDIA 2M1CA 4I39A 4HIAA 2INWA 3BWLA 5F68A 2QJ7A 4R6LA 4MN6A 3VOLA 2PYPA 5HWTA 1EW0A 4WN5A 3H82A 2QWSA 2KX6A 1T1CA 2QKPA 4F3LA 3F1PB 2PDRA 4R38A 3E4PA 4BBVA 4GCZA 1S4RA 1GSWA 4EESA 2ZBBA 4HH3A 4GS9A 5HDSA 5IU1A 4DJ2A 1V9YA 1TS0A 1XJ2A 4NXGA 1OJ5A 4JGRA 1T19A 2PR6A 4KUKA 4NXEA 1N9OA 4GHIB 1JNUA 1D7EA 5A8BA 4HOIA 2B02A 2CMNA 3LICA 3IBRA 3CLOA 4HNBA 5F6AA 4EETB 3MQQA 1X0OA 1LT0A 4HI4A 4R70A 4PKYG 3F1NA 4HP4A 2OWJA 3C8CA 3IS2B 3UMDA 4H6JB 5DKLA 1XFNA 2QHKA 2D02A 1UWPX 1TS8A 4EW7A 5DJTA 2PHYA 3LI9A 2KDKA 4E04A 4BBUA 2VLGA 3BY8A 5G4ZA 4I5SA 5DJUA 5J3WA 3PHYA 3SW1A 2WKRA 3CAXA 4LRXC 1LSXA 4KUOA 4NXFA 3F1OB 4I3IA 1OT9A 1XFQA 5KIZA 4WLAA 4EQ1A 1LL8A 1T1AA 2VV8A 3UE6A 3PYPA 1S4SA 3HJKA 2PD8A 5F5YA 4PKYA 5TBMA 3P7NA 1D06A 3E4QA 2VEAA 3ICYA 3MFXA 2L4RA 5HD5A 1N9LA 4XT2B 2JHEA 5IS1A 3NHQA 3NOUC 1NWZA 1DP6A 2JN7A 1P0ZA 3UB8A 2K7SA 1S1YA 5I5LA 3H82B 3RH8B 4F3LB 2L0WA 2OOLA 2ZOHA 4HH2A 3OLOA 3NOPC 3LYXA 4M4XA 4HJ6A 2YKFA 4LPZA 2V1AA 2Z6DA 2W0NA 4GS9B 1S67L 2OWHA 4I3AA 3MQOA 1S66L 1XJ6A 2EA9A 3GECA 2I9VA 3ZQ5A 3H7WA 2VV6A 4H6JA 3LIFA 1UGUA 4LRZE 4DJ3A 2GJ3A 1DP8A 1F98A 4LRYC 1KOUA 2A24B 3KX0X 3MJQA 4HQAA 3MR0A 1TS7A 3E4OA 4HP9A 1OT6A 1ODVA 4EEPA 4JGQA 2D01A 3NJAA 3FG8A 4WL9A 3F1NB 3UMEA 2WKPA 3K3CA 2HV1A 1OJGA 4EEUA 1V9ZA 4LLOB 1P97A 4B9OA 1OTIA 1VB6A 2BASA 5HWWA 5G4YA 3D72A 3ULFA 3F1PA 3LI8A 1GSXA 5EFWA 3A0RA 4L9EA 2V0UA 1TS6A 4MN5A 4WUJA 4L9GA
chains in the Genus database with same CATH superfamily
4EERA 3UB6A 1OTEA 4KQDA 3CG5A 4I38A 2H5SA 3P09A 2EWVA 4NXBA 1CQAA 1RGYA 2Y2LA 3N8RA 5FAOA 4ARZA 3DTIA 3DTEA 5FL3A 4HHDA 3RTYA 1LI9A 2PAVP 3MXRA 4A5RA 3BRMA 2HGVA 2Q0OA 5M18A 1Y28A 1N9NA 4WF0A 3B42A 2W27A 3NOTC 1ES2A 4R3AA 3T50A 3W2ZA 4KQQA 3VFHA 3PAGA 2XD5A 3Q81A 2Y91A 1MZUA 2ZQAA 2HZ5A 3LFVA 1PWCA 4ZJ3A 3H9WA 3M2KA 5FAPA 1DRMA 4DF6A 1OTDA 1K57C 3TJZC 4E3MA 3IT9A 2ZM8A 3HUNA 4G3VA 1Q2QA 2R78A 4OOYA 1BUEA 4FTXA 3C7VA 3DW0A 2WAFA 5FA7A 3GRJA 2WGWB 3LIBA 2Q9MA 3CUEC 3D4FA 1H8ZA 1BYWA 2Y2QA 2ZMFA 1XA1A 4GDBA 3UO9A 3H7WB 3LIEA 4OQHA 5FATA 2EWWA 3VE4A 1K4EA 4II7A 2W3GA 3QNCA 2ZD8A 4JKTA 3F1OA 1BLCA 2AVXA 1VETB 3LR5A 3S7OA 1J9MA 4HJ4A 1FCNA 1JWPA 3ZNYA 2QJ5A 3VOYA 3N4IA 4NKPA 1NRJA 1TEMA 5GHYA 2ZC7A 1HZOA 4Y13A 2J80A 5M1AA 3OZHA 2ACGA 3MSHA 1YSQA 3BLMA 3G31A 5IT5A 2QJ7A 4ZAMA 4MN6A 3Q82A 1EW0A 4WN5A 3N7WA 4F3LA 4X25A 4R38A 2QPNA 3TOIA 1TVFA 5CRFA 1MC0A 5DVAA 5J8XA 2J9OA 4B4XA 1S4RA 1PNEA 2ZC4B 1L3LA 4JF5A 2EXBA 5I94A 4KZ8A 4DJ2A 3W4PA 1XJ2A 4NXGA 4M3KA 4MN7A 4ZDXA 2DCFA 3V3RA 2B5RA 4OLDA 2XF3A 1XGJA 4Q8IA 5CGXA 5DFXA 2J7VA 4GHIB 5CEDA 4WM9A 4S2PA 4X1LA 1K0KA 2ZQ8A 3IXBA 4HOIA 3GV9A 3MZDA 3IBRA 4KG6A 1S6RA 3OCLA 3HCYA 2W1TB 2O9AA 1XGIA 4X56A 5F6AA 1BSGA 4KZ7A 2OAP1 5FAQA 2J3TC 3C4OA 5G18A 1ONHA 5HARA 4LV3A 3PBNA 3GR2A 1GA0A 3IS2B 5CTNA 3LEQA 4JPMA 3S1YA 3IHAA 1Q2PA 2VK3A 3S7QA 1UWPX 2V1ZA 2H10A 1W63Q 3OBFA 2JKTM 4YINA 2W3DA 3OC2A 2XR0A 5L09A 5A91A 1K25A 4DDYA 5AQ7A 3KYZA 3PHYA 3VMAA 3SW1A 4OP8A 3CAXA 4DXBA 4S2IA 3GQZA 5CGSA 2Y8HA 3FPVA 1OMEA 2ZC5B 4KUOA 1ZG4A 3IF6C 2M7VA 4KZAA 2OLUA 4GDNA 2WKIA 4EQ1A 1M6KA 4CJNA 2RCXA 4EUVA 3EEAA 5TBMA 4CLCA 1PRQA 5TGFA 3UN7A 4NEED 4S2NC 4LV0A 4MCWA 2PU2A 3VP1A 2L4RA 1K55A 1GHMA 3IWOA 3A3IA 3VP2A 4XT2B 1LHYA 1A0KA 3A3EA 3KSHA 2G2UA 4EWFA 1MBLA 3UB8A 1HLUP 4ZJ2A 1WYCA 2QMIA 3QP4A 3M2JA 3IF5A 4OQIA 4MLLA 3V39A 3H82B 2EX2A 3A3JA 2Z2MB 5HAQA 1IYOA 2ZOHA 4HH2A 3JPUA 2UV0E 5EOOA 2OSUA 2WYXA 4HJ6A 3W4QA 2Z6DA 5JYOA 1VEUA 2RL3A 3IX3A 3ISGA 2OWHA 4BL2A 1NY0A 4R4SA 4B88A 3IF6B 1PWGA 1SZVA 4ETZA 2ZMVA 1QMFA 2OV5A 3T1QB 3LIFA 5FQJA 1W8YA 5A90A 4DJ3A 2GJ3A 1F98A 4FH4A 3EQUA 3IHBA 1ACFA 3NI9A 5MC7A 4K0WA 3LGOA 3MR0A 1YLTA 4CLCE 3AGFA 1ODVA 3UPOA 3NJAA 3PTEA 4S2MA 1YMXA 4ID4A 3GVBA 3K3CA 5E43A 1P97A 1LLBA 3N6IA 2QYBA 2HJEA 5HWWA 1DY6A 4R0QA 2JKGA 5G4YA 3FZCA 3ULFA 4KZBA 3F1PA 3LI8A 4IJGA 2ZL1B 3C4PA 5EV0A 4UA9A 1CJFA 3GTCA 3IWIA 1K6SA 5EFWA 1PWDA 3FPWA 3ZG0A 3JYIA 5CERA 1VM1A 2XFSA 4IBRA 4MEZA 4IVIA 2HDQA 3HLEA 3HJIA 1K56A 2XK1A 5DF8A 3LR0A 4ZRRA 3OPLA 3T4TA 3WS0A 3WWXA 3E2KA 2JKRM 5EOEA 1BLHA 1WE4A 4X6TA 3VV4A 5EUAA 5HZHA 1I2WA 2V1BA 1KVLA 1NYMA 4WZ5C 1T1BA 1Y4OA 3U2AA 4U0TA 1PFLA 2Z6CA 1PI4A 2VGJA 3T1RA 2YKHA 4FUWA 1IKIA 2DRWA 3LIAA 4KQOA 2P9VA 5JYPA 1NLZA 3K3DA 4CPKA 2GZAA 4P0MA 2LB9A 5HD3A 3LEZA 5F69A 2A24A 5HFOA 4I3JA 1LL5A 1XJ4A 2HDRA 3C7UA 1ZG6A 2ZOIA 1XA7A 4IBXA 4Q0IA 5KSHA 2H0YA 5AQ9A 2J3TD 3UB7A 2P04A 1NJ4A 5FQIA 3KSFA 3LR3A 2WKQA 1NXYA 3Q7VA 1KGEA 1KE4A 4RA7A 1IEMA 3ZVTA 2P7JA 2R9WA 4K08A 2PR5A 2IWBA 1BLPA 5DKKA 1T18A 3A3FA 1SKFA 1DJBA 4DDSA 4N92A 2WADA 1E25A 4Y15A 4OLGA 4F94A 3A0SA 5DTKA 3O3VA 1XPBA 1UWNX 5E2FA 4QWOA 2E8JA 5FQ9A 4E6XA 2PD7A 4DN0A 4FD8A 1KGFA 1S0WA 3OPRA 2FFYA 4IVKA 1CEFA 4H8RA 5CTMA 4HBTA 3VOLA 2ZLYA 4UHUA 5HWTA 4B4ZA 3E4PA 2Y2OA 3ZYTA 2PRFA 4C6YA 5HDSA 1BLSA 3T1XA 2Y2GA 1V9YA 3JVVA 3KSIA 4OPQA 2J9PA 4OKPA 3OCNA 3ZG9B 4PMAA 5CGWA 4ARZB 3T4KA 3VSLA 4WMCD 5HAPA 3G2ZA 4NXEA 2Q9NA 5TFQA 1K4FA 3B47A 4JXGA 5A8BA 3NDEA 3PAEA 3LICA 3Q07A 4GD6A 5E2GA 4FOFA 1I2SA 1STZA 2X02A 2Y4AA 4MBFA 1J3WA 4JF4A 3MQQA 1X0OA 2LB5A 4WEKA 3ZNTA 4PM5A 4HI4A 3QP1A 1N4OA 1W79A 2ZQDA 3HL9A 3PBQA 4NETA 5A92A 4ETXA 3UMDA 4H6JB 3G32A 5DKLA 1XFNA 2DNSA 5FEGA 2J8YA 1H0MA 1Y54A 4AFIA 5LBRA 1TS8A 5L8MA 3NY4A 5KSCA 3UDIA 4E6WA 3P98A 4WYYA 4X1MA 3LI9A 3UE1A 1PI5A 3WS1A 1YLZA 4WEJA 3M6HA 2XH9A 4EBNA 4PM8A 3K2NA 1K38A 4Y0UA 4BBUA 1KE3A 2VLGA 3T4SA 2MJ6A 3S4XA 1K57A 5DJUA 5J3WA 2WKRA 1LI0A 1ZHHB 3QP2A 4GB7A 4LRXC 2ZM2A 4NXFA 3SH8A 3F1OB 1OT9A 3VP4A 1RP5A 4Q0HA 2VV8A 4BL3A 1BT5A 5EVIA 4UQIM 2PT7A 1E3UD 3P7NA 4GJ4A 1D06A 1LL9A 4P87A 3MFXA 3LCEA 3BECA 5HW3A 2V20A 1N9LA 3S22A 4BWIA 1FOFA 1DP6A 5CEBA 5EM1A 1KDWA 2Y2JA 1S1YA 1OPXA 5I5LA 3BFFA 4Y3IA 4F3LB 2O0YA 4XUXA 1IKGA 3WS2A 3OLOA 1KE0A 1ZKJA 2W1TA 4M4XA 2YKFA 3V67A 1XKZA 1EWZA 4I3AA 1HD8A 1KDSA 4Y5FA 3N8SA 3MQOA 3BLSA 4R3BA 4X55A 1WYBA 5BOHA 4O7DA 2UWXA 2I9VA 4CQHA 2J3WA 3D9YA 4KZ6A 1L0EA 5A93A 3HLBA 2XFTA 1DP8A 3L9KA 1KOUA 2JKFA 2ZMAA 2ZC3B 3MJQA 3LY3A 4DXCA 2EFUA 1FCMA 4MNRA 3LO7A 2G2WA 3BQAA 4EEPA 3E98A 3UY6A 2E8IA 1JTGA 5F82A 1K55C 4DRTA 1IELA 4N9LA 5AQBA 1OJGA 1V9ZA 4LLOB 3R7WA 2K31A 1RGZA 1OTIA 1ZTUA 4QJGA 4JLFA 4OP5A 1YLJA 1XX2A 3CI6A 3OPPA 1K54A 1ERMA 4P85A 2IWDA 1BULA 3CPTA 5HL1A 2XA7M 3HLFA 4OPYA 2HP6A 1GSXA 1ESUA 2VKSA 2ZQ7A 3MXSA 2V0UA 5GLCA 5HPIA 3OPHA 1TD5A 3UB5P 1TDGA 3QP6A 2CC1A 3LUQA 1MXOA 3NIAA 2EXAA 3T4JA 5AVFA 3HLDA 3IWQA 4N1HA 3FV7A 1GHPA 5HDDA 4OQ0A 5GL9A 5FDHA 1ES3A 4ZBEA 4FH2A 2Y55A 1Z09A 1ZC2A 4EXOA 3C38A 4GW9A 1EROA 4UQIS 4QY5A 2XLNA 1C3BA 5TBMB 4YFMA 4PPRA 3R4KA 1N9BA 5HPFA 2WKHA 3WS5A 3ZGAB 5FDSA 1WA9A 3Q7ZA 3ZVWA 1PW1A 2WZXA 3FYZA 4HEFA 3DTKA 4E3JA 5FI7A 1L2SA 1QMEA 4BMWA 3FC7A 5GLDA 5EE8A 1ES5A 5HSQA 1H8MA 3IH9A 1PW8A 3MMHA 3BM6A 2KLIA 3VOZA 4DE3A 4KG5A 2L1MA 4LCLA 1TF1A 4S2NA 3UE3A 4LENA 4BQMA 1OTBA 4NG2A 2G7UA 3HBRA 1MWTA 3TSGA 4RX2A 3CWFA 4OPRA 4K0XA 4S2KA 3V3SA 4P6ZM 3GMWA 4XUZA 3KYEA 2X01A 3O87A 2PYRA 1Z6FA 3DTMA 1LSWA 5CECA 4O0PA 3TG9A 1S1ZA 2PBDP 5KMWA 2WUQA 3P01A 1P9WA 4Y0TA 1G28A 5DFYA 2HPBA 4JXSA 2PU4A 4EUZA 1GA9A 4EV4A 2WGVA 2WZZA 3B33A 4PM9A 3NC8A 2Z2LB 4GLQA 1FSYA 1JWZA 3A0VA 2H28A 3ZG8B 4EBPA 1O07A 5HWVA 4I39A 3ZCZA 2Y79A 5EM0A 2O9BA 2HDSA 4R6LA 1YPRA 2EX8A 2QWSA 1MKIA 2XA7S 3F1PB 3BYDA 1K6RA 4QPRA 1XP4A 4UA7A 4E3LA 3U4LP 2BTFP 2Y2NA 4KZ5A 1GSWA 2DMWA 1SKOA 2VJWA 3NULA 4D60A 4EESA 4GS9A 3VP0A 3Q1FA 5IU1A 2V2FF 1TS0A 2VGKA 4OOMA 1OJ5A 1NYYA 4N9KA 5EPHA 4JGRA 4X53A 3RXWA 1T19A 3S7NA 1IYQA 4LFUA 4UEYA 2NUTC 3TW8A 4IUKA 1JNUA 1D7EA 4GD8A 2B02A 2XROA 1FCOA 4ME4A 1NZUA 1I5QA 4DE2A 3C30A 3WRZA 4RVAA 3TRCA 1AXBA 3CLOA 1JWVA 5DF9A 5HAIA 3NDGA 2P9VB 2FFFB 3DBAA 3MZFA 2VGLM 4R70A 2O99A 3F1NA 4HP4A 3G2YA 5KZHA 3C8CA 2GDNA 4IEDA 4PHTA 2JC7A 4JXVA 3BJNA 3MS6A 1IYSA 5EVEA 4GZBA 2D02A 1CI8A 1VQQA 3T12B 2PHYA 2XSSA 4E04A 4P6ZS 3CHWP 1MWSA 5G4ZA 5CXWA 4E3KA 2XD1A 3A3DA 4JXWA 4NK3A 3KSGA 1LSXA 3Q7VB 3G34A 4O01A 1NZOA 2KOIA 4I3IA 1XFQA 4Y17A 3B3XA 3ZG5A 3SOIA 4WLAA 3S7PA 4D2OA 1LL8A 1U60A 3UE6A 3O86A 4Z1WA 2PD8A 3BQ8A 1JVJA 4LV1A 4UAAA 4OVDA 4R4RA 3E4QA 2VEAA 4OONA 5HD5A 3ZDJA 2GNXA 3QHYA 3HLGA 5EVLA 5M19A 1YMSA 3NHQA 3CJMA 3SH9A 3LR4A 2VA0A 1NWZA 3EGXC 2XDMA 1P0ZA 5IHVA 3MZEA 4RX3A 4KG2A 2K2NA 2K7SA 5HL6A 1PZPA 3NCKA 3RH8B 2L0WA 2OOLA 1PYYA 2XRNA 1CEGA 3PXPA 4LPZA 3LY4A 3O5YA 2W0NA 1S67L 3VP3A 2WGWA 1E4DA 4HESA 4MMNA 3W8KA 3MKEA 1XJ6A 3GECA 3BW6A 4EBLA 5K5BA 3ZQ5A 3H7WA 3HUMA 4H6JA 3TE8A 2QZ6A 4JBFA 1YAXA 1VETA 4DMZA 1ONGA 5L07A 3T1SA 4EU0A 3UDFA 4OPZA 4HQAA 2Y2MA 3MFDA 4PAUA 3KYQA 4BD1A 1W7FA 5EVIC 1MWRA 5GHZA 3E4OA 1FSWA 4HP9A 1OT6A 1BZAA 5DTSA 5E2HA 2VGLS 4BLMA 3L7HA 1YLYA 1K56D 3FG8A 4WL9A 3UMEA 2VZWA 3MF0A 2Y2HA 4BJPA 4Y2FA 2B18A 2EX6A 2JKRI 5CHJA 1W5DA 1VB6A 2WGIA 2BASA 4R1GA 1SHVA 2V8FA 2A49A 3VSKA 2B95A 1AWIA 3ITAA 4XXRA 4KZ9A 4R3JA 3W4OA 3RXXA 5U47A 4Q0JA 5GLBA 2HF6A 3A0RA 4L9EA 1DJAA 3IH8A 1TS6A 3CUEA 4LGWA 5GHXA 4JGOA 1F9IA 3EEHA 2PBYA 1PZOA 3UDXA 2C6WB 5E2EA 2X71A 3C5AA 3CZDA 3VE3A 4JGPA 5J7EA 1FR6A 3E2LA 1FIKA 3SH7A 4RQ9A 1L0GA 4QHCA 3JVUA 5HDCA 5GLAA 4QD4A 4UA6A 4GHIA 5EVIB 3VFFA 4U3TA 4BBTA 4YWZA 4HY8A 4G3KA 3M6BA 2V0WA 4IHQA 1HTZA 4Z9QA 1YLWA 3BEBA 2HP5A 2ZC6B 1IOUA 1HVBA 1LSVA 1DP9A 3G6OA 4WZ4A 5F1GA 3BY9A 3HREA 1G6OA 3IXGA 3IXDA 4HBUA 4IUHA 5CHMA 5J4EA 2XGNA 5D3OA 1H5XA 3D3OA 2M7UA 4GN2A 2Y59A 3IS2A 1P9RA 4S2JA 1K54C 3G35A 4WBGA 2V9AA 4LCMA 3SZTA 3ITBA 1OTAA 4G3WA 3QP8A 4X69A 2WK0A 5EECA 2VV7A 1XJ3A 4L9FA 3MXQA 4CLCC 3SS3A 1VHMA 2W1RA 1CF0A 1YQSA 4KZ3A 1FQGA 3NBLA 4L0LA 1SCWA 4GOGA 2A2LA 5CHUA 2ZJ9A 3T4OA 3UB9A 4DKIA 5F83A 3V50A 3T4LA 3NECA 3HUOA 5AJGA 3C2WA 2EX9A 3CITA 4HJ3A 5FASA 1F5MA 4Y0OA 5C5KA 3LIDA 2Y2IA 2FZ0A 3FWLA 2HP9A 3EWKA 5AVEA 1GSVA 4XT2A 1PIOA 1O7EA 2R9XA 3IX4A 3GDIA 3R7WB 2M1CA 1KVMA 4HIAA 3ZHHA 1KGGA 3UE0A 2INWA 2ZQ9A 3BWLA 5F68A 2XQZA 3HVFA 4MBHA 2PYPA 1L0FA 1MY8A 3H82A 2KX6A 1T1CA 3CPTB 2QKPA 5CX7A 2P08A 2PDRA 3EOIA 1CI9A 5FQQA 4BBVA 4GCZA 3SS4A 3MBZA 4CLCB 3E0YA 4P6BA 2ZBBA 4HH3A 1H3QA 3PR6A 3PBRA 3FKVA 4C3QA 4O8GA 4ZJ1A 2WAEA 3IF6A 3UPNA 1IFQA 1FILA 4DE1A 1CK3A 5FQKA 2PR6A 3AGEA 3OOVA 2JE5A 2OAQ1 4KUKA 1N9OA 4MBKA 4OQGA 3UPPA 3HLWA 2CMNA 2ZQCA 4RYEA 3MQ0A 3IQAA 1TDLA 2FH5A 3V5MA 2IA2A 4DE0A 1VEUB 4HNBA 3PBSA 4EETB 2VX8A 3HLCA 2O9CA 3PBTA 3EQVA 2W3FA 1H8YA 1LT0A 4LV2A 1FR1A 5FEFA 4S2OA 4PKYG 3I7JA 5L2FA 1YT4A 2OWJA 1IYPA 3G4PA 2C5WB 3CMZA 5HX9A 4WMCA 4KENB 2H0TA 3QP5A 1MPLA 2W3HA 5FI2A 3N8LA 5FQMA 1D1JA 2QHKA 3IX8A 5EVID 4EW7A 5DJTA 2ZL1A 2KDKA 3SS5A 2BLSA 3BY8A 2IWCA 2Y2KA 4U0XA 5TR7A 4Y7PA 3ZFZA 2JBFA 4I5SA 4OH0A 4QY6A 4JF6A 1EI5A 1ES4A 3FKWA 4BENA 4KZ4A 4WELA 4QU3A 4YNRA 2HDUA 4QB8A 2XEPA 5KIZA 3DWKA 1T1AA 3PYPA 1S4SA 3HJKA 5F1FA 5F5YA 1ALQA 4PKYA 1YLPA 1NLYA 3ICYA 5L10A 3ZG7B 2A3UA 5DF7A 4MDZA 1F2KA 2JHEA 2W3EA 3DWZA 3PBOA 5IS1A 1ESIA 3NOUC 2P74A 1DJCA 2JN7A 1YSPA 1W63M 5TJJA 3BFDA 4S2LA 3BFGA 4ESPA 1ERQA 4X68A 3IXHA 4K91A 2JCHA 3BFEA 3WRTA 3NOPC 1MWUA 3LYXA 3GSGA 1XXMA 1E3UA 1SKOB 2JKTI 2V1AA 1SDNA 4GS9B 2Y2PA 4FSFA 4GKUA 4E3IA 1BTLA 2EFXA 2HJ9C 3WS4A 1S66L 5FSRA 2EA9A 4ZTKA 1YM1A 4BD0A 1G6AA 2VV6A 1M40A 4R23A 4WZ5A 1NRFA 5DTTA 1UGUA 4LRZE 1SDEA 3IBJA 2V8CA 4LRYC 2A24B 4E3NA 3EGDC 1L0DA 3KX0X 1W8QA 3BFCA 3AGDA 1TS7A 3G30A 3MKFA 3KO6A 2WKEA 4CLCD 4JGQA 2D01A 4KQRA 4EQIA 1YKDA 4C75A 4OOLA 3QNBA 3F1NB 2WKPA 2HV1A 3RFBA 3DAVA 4EEUA 1MKMA 3UNWA 1GHIA 3O88A 4B9OA 2ZM0A 4E3OA 2GX5A 1JTDA 4FCFA 4PM6A 2BG1A 1G5UA 1GCEA 2NUPC 3D72A 4PM7A 2I72A 2OLVA 4B93A 5AQAA 3RJUA 3T4QA 4YOFA 1RCJA 4MN5A 4WUJA 4L9GA 4GNUA 5FI6A 4N1XA 1G68A
chains in the Genus database with same CATH topology
4JGOA 1F9IA 3HJIA 3LUQA 3EEHA 4EERA 3LR0A 3T4JA 3UB6A 5AVFA 3VE3A 4ZRRA 1OTEA 4KQDA 4JGPA 3T4TA 5J7EA 4I38A 2EWVA 4NXBA 5HDDA 2JKRM 4RQ9A 3VV4A 5HZHA 4ARZA 3JVUA 5HDCA 5FL3A 3RTYA 4HHDA 2V1BA 1T1BA 4GHIA 3U2AA 4EXOA 3C38A 4GW9A 4UQIS 2HGVA 5TBMB 4BBTA 4YWZA 4HY8A 1Y28A 4G3KA 2Z6CA 1N9NA 3R4KA 2V0WA 4WF0A 3B42A 4IHQA 5HPFA 2W27A 3NOTC 4R3AA 3T50A 1WA9A 3W2ZA 2YKHA 1IOUA 1LSVA 4BMWA 3FC7A 3LIAA 1DP9A 4KQOA 3G6OA 1MZUA 5HSQA 1H8MA 3BY9A 1NLZA 3MMHA 3LFVA 1G6OA 2KLIA 3H9WA 1DRMA 1OTDA 4IUHA 3K3DA 2L1MA 5J4EA 2GZAA 2LB9A 3TJZC 5HD3A 3D3OA 2M7UA 1TF1A 5F69A 2A24A 3IS2A 1P9RA 4G3VA 4I3JA 3UE3A 2R78A 1XJ4A 2V9AA 1OTBA 1OTAA 4G3WA 2ZOIA 2G7UA 4Q0IA 5KSHA 3CWFA 3LIBA 2J3TD 3UB7A 4P6ZM 2P04A 3CUEC 1XJ3A 2VV7A 4L9FA 3MXQA 4CLCC 1BYWA 2PYRA 3KSFA 2ZMFA 1VHMA 3LR3A 2W1RA 1LSWA 3H7WB 3LIEA 3VE4A 2EWWA 4O0PA 4II7A 2WKQA 1S1ZA 2W3GA 4L0LA 3P01A 1P9WA 3F1OA 2A2LA 1G28A 3T4OA 5DFYA 3UB9A 3LR5A 3S7OA 4HJ4A 3T4LA 2P7JA 4K08A 2QJ5A 5AJGA 2PR5A 5DKKA 3C2WA 1T18A 3CITA 4NKPA 1NRJA 4HJ3A 3B33A 1F5MA 3A0SA 5C5KA 3LIDA 1UWNX 2FZ0A 4GLQA 3EWKA 5AVEA 1GSVA 4XT2A 2PD7A 3A0VA 2H28A 2J80A 4DN0A 5HWVA 3GDIA 3R7WB 2M1CA 4I39A 4HIAA 2INWA 2Y79A 3BWLA 1YSQA 5F68A 5IT5A 2QJ7A 2O9BA 4R6LA 4MN6A 3VOLA 2PYPA 5HWTA 1EW0A 4WN5A 3H82A 2QWSA 2KX6A 1T1CA 2XA7S 2QKPA 4F3LA 5CX7A 2P08A 3F1PB 2PDRA 4R38A 3E4PA 3EOIA 4QPRA 4BBVA 1MC0A 4GCZA 1S4RA 3ZYTA 1GSWA 2DMWA 4CLCB 2VJWA 3E0YA 4EESA 2ZBBA 4HH3A 4GS9A 1H3QA 3PR6A 5HDSA 3PBRA 5IU1A 4O8GA 4DJ2A 3KSIA 1V9YA 3JVVA 1TS0A 1XJ2A 4NXGA 3OCNA 4MN7A 1IFQA 4OOMA 1OJ5A 4ARZB 4JGRA 3T4KA 1T19A 3S7NA 2PR6A 3OOVA 4KUKA 2OAQ1 4UEYA 5DFXA 2NUTC 4NXEA 3TW8A 1N9OA 4GHIB 1JNUA 4IUKA 1D7EA 3B47A 5A8BA 4HOIA 2B02A 2CMNA 2XROA 3LICA 3MQ0A 4ME4A 3IBRA 2FH5A 3C30A 2IA2A 3OCLA 3HCYA 4FOFA 2W1TB 3TRCA 2O9AA 1STZA 3CLOA 5DF9A 4HNBA 3PBSA 5F6AA 4EETB 2VX8A 3MQQA 2OAP1 2O9CA 3PBTA 1X0OA 2J3TC 2LB5A 2W3FA 3DBAA 3EQVA 4WEKA 1LT0A 2VGLM 4HI4A 4R70A 4PKYG 2O99A 3F1NA 4HP4A 2OWJA 3PBNA 3PBQA 3C8CA 4PHTA 4ETXA 3BJNA 3IS2B 3UMDA 4H6JB 5DKLA 1XFNA 2W3HA 3S7QA 4AFIA 2QHKA 2D02A 1UWPX 1TS8A 5LBRA 5L8MA 4EW7A 1W63Q 3OBFA 5DJTA 2JKTM 2PHYA 3LI9A 2W3DA 3OC2A 2KDKA 2XSSA 4E04A 4WEJA 4P6ZS 3K2NA 4BBUA 2VLGA 3BY8A 5G4ZA 3T4SA 2MJ6A 3KYZA 4I5SA 5DJUA 5J3WA 3PHYA 3SW1A 2WKRA 3CAXA 1ZHHB 4LRXC 3KSGA 1LSXA 2Y8HA 3FPVA 4KUOA 4NXFA 4WELA 4O01A 2M7VA 2KOIA 3F1OB 4YNRA 4I3IA 1OT9A 1XFQA 5KIZA 4WLAA 3S7PA 4Q0HA 4EQ1A 1LL8A 1T1AA 2VV8A 3UE6A 3PYPA 1S4SA 3HJKA 4Z1WA 2PD8A 3BQ8A 5F5YA 4UQIM 2PT7A 3EEAA 4EUVA 4PKYA 5TBMA 4CLCA 3P7NA 4GJ4A 1D06A 1NLYA 3E4QA 2VEAA 4NEED 3ICYA 4MCWA 3MFXA 2L4RA 5HD5A 4MDZA 2GNXA 1N9LA 4XT2B 2JHEA 2W3EA 3PBOA 4BWIA 5IS1A 3NHQA 3NOUC 3LR4A 2VA0A 3KSHA 1NWZA 1DP6A 2JN7A 1YSPA 1W63M 3EGXC 1P0ZA 5TJJA 3UB8A 2K2NA 2K7SA 1S1YA 1OPXA 5I5LA 3H82B 4Y3IA 5HL6A 3RH8B 4F3LB 2O0YA 2L0WA 2OOLA 2ZOHA 4HH2A 3OLOA 2XRNA 3NOPC 2W1TA 3LYXA 3PXPA 4M4XA 4HJ6A 2YKFA 3V67A 4LPZA 2JKTI 2V1AA 2Z6DA 3O5YA 2W0NA 4GS9B 1S67L 2OWHA 4FSFA 4I3AA 4MMNA 4Y5FA 2HJ9C 3MQOA 1S66L 1XJ6A 2EA9A 4ETZA 3GECA 3BW6A 2ZMVA 5K5BA 2I9VA 3ZQ5A 4CQHA 2J3WA 3H7WA 2VV6A 4H6JA 3LIFA 3TE8A 1UGUA 4LRZE 4DJ3A 1YAXA 2GJ3A 3IBJA 1DP8A 1F98A 4LRYC 1KOUA 2A24B 3EQUA 4DMZA 3EGDC 4EU0A 5MC7A 3KX0X 3MJQA 4HQAA 4PAUA 3KYQA 3MR0A 1TS7A 4CLCE 3E4OA 4HP9A 1OT6A 1ODVA 3KO6A 4CLCD 4EEPA 3BQAA 4JGQA 3E98A 2D01A 3NJAA 2VGLS 1YKDA 4OOLA 3FG8A 4WL9A 3F1NB 3UMEA 2WKPA 2VZWA 3MF0A 4BJPA 3K3CA 2HV1A 4Y2FA 3RFBA 2B18A 2JKRI 1OJGA 4EEUA 1V9ZA 1MKMA 4LLOB 3R7WA 2K31A 1P97A 4B9OA 1OTIA 1VB6A 1ZTUA 2BASA 3CI6A 2QYBA 2HJEA 5HWWA 2GX5A 2NUPC 5G4YA 2XA7M 3D72A 3ULFA 3F1PA 3LI8A 4IJGA 4Q0JA 1GSXA 4B93A 2VKSA 5EFWA 2HF6A 3FPWA 3T4QA 3A0RA 4L9EA 4YOFA 2V0UA 1TS6A 3CUEA 4MN5A 5HPIA 4WUJA 1TD5A 4L9GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JGO A;  1F9I A;  3HJI A;  3LUQ A;  3EEH A;  4EER A;  3UB6 A;  5AVF A;  3VE3 A;  1OTE A;  4KQD A;  4JGP A;  5J7E A;  4I38 A;  4NXB A;  5HDD A;  4RQ9 A;  5HZH A;  5HDC A;  3RTY A;  4HHD A;  2V1B A;  1T1B A;  4GHI A;  4EXO A;  4GW9 A;  5TBM B;  4BBT A;  4YWZ A;  4HY8 A;  1Y28 A;  2Z6C A;  1N9N A;  2V0W A;  4WF0 A;  2W27 A;  3NOT C;  4R3A A;  3T50 A;  1WA9 A;  2YKH A;  1LSV A;  3FC7 A;  3LIA A;  1DP9 A;  5HSQ A;  3G6O A;  1MZU A;  3BY9 A;  3H9W A;  1DRM A;  1OTD A;  3K3D A;  2L1M A;  5J4E A;  5HD3 A;  5F69 A;  2A24 A;  3IS2 A;  4I3J A;  2R78 A;  1XJ4 A;  2V9A A;  1OTB A;  1OTA A;  2ZOI A;  3CWF A;  3LIB A;  3UB7 A;  2VV7 A;  1XJ3 A;  4L9F A;  3MXQ A;  1BYW A;  2PYR A;  1LSW A;  3H7W B;  3LIE A;  3VE4 A;  2WKQ A;  1S1Z A;  3F1O A;  1G28 A;  3UB9 A;  4HJ4 A;  2P7J A;  4K08 A;  2QJ5 A;  2PR5 A;  5DKK A;  3C2W A;  1T18 A;  4HJ3 A;  3B33 A;  3A0S A;  3LID A;  1UWN X;  3EWK A;  5AVE A;  1GSV A;  4XT2 A;  2PD7 A;  3A0V A;  2H28 A;  2J80 A;  5HWV A;  3GDI A;  2M1C A;  4I39 A;  4HIA A;  2INW A;  3BWL A;  5F68 A;  2QJ7 A;  4R6L A;  4MN6 A;  3VOL A;  2PYP A;  5HWT A;  1EW0 A;  4WN5 A;  3H82 A;  2QWS A;  2KX6 A;  1T1C A;  2QKP A;  4F3L A;  3F1P B;  2PDR A;  4R38 A;  3E4P A;  4BBV A;  4GCZ A;  1S4R A;  1GSW A;  4EES A;  2ZBB A;  4HH3 A;  4GS9 A;  5HDS A;  5IU1 A;  4DJ2 A;  1V9Y A;  1TS0 A;  1XJ2 A;  4NXG A;  1OJ5 A;  4JGR A;  1T19 A;  2PR6 A;  4KUK A;  4NXE A;  1N9O A;  4GHI B;  1JNU A;  1D7E A;  5A8B A;  4HOI A;  2B02 A;  2CMN A;  3LIC A;  3IBR A;  3CLO A;  4HNB A;  5F6A A;  4EET B;  3MQQ A;  1X0O A;  1LT0 A;  4HI4 A;  4R70 A;  4PKY G;  3F1N A;  4HP4 A;  2OWJ A;  3C8C A;  3IS2 B;  3UMD A;  4H6J B;  5DKL A;  1XFN A;  2QHK A;  2D02 A;  1UWP X;  1TS8 A;  4EW7 A;  5DJT A;  2PHY A;  3LI9 A;  2KDK A;  4E04 A;  4BBU A;  2VLG A;  3BY8 A;  5G4Z A;  4I5S A;  5DJU A;  5J3W A;  3PHY A;  3SW1 A;  2WKR A;  3CAX A;  4LRX C;  1LSX A;  4KUO A;  4NXF A;  3F1O B;  4I3I A;  1OT9 A;  1XFQ A;  5KIZ A;  4WLA A;  4EQ1 A;  1LL8 A;  1T1A A;  2VV8 A;  3UE6 A;  3PYP A;  1S4S A;  3HJK A;  2PD8 A;  5F5Y A;  4PKY A;  5TBM A;  3P7N A;  1D06 A;  3E4Q A;  2VEA A;  3ICY A;  3MFX A;  2L4R A;  5HD5 A;  1N9L A;  4XT2 B;  2JHE A;  5IS1 A;  3NHQ A;  3NOU C;  1NWZ A;  1DP6 A;  2JN7 A;  1P0Z A;  3UB8 A;  2K7S A;  1S1Y A;  5I5L A;  3H82 B;  3RH8 B;  4F3L B;  2L0W A;  2OOL A;  2ZOH A;  4HH2 A;  3OLO A;  3NOP C;  3LYX A;  4M4X A;  4HJ6 A;  2YKF A;  4LPZ A;  2V1A A;  2Z6D A;  2W0N A;  4GS9 B;  1S67 L;  2OWH A;  4I3A A;  3MQO A;  1S66 L;  1XJ6 A;  2EA9 A;  3GEC A;  2I9V A;  3ZQ5 A;  3H7W A;  2VV6 A;  4H6J A;  3LIF A;  1UGU A;  4LRZ E;  4DJ3 A;  2GJ3 A;  1DP8 A;  1F98 A;  4LRY C;  1KOU A;  2A24 B;  3KX0 X;  3MJQ A;  4HQA A;  3MR0 A;  1TS7 A;  3E4O A;  4HP9 A;  1OT6 A;  1ODV A;  4EEP A;  4JGQ A;  2D01 A;  3NJA A;  3FG8 A;  4WL9 A;  3F1N B;  3UME A;  2WKP A;  3K3C A;  2HV1 A;  1OJG A;  4EEU A;  1V9Z A;  4LLO B;  1P97 A;  4B9O A;  1OTI A;  1VB6 A;  2BAS A;  5HWW A;  5G4Y A;  3D72 A;  3ULF A;  3F1P A;  3LI8 A;  1GSX A;  5EFW A;  3A0R A;  4L9E A;  2V0U A;  1TS6 A;  4MN5 A;  4WUJ A;  4L9G A; 
#chains in the Genus database with same CATH topology
 4EER A;  3UB6 A;  1OTE A;  4KQD A;  3CG5 A;  4I38 A;  2H5S A;  3P09 A;  2EWV A;  4NXB A;  1CQA A;  1RGY A;  2Y2L A;  3N8R A;  5FAO A;  4ARZ A;  3DTI A;  3DTE A;  5FL3 A;  4HHD A;  3RTY A;  1LI9 A;  2PAV P;  3MXR A;  4A5R A;  3BRM A;  2HGV A;  2Q0O A;  5M18 A;  1Y28 A;  1N9N A;  4WF0 A;  3B42 A;  2W27 A;  3NOT C;  1ES2 A;  4R3A A;  3T50 A;  3W2Z A;  4KQQ A;  3VFH A;  3PAG A;  2XD5 A;  3Q81 A;  2Y91 A;  1MZU A;  2ZQA A;  2HZ5 A;  3LFV A;  1PWC A;  4ZJ3 A;  3H9W A;  3M2K A;  5FAP A;  1DRM A;  4DF6 A;  1OTD A;  1K57 C;  3TJZ C;  4E3M A;  3IT9 A;  2ZM8 A;  3HUN A;  4G3V A;  1Q2Q A;  2R78 A;  4OOY A;  1BUE A;  4FTX A;  3C7V A;  3DW0 A;  2WAF A;  5FA7 A;  3GRJ A;  2WGW B;  3LIB A;  2Q9M A;  3CUE C;  3D4F A;  1H8Z A;  1BYW A;  2Y2Q A;  2ZMF A;  1XA1 A;  4GDB A;  3UO9 A;  3H7W B;  3LIE A;  4OQH A;  5FAT A;  2EWW A;  3VE4 A;  1K4E A;  4II7 A;  2W3G A;  3QNC A;  2ZD8 A;  4JKT A;  3F1O A;  1BLC A;  2AVX A;  1VET B;  3LR5 A;  3S7O A;  1J9M A;  4HJ4 A;  1FCN A;  1JWP A;  3ZNY A;  2QJ5 A;  3VOY A;  3N4I A;  4NKP A;  1NRJ A;  1TEM A;  5GHY A;  2ZC7 A;  1HZO A;  4Y13 A;  2J80 A;  5M1A A;  3OZH A;  2ACG A;  3MSH A;  1YSQ A;  3BLM A;  3G31 A;  5IT5 A;  2QJ7 A;  4ZAM A;  4MN6 A;  3Q82 A;  1EW0 A;  4WN5 A;  3N7W A;  4F3L A;  4X25 A;  4R38 A;  2QPN A;  3TOI A;  1TVF A;  5CRF A;  1MC0 A;  5DVA A;  5J8X A;  2J9O A;  4B4X A;  1S4R A;  1PNE A;  2ZC4 B;  1L3L A;  4JF5 A;  2EXB A;  5I94 A;  4KZ8 A;  4DJ2 A;  3W4P A;  1XJ2 A;  4NXG A;  4M3K A;  4MN7 A;  4ZDX A;  2DCF A;  3V3R A;  2B5R A;  4OLD A;  2XF3 A;  1XGJ A;  4Q8I A;  5CGX A;  5DFX A;  2J7V A;  4GHI B;  5CED A;  4WM9 A;  4S2P A;  4X1L A;  1K0K A;  2ZQ8 A;  3IXB A;  4HOI A;  3GV9 A;  3MZD A;  3IBR A;  4KG6 A;  1S6R A;  3OCL A;  3HCY A;  2W1T B;  2O9A A;  1XGI A;  4X56 A;  5F6A A;  1BSG A;  4KZ7 A;  2OAP 1;  5FAQ A;  2J3T C;  3C4O A;  5G18 A;  1ONH A;  5HAR A;  4LV3 A;  3PBN A;  3GR2 A;  1GA0 A;  3IS2 B;  5CTN A;  3LEQ A;  4JPM A;  3S1Y A;  3IHA A;  1Q2P A;  2VK3 A;  3S7Q A;  1UWP X;  2V1Z A;  2H10 A;  1W63 Q;  3OBF A;  2JKT M;  4YIN A;  2W3D A;  3OC2 A;  2XR0 A;  5L09 A;  5A91 A;  1K25 A;  4DDY A;  5AQ7 A;  3KYZ A;  3PHY A;  3VMA A;  3SW1 A;  4OP8 A;  3CAX A;  4DXB A;  4S2I A;  3GQZ A;  5CGS A;  2Y8H A;  3FPV A;  1OME A;  2ZC5 B;  4KUO A;  1ZG4 A;  3IF6 C;  2M7V A;  4KZA A;  2OLU A;  4GDN A;  2WKI A;  4EQ1 A;  1M6K A;  4CJN A;  2RCX A;  4EUV A;  3EEA A;  5TBM A;  4CLC A;  1PRQ A;  5TGF A;  3UN7 A;  4NEE D;  4S2N C;  4LV0 A;  4MCW A;  2PU2 A;  3VP1 A;  2L4R A;  1K55 A;  1GHM A;  3IWO A;  3A3I A;  3VP2 A;  4XT2 B;  1LHY A;  1A0K A;  3A3E A;  3KSH A;  2G2U A;  4EWF A;  1MBL A;  3UB8 A;  1HLU P;  4ZJ2 A;  1WYC A;  2QMI A;  3QP4 A;  3M2J A;  3IF5 A;  4OQI A;  4MLL A;  3V39 A;  3H82 B;  2EX2 A;  3A3J A;  2Z2M B;  5HAQ A;  1IYO A;  2ZOH A;  4HH2 A;  3JPU A;  2UV0 E;  5EOO A;  2OSU A;  2WYX A;  4HJ6 A;  3W4Q A;  2Z6D A;  5JYO A;  1VEU A;  2RL3 A;  3IX3 A;  3ISG A;  2OWH A;  4BL2 A;  1NY0 A;  4R4S A;  4B88 A;  3IF6 B;  1PWG A;  1SZV A;  4ETZ A;  2ZMV A;  1QMF A;  2OV5 A;  3T1Q B;  3LIF A;  5FQJ A;  1W8Y A;  5A90 A;  4DJ3 A;  2GJ3 A;  1F98 A;  4FH4 A;  3EQU A;  3IHB A;  1ACF A;  3NI9 A;  5MC7 A;  4K0W A;  3LGO A;  3MR0 A;  1YLT A;  4CLC E;  3AGF A;  1ODV A;  3UPO A;  3NJA A;  3PTE A;  4S2M A;  1YMX A;  4ID4 A;  3GVB A;  3K3C A;  5E43 A;  1P97 A;  1LLB A;  3N6I A;  2QYB A;  2HJE A;  5HWW A;  1DY6 A;  4R0Q A;  2JKG A;  5G4Y A;  3FZC A;  3ULF A;  4KZB A;  3F1P A;  3LI8 A;  4IJG A;  2ZL1 B;  3C4P A;  5EV0 A;  4UA9 A;  1CJF A;  3GTC A;  3IWI A;  1K6S A;  5EFW A;  1PWD A;  3FPW A;  3ZG0 A;  3JYI A;  5CER A;  1VM1 A;  2XFS A;  4IBR A;  4MEZ A;  4IVI A;  2HDQ A;  3HLE A;  3HJI A;  1K56 A;  2XK1 A;  5DF8 A;  3LR0 A;  4ZRR A;  3OPL A;  3T4T A;  3WS0 A;  3WWX A;  3E2K A;  2JKR M;  5EOE A;  1BLH A;  1WE4 A;  4X6T A;  3VV4 A;  5EUA A;  5HZH A;  1I2W A;  2V1B A;  1KVL A;  1NYM A;  4WZ5 C;  1T1B A;  1Y4O A;  3U2A A;  4U0T A;  1PFL A;  2Z6C A;  1PI4 A;  2VGJ A;  3T1R A;  2YKH A;  4FUW A;  1IKI A;  2DRW A;  3LIA A;  4KQO A;  2P9V A;  5JYP A;  1NLZ A;  3K3D A;  4CPK A;  2GZA A;  4P0M A;  2LB9 A;  5HD3 A;  3LEZ A;  5F69 A;  2A24 A;  5HFO A;  4I3J A;  1LL5 A;  1XJ4 A;  2HDR A;  3C7U A;  1ZG6 A;  2ZOI A;  1XA7 A;  4IBX A;  4Q0I A;  5KSH A;  2H0Y A;  5AQ9 A;  2J3T D;  3UB7 A;  2P04 A;  1NJ4 A;  5FQI A;  3KSF A;  3LR3 A;  2WKQ A;  1NXY A;  3Q7V A;  1KGE A;  1KE4 A;  4RA7 A;  1IEM A;  3ZVT A;  2P7J A;  2R9W A;  4K08 A;  2PR5 A;  2IWB A;  1BLP A;  5DKK A;  1T18 A;  3A3F A;  1SKF A;  1DJB A;  4DDS A;  4N92 A;  2WAD A;  1E25 A;  4Y15 A;  4OLG A;  4F94 A;  3A0S A;  5DTK A;  3O3V A;  1XPB A;  1UWN X;  5E2F A;  4QWO A;  2E8J A;  5FQ9 A;  4E6X A;  2PD7 A;  4DN0 A;  4FD8 A;  1KGF A;  1S0W A;  3OPR A;  2FFY A;  4IVK A;  1CEF A;  4H8R A;  5CTM A;  4HBT A;  3VOL A;  2ZLY A;  4UHU A;  5HWT A;  4B4Z A;  3E4P A;  2Y2O A;  3ZYT A;  2PRF A;  4C6Y A;  5HDS A;  1BLS A;  3T1X A;  2Y2G A;  1V9Y A;  3JVV A;  3KSI A;  4OPQ A;  2J9P A;  4OKP A;  3OCN A;  3ZG9 B;  4PMA A;  5CGW A;  4ARZ B;  3T4K A;  3VSL A;  4WMC D;  5HAP A;  3G2Z A;  4NXE A;  2Q9N A;  5TFQ A;  1K4F A;  3B47 A;  4JXG A;  5A8B A;  3NDE A;  3PAE A;  3LIC A;  3Q07 A;  4GD6 A;  5E2G A;  4FOF A;  1I2S A;  1STZ A;  2X02 A;  2Y4A A;  4MBF A;  1J3W A;  4JF4 A;  3MQQ A;  1X0O A;  2LB5 A;  4WEK A;  3ZNT A;  4PM5 A;  4HI4 A;  3QP1 A;  1N4O A;  1W79 A;  2ZQD A;  3HL9 A;  3PBQ A;  4NET A;  5A92 A;  4ETX A;  3UMD A;  4H6J B;  3G32 A;  5DKL A;  1XFN A;  2DNS A;  5FEG A;  2J8Y A;  1H0M A;  1Y54 A;  4AFI A;  5LBR A;  1TS8 A;  5L8M A;  3NY4 A;  5KSC A;  3UDI A;  4E6W A;  3P98 A;  4WYY A;  4X1M A;  3LI9 A;  3UE1 A;  1PI5 A;  3WS1 A;  1YLZ A;  4WEJ A;  3M6H A;  2XH9 A;  4EBN A;  4PM8 A;  3K2N A;  1K38 A;  4Y0U A;  4BBU A;  1KE3 A;  2VLG A;  3T4S A;  2MJ6 A;  3S4X A;  1K57 A;  5DJU A;  5J3W A;  2WKR A;  1LI0 A;  1ZHH B;  3QP2 A;  4GB7 A;  4LRX C;  2ZM2 A;  4NXF A;  3SH8 A;  3F1O B;  1OT9 A;  3VP4 A;  1RP5 A;  4Q0H A;  2VV8 A;  4BL3 A;  1BT5 A;  5EVI A;  4UQI M;  2PT7 A;  1E3U D;  3P7N A;  4GJ4 A;  1D06 A;  1LL9 A;  4P87 A;  3MFX A;  3LCE A;  3BEC A;  5HW3 A;  2V20 A;  1N9L A;  3S22 A;  4BWI A;  1FOF A;  1DP6 A;  5CEB A;  5EM1 A;  1KDW A;  2Y2J A;  1S1Y A;  1OPX A;  5I5L A;  3BFF A;  4Y3I A;  4F3L B;  2O0Y A;  4XUX A;  1IKG A;  3WS2 A;  3OLO A;  1KE0 A;  1ZKJ A;  2W1T A;  4M4X A;  2YKF A;  3V67 A;  1XKZ A;  1EWZ A;  4I3A A;  1HD8 A;  1KDS A;  4Y5F A;  3N8S A;  3MQO A;  3BLS A;  4R3B A;  4X55 A;  1WYB A;  5BOH A;  4O7D A;  2UWX A;  2I9V A;  4CQH A;  2J3W A;  3D9Y A;  4KZ6 A;  1L0E A;  5A93 A;  3HLB A;  2XFT A;  1DP8 A;  3L9K A;  1KOU A;  2JKF A;  2ZMA A;  2ZC3 B;  3MJQ A;  3LY3 A;  4DXC A;  2EFU A;  1FCM A;  4MNR A;  3LO7 A;  2G2W A;  3BQA A;  4EEP A;  3E98 A;  3UY6 A;  2E8I A;  1JTG A;  5F82 A;  1K55 C;  4DRT A;  1IEL A;  4N9L A;  5AQB A;  1OJG A;  1V9Z A;  4LLO B;  3R7W A;  2K31 A;  1RGZ A;  1OTI A;  1ZTU A;  4QJG A;  4JLF A;  4OP5 A;  1YLJ A;  1XX2 A;  3CI6 A;  3OPP A;  1K54 A;  1ERM A;  4P85 A;  2IWD A;  1BUL A;  3CPT A;  5HL1 A;  2XA7 M;  3HLF A;  4OPY A;  2HP6 A;  1GSX A;  1ESU A;  2VKS A;  2ZQ7 A;  3MXS A;  2V0U A;  5GLC A;  5HPI A;  3OPH A;  1TD5 A;  3UB5 P;  1TDG A;  3QP6 A;  2CC1 A;  3LUQ A;  1MXO A;  3NIA A;  2EXA A;  3T4J A;  5AVF A;  3HLD A;  3IWQ A;  4N1H A;  3FV7 A;  1GHP A;  5HDD A;  4OQ0 A;  5GL9 A;  5FDH A;  1ES3 A;  4ZBE A;  4FH2 A;  2Y55 A;  1Z09 A;  1ZC2 A;  4EXO A;  3C38 A;  4GW9 A;  1ERO A;  4UQI S;  4QY5 A;  2XLN A;  1C3B A;  5TBM B;  4YFM A;  4PPR A;  3R4K A;  1N9B A;  5HPF A;  2WKH A;  3WS5 A;  3ZGA B;  5FDS A;  1WA9 A;  3Q7Z A;  3ZVW A;  1PW1 A;  2WZX A;  3FYZ A;  4HEF A;  3DTK A;  4E3J A;  5FI7 A;  1L2S A;  1QME A;  4BMW A;  3FC7 A;  5GLD A;  5EE8 A;  1ES5 A;  5HSQ A;  1H8M A;  3IH9 A;  1PW8 A;  3MMH A;  3BM6 A;  2KLI A;  3VOZ A;  4DE3 A;  4KG5 A;  2L1M A;  4LCL A;  1TF1 A;  4S2N A;  3UE3 A;  4LEN A;  4BQM A;  1OTB A;  4NG2 A;  2G7U A;  3HBR A;  1MWT A;  3TSG A;  4RX2 A;  3CWF A;  4OPR A;  4K0X A;  4S2K A;  3V3S A;  4P6Z M;  3GMW A;  4XUZ A;  3KYE A;  2X01 A;  3O87 A;  2PYR A;  1Z6F A;  3DTM A;  1LSW A;  5CEC A;  4O0P A;  3TG9 A;  1S1Z A;  2PBD P;  5KMW A;  2WUQ A;  3P01 A;  1P9W A;  4Y0T A;  1G28 A;  5DFY A;  2HPB A;  4JXS A;  2PU4 A;  4EUZ A;  1GA9 A;  4EV4 A;  2WGV A;  2WZZ A;  3B33 A;  4PM9 A;  3NC8 A;  2Z2L B;  4GLQ A;  1FSY A;  1JWZ A;  3A0V A;  2H28 A;  3ZG8 B;  4EBP A;  1O07 A;  5HWV A;  4I39 A;  3ZCZ A;  2Y79 A;  5EM0 A;  2O9B A;  2HDS A;  4R6L A;  1YPR A;  2EX8 A;  2QWS A;  1MKI A;  2XA7 S;  3F1P B;  3BYD A;  1K6R A;  4QPR A;  1XP4 A;  4UA7 A;  4E3L A;  3U4L P;  2BTF P;  2Y2N A;  4KZ5 A;  1GSW A;  2DMW A;  1SKO A;  2VJW A;  3NUL A;  4D60 A;  4EES A;  4GS9 A;  3VP0 A;  3Q1F A;  5IU1 A;  2V2F F;  1TS0 A;  2VGK A;  4OOM A;  1OJ5 A;  1NYY A;  4N9K A;  5EPH A;  4JGR A;  4X53 A;  3RXW A;  1T19 A;  3S7N A;  1IYQ A;  4LFU A;  4UEY A;  2NUT C;  3TW8 A;  4IUK A;  1JNU A;  1D7E A;  4GD8 A;  2B02 A;  2XRO A;  1FCO A;  4ME4 A;  1NZU A;  1I5Q A;  4DE2 A;  3C30 A;  3WRZ A;  4RVA A;  3TRC A;  1AXB A;  3CLO A;  1JWV A;  5DF9 A;  5HAI A;  3NDG A;  2P9V B;  2FFF B;  3DBA A;  3MZF A;  2VGL M;  4R70 A;  2O99 A;  3F1N A;  4HP4 A;  3G2Y A;  5KZH A;  3C8C A;  2GDN A;  4IED A;  4PHT A;  2JC7 A;  4JXV A;  3BJN A;  3MS6 A;  1IYS A;  5EVE A;  4GZB A;  2D02 A;  1CI8 A;  1VQQ A;  3T12 B;  2PHY A;  2XSS A;  4E04 A;  4P6Z S;  3CHW P;  1MWS A;  5G4Z A;  5CXW A;  4E3K A;  2XD1 A;  3A3D A;  4JXW A;  4NK3 A;  3KSG A;  1LSX A;  3Q7V B;  3G34 A;  4O01 A;  1NZO A;  2KOI A;  4I3I A;  1XFQ A;  4Y17 A;  3B3X A;  3ZG5 A;  3SOI A;  4WLA A;  3S7P A;  4D2O A;  1LL8 A;  1U60 A;  3UE6 A;  3O86 A;  4Z1W A;  2PD8 A;  3BQ8 A;  1JVJ A;  4LV1 A;  4UAA A;  4OVD A;  4R4R A;  3E4Q A;  2VEA A;  4OON A;  5HD5 A;  3ZDJ A;  2GNX A;  3QHY A;  3HLG A;  5EVL A;  5M19 A;  1YMS A;  3NHQ A;  3CJM A;  3SH9 A;  3LR4 A;  2VA0 A;  1NWZ A;  3EGX C;  2XDM A;  1P0Z A;  5IHV A;  3MZE A;  4RX3 A;  4KG2 A;  2K2N A;  2K7S A;  5HL6 A;  1PZP A;  3NCK A;  3RH8 B;  2L0W A;  2OOL A;  1PYY A;  2XRN A;  1CEG A;  3PXP A;  4LPZ A;  3LY4 A;  3O5Y A;  2W0N A;  1S67 L;  3VP3 A;  2WGW A;  1E4D A;  4HES A;  4MMN A;  3W8K A;  3MKE A;  1XJ6 A;  3GEC A;  3BW6 A;  4EBL A;  5K5B A;  3ZQ5 A;  3H7W A;  3HUM A;  4H6J A;  3TE8 A;  2QZ6 A;  4JBF A;  1YAX A;  1VET A;  4DMZ A;  1ONG A;  5L07 A;  3T1S A;  4EU0 A;  3UDF A;  4OPZ A;  4HQA A;  2Y2M A;  3MFD A;  4PAU A;  3KYQ A;  4BD1 A;  1W7F A;  5EVI C;  1MWR A;  5GHZ A;  3E4O A;  1FSW A;  4HP9 A;  1OT6 A;  1BZA A;  5DTS A;  5E2H A;  2VGL S;  4BLM A;  3L7H A;  1YLY A;  1K56 D;  3FG8 A;  4WL9 A;  3UME A;  2VZW A;  3MF0 A;  2Y2H A;  4BJP A;  4Y2F A;  2B18 A;  2EX6 A;  2JKR I;  5CHJ A;  1W5D A;  1VB6 A;  2WGI A;  2BAS A;  4R1G A;  1SHV A;  2V8F A;  2A49 A;  3VSK A;  2B95 A;  1AWI A;  3ITA A;  4XXR A;  4KZ9 A;  4R3J A;  3W4O A;  3RXX A;  5U47 A;  4Q0J A;  5GLB A;  2HF6 A;  3A0R A;  4L9E A;  1DJA A;  3IH8 A;  1TS6 A;  3CUE A;  4LGW A;  5GHX A;  4JGO A;  1F9I A;  3EEH A;  2PBY A;  1PZO A;  3UDX A;  2C6W B;  5E2E A;  2X71 A;  3C5A A;  3CZD A;  3VE3 A;  4JGP A;  5J7E A;  1FR6 A;  3E2L A;  1FIK A;  3SH7 A;  4RQ9 A;  1L0G A;  4QHC A;  3JVU A;  5HDC A;  5GLA A;  4QD4 A;  4UA6 A;  4GHI A;  5EVI B;  3VFF A;  4U3T A;  4BBT A;  4YWZ A;  4HY8 A;  4G3K A;  3M6B A;  2V0W A;  4IHQ A;  1HTZ A;  4Z9Q A;  1YLW A;  3BEB A;  2HP5 A;  2ZC6 B;  1IOU A;  1HVB A;  1LSV A;  1DP9 A;  3G6O A;  4WZ4 A;  5F1G A;  3BY9 A;  3HRE A;  1G6O A;  3IXG A;  3IXD A;  4HBU A;  4IUH A;  5CHM A;  5J4E A;  2XGN A;  5D3O A;  1H5X A;  3D3O A;  2M7U A;  4GN2 A;  2Y59 A;  3IS2 A;  1P9R A;  4S2J A;  1K54 C;  3G35 A;  4WBG A;  2V9A A;  4LCM A;  3SZT A;  3ITB A;  1OTA A;  4G3W A;  3QP8 A;  4X69 A;  2WK0 A;  5EEC A;  2VV7 A;  1XJ3 A;  4L9F A;  3MXQ A;  4CLC C;  3SS3 A;  1VHM A;  2W1R A;  1CF0 A;  1YQS A;  4KZ3 A;  1FQG A;  3NBL A;  4L0L A;  1SCW A;  4GOG A;  2A2L A;  5CHU A;  2ZJ9 A;  3T4O A;  3UB9 A;  4DKI A;  5F83 A;  3V50 A;  3T4L A;  3NEC A;  3HUO A;  5AJG A;  3C2W A;  2EX9 A;  3CIT A;  4HJ3 A;  5FAS A;  1F5M A;  4Y0O A;  5C5K A;  3LID A;  2Y2I A;  2FZ0 A;  3FWL A;  2HP9 A;  3EWK A;  5AVE A;  1GSV A;  4XT2 A;  1PIO A;  1O7E A;  2R9X A;  3IX4 A;  3GDI A;  3R7W B;  2M1C A;  1KVM A;  4HIA A;  3ZHH A;  1KGG A;  3UE0 A;  2INW A;  2ZQ9 A;  3BWL A;  5F68 A;  2XQZ A;  3HVF A;  4MBH A;  2PYP A;  1L0F A;  1MY8 A;  3H82 A;  2KX6 A;  1T1C A;  3CPT B;  2QKP A;  5CX7 A;  2P08 A;  2PDR A;  3EOI A;  1CI9 A;  5FQQ A;  4BBV A;  4GCZ A;  3SS4 A;  3MBZ A;  4CLC B;  3E0Y A;  4P6B A;  2ZBB A;  4HH3 A;  1H3Q A;  3PR6 A;  3PBR A;  3FKV A;  4C3Q A;  4O8G A;  4ZJ1 A;  2WAE A;  3IF6 A;  3UPN A;  1IFQ A;  1FIL A;  4DE1 A;  1CK3 A;  5FQK A;  2PR6 A;  3AGE A;  3OOV A;  2JE5 A;  2OAQ 1;  4KUK A;  1N9O A;  4MBK A;  4OQG A;  3UPP A;  3HLW A;  2CMN A;  2ZQC A;  4RYE A;  3MQ0 A;  3IQA A;  1TDL A;  2FH5 A;  3V5M A;  2IA2 A;  4DE0 A;  1VEU B;  4HNB A;  3PBS A;  4EET B;  2VX8 A;  3HLC A;  2O9C A;  3PBT A;  3EQV A;  2W3F A;  1H8Y A;  1LT0 A;  4LV2 A;  1FR1 A;  5FEF A;  4S2O A;  4PKY G;  3I7J A;  5L2F A;  1YT4 A;  2OWJ A;  1IYP A;  3G4P A;  2C5W B;  3CMZ A;  5HX9 A;  4WMC A;  4KEN B;  2H0T A;  3QP5 A;  1MPL A;  2W3H A;  5FI2 A;  3N8L A;  5FQM A;  1D1J A;  2QHK A;  3IX8 A;  5EVI D;  4EW7 A;  5DJT A;  2ZL1 A;  2KDK A;  3SS5 A;  2BLS A;  3BY8 A;  2IWC A;  2Y2K A;  4U0X A;  5TR7 A;  4Y7P A;  3ZFZ A;  2JBF A;  4I5S A;  4OH0 A;  4QY6 A;  4JF6 A;  1EI5 A;  1ES4 A;  3FKW A;  4BEN A;  4KZ4 A;  4WEL A;  4QU3 A;  4YNR A;  2HDU A;  4QB8 A;  2XEP A;  5KIZ A;  3DWK A;  1T1A A;  3PYP A;  1S4S A;  3HJK A;  5F1F A;  5F5Y A;  1ALQ A;  4PKY A;  1YLP A;  1NLY A;  3ICY A;  5L10 A;  3ZG7 B;  2A3U A;  5DF7 A;  4MDZ A;  1F2K A;  2JHE A;  2W3E A;  3DWZ A;  3PBO A;  5IS1 A;  1ESI A;  3NOU C;  2P74 A;  1DJC A;  2JN7 A;  1YSP A;  1W63 M;  5TJJ A;  3BFD A;  4S2L A;  3BFG A;  4ESP A;  1ERQ A;  4X68 A;  3IXH A;  4K91 A;  2JCH A;  3BFE A;  3WRT A;  3NOP C;  1MWU A;  3LYX A;  3GSG A;  1XXM A;  1E3U A;  1SKO B;  2JKT I;  2V1A A;  1SDN A;  4GS9 B;  2Y2P A;  4FSF A;  4GKU A;  4E3I A;  1BTL A;  2EFX A;  2HJ9 C;  3WS4 A;  1S66 L;  5FSR A;  2EA9 A;  4ZTK A;  1YM1 A;  4BD0 A;  1G6A A;  2VV6 A;  1M40 A;  4R23 A;  4WZ5 A;  1NRF A;  5DTT A;  1UGU A;  4LRZ E;  1SDE A;  3IBJ A;  2V8C A;  4LRY C;  2A24 B;  4E3N A;  3EGD C;  1L0D A;  3KX0 X;  1W8Q A;  3BFC A;  3AGD A;  1TS7 A;  3G30 A;  3MKF A;  3KO6 A;  2WKE A;  4CLC D;  4JGQ A;  2D01 A;  4KQR A;  4EQI A;  1YKD A;  4C75 A;  4OOL A;  3QNB A;  3F1N B;  2WKP A;  2HV1 A;  3RFB A;  3DAV A;  4EEU A;  1MKM A;  3UNW A;  1GHI A;  3O88 A;  4B9O A;  2ZM0 A;  4E3O A;  2GX5 A;  1JTD A;  4FCF A;  4PM6 A;  2BG1 A;  1G5U A;  1GCE A;  2NUP C;  3D72 A;  4PM7 A;  2I72 A;  2OLV A;  4B93 A;  5AQA A;  3RJU A;  3T4Q A;  4YOF A;  1RCJ A;  4MN5 A;  4WUJ A;  4L9G A;  4GNU A;  5FI6 A;  4N1X A;  1G68 A; 
#chains in the Genus database with same CATH homology
 4JGO A;  1F9I A;  3HJI A;  3LUQ A;  3EEH A;  4EER A;  3LR0 A;  3T4J A;  3UB6 A;  5AVF A;  3VE3 A;  4ZRR A;  1OTE A;  4KQD A;  4JGP A;  3T4T A;  5J7E A;  4I38 A;  2EWV A;  4NXB A;  5HDD A;  2JKR M;  4RQ9 A;  3VV4 A;  5HZH A;  4ARZ A;  3JVU A;  5HDC A;  5FL3 A;  3RTY A;  4HHD A;  2V1B A;  1T1B A;  4GHI A;  3U2A A;  4EXO A;  3C38 A;  4GW9 A;  4UQI S;  2HGV A;  5TBM B;  4BBT A;  4YWZ A;  4HY8 A;  1Y28 A;  4G3K A;  2Z6C A;  1N9N A;  3R4K A;  2V0W A;  4WF0 A;  3B42 A;  4IHQ A;  5HPF A;  2W27 A;  3NOT C;  4R3A A;  3T50 A;  1WA9 A;  3W2Z A;  2YKH A;  1IOU A;  1LSV A;  4BMW A;  3FC7 A;  3LIA A;  1DP9 A;  4KQO A;  3G6O A;  1MZU A;  5HSQ A;  1H8M A;  3BY9 A;  1NLZ A;  3MMH A;  3LFV A;  1G6O A;  2KLI A;  3H9W A;  1DRM A;  1OTD A;  4IUH A;  3K3D A;  2L1M A;  5J4E A;  2GZA A;  2LB9 A;  3TJZ C;  5HD3 A;  3D3O A;  2M7U A;  1TF1 A;  5F69 A;  2A24 A;  3IS2 A;  1P9R A;  4G3V A;  4I3J A;  3UE3 A;  2R78 A;  1XJ4 A;  2V9A A;  1OTB A;  1OTA A;  4G3W A;  2ZOI A;  2G7U A;  4Q0I A;  5KSH A;  3CWF A;  3LIB A;  2J3T D;  3UB7 A;  4P6Z M;  2P04 A;  3CUE C;  1XJ3 A;  2VV7 A;  4L9F A;  3MXQ A;  4CLC C;  1BYW A;  2PYR A;  3KSF A;  2ZMF A;  1VHM A;  3LR3 A;  2W1R A;  1LSW A;  3H7W B;  3LIE A;  3VE4 A;  2EWW A;  4O0P A;  4II7 A;  2WKQ A;  1S1Z A;  2W3G A;  4L0L A;  3P01 A;  1P9W A;  3F1O A;  2A2L A;  1G28 A;  3T4O A;  5DFY A;  3UB9 A;  3LR5 A;  3S7O A;  4HJ4 A;  3T4L A;  2P7J A;  4K08 A;  2QJ5 A;  5AJG A;  2PR5 A;  5DKK A;  3C2W A;  1T18 A;  3CIT A;  4NKP A;  1NRJ A;  4HJ3 A;  3B33 A;  1F5M A;  3A0S A;  5C5K A;  3LID A;  1UWN X;  2FZ0 A;  4GLQ A;  3EWK A;  5AVE A;  1GSV A;  4XT2 A;  2PD7 A;  3A0V A;  2H28 A;  2J80 A;  4DN0 A;  5HWV A;  3GDI A;  3R7W B;  2M1C A;  4I39 A;  4HIA A;  2INW A;  2Y79 A;  3BWL A;  1YSQ A;  5F68 A;  5IT5 A;  2QJ7 A;  2O9B A;  4R6L A;  4MN6 A;  3VOL A;  2PYP A;  5HWT A;  1EW0 A;  4WN5 A;  3H82 A;  2QWS A;  2KX6 A;  1T1C A;  2XA7 S;  2QKP A;  4F3L A;  5CX7 A;  2P08 A;  3F1P B;  2PDR A;  4R38 A;  3E4P A;  3EOI A;  4QPR A;  4BBV A;  1MC0 A;  4GCZ A;  1S4R A;  3ZYT A;  1GSW A;  2DMW A;  4CLC B;  2VJW A;  3E0Y A;  4EES A;  2ZBB A;  4HH3 A;  4GS9 A;  1H3Q A;  3PR6 A;  5HDS A;  3PBR A;  5IU1 A;  4O8G A;  4DJ2 A;  3KSI A;  1V9Y A;  3JVV A;  1TS0 A;  1XJ2 A;  4NXG A;  3OCN A;  4MN7 A;  1IFQ A;  4OOM A;  1OJ5 A;  4ARZ B;  4JGR A;  3T4K A;  1T19 A;  3S7N A;  2PR6 A;  3OOV A;  4KUK A;  2OAQ 1;  4UEY A;  5DFX A;  2NUT C;  4NXE A;  3TW8 A;  1N9O A;  4GHI B;  1JNU A;  4IUK A;  1D7E A;  3B47 A;  5A8B A;  4HOI A;  2B02 A;  2CMN A;  2XRO A;  3LIC A;  3MQ0 A;  4ME4 A;  3IBR A;  2FH5 A;  3C30 A;  2IA2 A;  3OCL A;  3HCY A;  4FOF A;  2W1T B;  3TRC A;  2O9A A;  1STZ A;  3CLO A;  5DF9 A;  4HNB A;  3PBS A;  5F6A A;  4EET B;  2VX8 A;  3MQQ A;  2OAP 1;  2O9C A;  3PBT A;  1X0O A;  2J3T C;  2LB5 A;  2W3F A;  3DBA A;  3EQV A;  4WEK A;  1LT0 A;  2VGL M;  4HI4 A;  4R70 A;  4PKY G;  2O99 A;  3F1N A;  4HP4 A;  2OWJ A;  3PBN A;  3PBQ A;  3C8C A;  4PHT A;  4ETX A;  3BJN A;  3IS2 B;  3UMD A;  4H6J B;  5DKL A;  1XFN A;  2W3H A;  3S7Q A;  4AFI A;  2QHK A;  2D02 A;  1UWP X;  1TS8 A;  5LBR A;  5L8M A;  4EW7 A;  1W63 Q;  3OBF A;  5DJT A;  2JKT M;  2PHY A;  3LI9 A;  2W3D A;  3OC2 A;  2KDK A;  2XSS A;  4E04 A;  4WEJ A;  4P6Z S;  3K2N A;  4BBU A;  2VLG A;  3BY8 A;  5G4Z A;  3T4S A;  2MJ6 A;  3KYZ A;  4I5S A;  5DJU A;  5J3W A;  3PHY A;  3SW1 A;  2WKR A;  3CAX A;  1ZHH B;  4LRX C;  3KSG A;  1LSX A;  2Y8H A;  3FPV A;  4KUO A;  4NXF A;  4WEL A;  4O01 A;  2M7V A;  2KOI A;  3F1O B;  4YNR A;  4I3I A;  1OT9 A;  1XFQ A;  5KIZ A;  4WLA A;  3S7P A;  4Q0H A;  4EQ1 A;  1LL8 A;  1T1A A;  2VV8 A;  3UE6 A;  3PYP A;  1S4S A;  3HJK A;  4Z1W A;  2PD8 A;  3BQ8 A;  5F5Y A;  4UQI M;  2PT7 A;  3EEA A;  4EUV A;  4PKY A;  5TBM A;  4CLC A;  3P7N A;  4GJ4 A;  1D06 A;  1NLY A;  3E4Q A;  2VEA A;  4NEE D;  3ICY A;  4MCW A;  3MFX A;  2L4R A;  5HD5 A;  4MDZ A;  2GNX A;  1N9L A;  4XT2 B;  2JHE A;  2W3E A;  3PBO A;  4BWI A;  5IS1 A;  3NHQ A;  3NOU C;  3LR4 A;  2VA0 A;  3KSH A;  1NWZ A;  1DP6 A;  2JN7 A;  1YSP A;  1W63 M;  3EGX C;  1P0Z A;  5TJJ A;  3UB8 A;  2K2N A;  2K7S A;  1S1Y A;  1OPX A;  5I5L A;  3H82 B;  4Y3I A;  5HL6 A;  3RH8 B;  4F3L B;  2O0Y A;  2L0W A;  2OOL A;  2ZOH A;  4HH2 A;  3OLO A;  2XRN A;  3NOP C;  2W1T A;  3LYX A;  3PXP A;  4M4X A;  4HJ6 A;  2YKF A;  3V67 A;  4LPZ A;  2JKT I;  2V1A A;  2Z6D A;  3O5Y A;  2W0N A;  4GS9 B;  1S67 L;  2OWH A;  4FSF A;  4I3A A;  4MMN A;  4Y5F A;  2HJ9 C;  3MQO A;  1S66 L;  1XJ6 A;  2EA9 A;  4ETZ A;  3GEC A;  3BW6 A;  2ZMV A;  5K5B A;  2I9V A;  3ZQ5 A;  4CQH A;  2J3W A;  3H7W A;  2VV6 A;  4H6J A;  3LIF A;  3TE8 A;  1UGU A;  4LRZ E;  4DJ3 A;  1YAX A;  2GJ3 A;  3IBJ A;  1DP8 A;  1F98 A;  4LRY C;  1KOU A;  2A24 B;  3EQU A;  4DMZ A;  3EGD C;  4EU0 A;  5MC7 A;  3KX0 X;  3MJQ A;  4HQA A;  4PAU A;  3KYQ A;  3MR0 A;  1TS7 A;  4CLC E;  3E4O A;  4HP9 A;  1OT6 A;  1ODV A;  3KO6 A;  4CLC D;  4EEP A;  3BQA A;  4JGQ A;  3E98 A;  2D01 A;  3NJA A;  2VGL S;  1YKD A;  4OOL A;  3FG8 A;  4WL9 A;  3F1N B;  3UME A;  2WKP A;  2VZW A;  3MF0 A;  4BJP A;  3K3C A;  2HV1 A;  4Y2F A;  3RFB A;  2B18 A;  2JKR I;  1OJG A;  4EEU A;  1V9Z A;  1MKM A;  4LLO B;  3R7W A;  2K31 A;  1P97 A;  4B9O A;  1OTI A;  1VB6 A;  1ZTU A;  2BAS A;  3CI6 A;  2QYB A;  2HJE A;  5HWW A;  2GX5 A;  2NUP C;  5G4Y A;  2XA7 M;  3D72 A;  3ULF A;  3F1P A;  3LI8 A;  4IJG A;  4Q0J A;  1GSX A;  4B93 A;  2VKS A;  5EFW A;  2HF6 A;  3FPW A;  3T4Q A;  3A0R A;  4L9E A;  4YOF A;  2V0U A;  1TS6 A;  3CUE A;  4MN5 A;  5HPI A;  4WUJ A;  1TD5 A;  4L9G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...