5J4EA

Crystal structures reveal signaling states of a short blue light photoreceptor protein ppsb1-lov (photoexcited state)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
133
structure length
133
Chain Sequence
MINAQLLQSMVDASNDGIVVAEKEGDDTILIYVNAAFEYLTGYSRDEILYQDCRFLQGDDRDQLGRARIRKAMAEGRPCREVLRNYRKDGSAFWNELSITPVKSDFDQRTYFIGIQKDVSRQVELERELAELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Sensory box protein
publication title Signaling States of a Short Blue-Light Photoreceptor Protein PpSB1-LOV Revealed from Crystal Structures and Solution NMR Spectroscopy.
pubmed doi rcsb
source organism Pseudomonas putida
total genus 35
structure length 133
sequence length 133
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5j4eA00
4I38A 1P97A 4EEUA 3LIDA 3PHYA 4GW9A 4L9GA 2HV1A 2VV7A 1XJ4A 1S4RA 1N9OA 4HP4A 5G4ZA 3GDIA 5J4EA 2BASA 5AVFA 1OJGA 1OTBA 1TS0A 2QKPA 4HIAA 4L9EA 2ZOHA 1OTEA 3F1PA 3LICA 4EERA 4DJ2A 4BBVA 5DJUA 1ODVA 3F1PB 2JN7A 3LIAA 3GECA 2VEAA 2PR5A 3G6OA 1EW0A 2KDKA 3LI9A 2P7JA 2J80A 1KOUA 4I39A 3UB9A 2PD7A 2EA9A 2ZOIA 4R3AA 2GJ3A 3H9WA 3LIBA 1S4SA 1UWNX 2V9AA 3A0VA 3OLOA 1Y28A 1LSXA 1OT6A 3IBRA 5HWTA 4F3LA 3MQOA 1OTAA 4PKYA 4F3LB 4WF0A 1OT9A 4NXBA 1GSXA 1T1AA 3RTYA 4GHIA 3NHQA 4H6JA 1OTDA 2V0UA 4GHIB 4R70A 2L1MA 1LSVA 4H6JB 5AVEA 2VV6A 5F69A 4HNBA 3VE4A 2PR6A 4R38A 3SW1A 4HP9A 2OWHA 3H7WA 1GSWA 1T1BA 5I5LA 3H7WB 1DP9A 4KUOA 4HH3A 2Z6CA 1MZUA 2OWJA 5TBMA 5HDDA 2INWA 2WKPA 3UB6A 1GSVA 5TBMB 3K3CA 5DKKA 3BWLA 4DJ3A 3T50A 4HHDA 1X0OA 2VLGA 3KX0X 1BYWA 1DP6A 1XJ6A 5F6AA 3CLOA 3H82A 4GS9A 4BBUA 4NXEA 1T1CA 5J3WA 3A0RA 2A24A 4HY8A 2W27A 5HD3A 2OOLA 1F98A 3H82B 3NOUC 4GS9B 5EFWA 2PD8A 2A24B 3NOPC 2V0WA 5IS1A 3MJQA 2L0WA 3MR0A 3MXQA 5G4YA 1TS6A 4JGQA 1T18A 3HJIA 1N9NA 3BY9A 3UB7A 2YKHA 3EEHA 4I3IA 3K3DA 4E04A 1P0ZA 4RQ9A 3VOLA 5HSQA 3E4PA 1LT0A 3MFXA 2D02A 5KIZA 5DKLA 4WUJA 1S1YA 4LRZE 2WKQA 3LIEA 3F1OA 4NXGA 5HD5A 1N9LA 4GCZA 3F1OB 1XFNA 3E4OA 3RH8B 1F9IA 2CMNA 4JGPA 4WL9A 2JHEA 2R78A 4JGRA 4HQAA 3LI8A 1WA9A 4HOIA 3LUQA 4HH2A 4I5SA 5J7EA 3UMEA 3FC7A 2K7SA 4EETB 2H28A 4B9OA 3E4QA 5IU1A 4MN6A 4WN5A 1V9YA 1UGUA 2V1BA 1DRMA 1G28A 3UMDA 4LRXC 4HJ3A 2L4RA 3PYPA 2QHKA 4MN5A 4WLAA 4YWZA 3CWFA 5HWVA 1XJ2A 2YKFA 5HDSA 3UE6A 4EESA 2Z6DA 5HWWA 4LRYC 1LL8A 4M4XA 2I9VA 4EQ1A 3LIFA 1LSWA 4K08A 5F68A 1XFQA 3B33A 1D06A 3C2WA 2QWSA 3FG8A 1OJ5A 3P7NA 4R6LA 1D7EA 1NWZA 2M1CA 4KQDA 3C8CA 4BBTA 4HI4A 1S66L 3CAXA 2KX6A 4HJ4A 3LYXA 2PYRA 1VB6A 4KUKA 5A8BA 3ICYA 3VE3A 1TS7A 3D72A 3ULFA 3NJAA 5F5YA 2PDRA 2D01A 2VV8A 4EW7A 3HJKA 3IS2A 3UB8A 1OTIA 1TS8A 3ZQ5A 3IS2B 3BY8A 3EWKA 5HDCA 2W0NA 3NOTC 1V9ZA 2B02A 2WKRA 3A0SA 4HJ6A 1UWPX 4LLOB 4JGOA 3MQQA 2V1AA 5HZHA 1JNUA 4I3AA 4NXFA 4LPZA 5DJTA 4PKYG 2ZBBA 4I3JA 4EXOA 1XJ3A 1S1ZA 4L9FA 4EEPA 2PHYA 2QJ5A 3F1NA 3F1NB 1S67L 2PYPA 1T19A 4XT2A 1DP8A 4XT2B 2QJ7A
chains in the Genus database with same CATH superfamily
4RVAA 1PRQA 1MBLA 4I38A 4U0TA 3S7NA 1ERQA 4D60A 1GA0A 5E43A 1ZHHB 1KDSA 4L9GA 1XJ4A 1S4RA 1WYBA 2R9WA 1K25A 1CK3A 3PTEA 5JYOA 3GDIA 4N1HA 1NRFA 3SS4A 4IHQA 5E2FA 4P6ZM 4BLMA 5AVFA 4BL3A 1TS0A 5CTNA 3SZTA 3MKEA 4L9EA 2V2FF 1E4DA 4CLCC 5FDHA 4G3VA 3LY3A 4DJ2A 3JVUA 2EWVA 3F1PB 2VK3A 1YMXA 1ES3A 1FSYA 3LIAA 1YMSA 3VSKA 2JE5A 3EEAA 4PHTA 2Y59A 5AQ9A 3MZFA 4BJPA 3G2ZA 2P7JA 2PD7A 3UPPA 2PU2A 2ZMFA 3G34A 2NUPC 5BOHA 5DTSA 2ZC6B 1W8QA 1LSXA 2J3WA 2FZ0A 5FASA 2HDUA 5HWTA 3G35A 4KG5A 1OTAA 1YAXA 3R7WA 5L2FA 4WF0A 3MXSA 2BTFP 1T1AA 4GHIA 3LR3A 1FSWA 4B93A 1FCOA 4GKUA 5AVEA 2WGWB 1LHYA 4O0PA 4IVKA 4N1XA 5E2EA 1NY0A 2DCFA 3BQ8A 3FKWA 1GSWA 3MS6A 5I5LA 1TF1A 1FR1A 2A2LA 5CXWA 1KGEA 5M19A 2WYXA 1NYYA 2VX8A 3OPHA 4WZ5C 2H0YA 5TBMA 2W3GA 2GX5A 5EM0A 3K3CA 3C5AA 3D9YA 4GZBA 4OQGA 2OSUA 3SS3A 5FAOA 5HX9A 5FI6A 2WGVA 2J8YA 1DP6A 4Y3IA 2H10A 3E0YA 4Y15A 3MZEA 4Z1WA 2ACGA 2XQZA 2QMIA 3T4KA 1C3BA 3PBSA 4GB7A 1MWSA 3OPPA 4X69A 4BBUA 4DXCA 1F2KA 4U0XA 3A0RA 2A24A 3NOUC 5EFWA 4C6YA 3C4PA 1XP4A 3S7PA 2L0WA 2G2WA 1G5UA 4JGQA 2LB5A 4S2KA 4QD4A 4X25A 1PI4A 5E2GA 2ZQ8A 4Y7PA 3UB7A 4JXVA 5DFXA 3IXBA 3TJZC 4S2OA 3VOLA 3FPVA 3OC2A 3VP1A 1GCEA 2WKEA 5FQJA 1S1YA 4P6ZS 2PAVP 3LIEA 5K5BA 5C5KA 3SH7A 1ESUA 4HBUA 5IHVA 1N9LA 4QY5A 1KE4A 1H0MA 3F1OB 1S6RA 3P98A 1VHMA 3PR6A 4KZ6A 4WZ4A 3V39A 4BQMA 5CGSA 2HDSA 4LV2A 3VP3A 4ID4A 4JBFA 2JKTI 1ONGA 3UPNA 4OP8A 4I5SA 4ME4A 3VOYA 3FC7A 4IUKA 2Z2LB 1XXMA 4DDYA 4DF6A 3IWIA 3E2LA 3LFVA 5FEGA 3A3JA 3MKFA 3IQAA 2V1BA 3ZNYA 1SKOB 3UMDA 4WMCA 1IYOA 4HJ3A 4ESPA 2A49A 2L4RA 3VOZA 1MKIA 2WUQA 2QHKA 3M2KA 4MN5A 3E98A 4L0LA 2XROA 3CITA 4UQIM 3IWOA 4MEZA 1W79A 1K54C 4EESA 4N9KA 2PT7A 3UNWA 3WS1A 4PM8A 1I2SA 4S2JA 3S1YA 4ETZA 1PWGA 5TJJA 1LSWA 3PAGA 5D3OA 3BLMA 2B18A 2IWCA 2B5RA 1ERMA 1VM1A 2AVXA 5GLDA 4KG6A 3CUEC 1ZG6A 3FYZA 1STZA 3R4KA 1SZVA 3CAXA 2KX6A 4HJ4A 2WZZA 1N9BA 3V67A 3QP8A 2OAP1 1ES4A 1TS7A 4X68A 4IEDA 3UE0A 4QY6A 3KYZA 3O3VA 5F5YA 3Q82A 3HJKA 1TS8A 2E8IA 3IS2B 2JKFA 4UAAA 1FILA 2W0NA 2QYBA 4XUZA 4HESA 2B02A 4R23A 4HJ6A 4JGOA 2P9VB 1CI9A 4I3AA 4NXFA 5A91A 1YPRA 4PKYG 2ZBBA 2XDMA 4I3JA 2P04A 1J9MA 1XJ3A 4JF4A 1S1ZA 4L9FA 3C7UA 3ZDJA 2QJ5A 2JKTM 3T4QA 1NLZA 3ZCZA 1EROA 3T1SA 3B42A 3CZDA 2PYPA 5FQMA 4EUVA 3FV7A 3GV9A 1ACFA 1N4OA 5CHUA 3UPOA 1P97A 2HPBA 2W3DA 4EEUA 4KZ4A 1CQAA 1A0KA 4IJGA 3LIDA 1L0DA 4S2LA 2GZAA 3IH9A 3ZHHA 1G68A 3BECA 1H8YA 1BSGA 1H5XA 4M3KA 4GNUA 5CERA 1D1JA 3JYIA 1PWCA 4E3IA 2XH9A 4FH2A 3DTEA 3OCLA 3MFDA 4B88A 4WZ5A 1K55A 3PAEA 3HL9A 2BG1A 1MWRA 2V8CA 3PBOA 1JWZA 3BRMA 3LICA 5IT5A 4EERA 3HUOA 4BBVA 3GRJA 3IX4A 5EVIB 4YINA 3HBRA 5HARA 1Y54A 1EW0A 5EOEA 4DDSA 4MNRA 1K38A 2J80A 4I39A 2EA9A 4H8RA 5CTMA 1WE4A 3ZGAB 4N9LA 1GHPA 4QWOA 1HLUP 1UWNX 3G2YA 5FAQA 2V9AA 3A0VA 5HAIA 4FTXA 4UQIS 1OT6A 5HFOA 3T4SA 1RP5A 2P74A 5M1AA 4F3LA 2CC1A 3T4JA 4ZJ2A 1U60A 2ZL1A 1OT9A 2DNSA 4XXRA 1RCJA 1BT5A 1EI5A 3GMWA 1H8ZA 2Y2KA 2V0UA 4R0QA 2W3EA 2W3FA 2QPNA 4H6JB 4HNBA 1KE3A 3OOVA 3VE4A 5HPFA 3BJNA 3SW1A 3T4TA 1XPBA 5CEDA 3H7WA 3WS4A 5EVLA 2HGVA 1T1BA 1W5DA 5FI2A 1M6KA 3RJUA 3KO6A 3Q7VB 3W4OA 4KUOA 2VGKA 3SH8A 1W63Q 4HH3A 2Z6CA 3VP2A 1VEUA 1BZAA 4X53A 5HDDA 2Y8HA 4KQQA 2VZWA 4RYEA 4R4RA 4NEED 1BULA 3SOIA 1KVLA 1YLTA 2O9BA 4FD8A 1L3LA 3NDEA 5HPIA 3NCKA 4Y0TA 4QHCA 5FQQA 3DWKA 4HHDA 3WS5A 5FQKA 2V20A 3HLBA 2XR0A 3ISGA 3G30A 4UA7A 5AJGA 1KDWA 1BYWA 1K6RA 1XJ6A 3IWQA 3N6IA 5CHMA 3IT9A 2Y4AA 4NXEA 3LCEA 1K54A 1HTZA 4O8GA 2OOLA 3A3IA 3H82B 4GS9B 2ZMVA 3RFBA 4FSFA 2QZ6A 3MZDA 5IS1A 2V0WA 2VGLS 4UA9A 1TVFA 3FWLA 3EGDC 2E8JA 4ARZA 4GLQA 3CPTA 5G4YA 1TS6A 1PWDA 3L9KA 2IWDA 2ZC3B 1DJCA 1W63M 4LCLA 3AGDA 3DTKA 3UN7A 3EEHA 1LI9A 2VKSA 4OQIA 2M7UA 4CLCB 4BMWA 4E04A 4EUZA 2C6WB 3O87A 4AFIA 3LEQA 3CUEA 1CF0A 4II7A 2EX2A 2Y2LA 3Q81A 5KIZA 2FH5A 1P9WA 4LRZE 3UE1A 2V1ZA 2WKQA 4KG2A 3TE8A 1ZC2A 2XD5A 4E3NA 1XFNA 3E4OA 2RL3A 5FQ9A 5CHJA 1F9IA 4JGPA 2KLIA 3NIAA 1YM1A 2R78A 4DMZA 4X6TA 3WRZA 4HQAA 1VETA 3OZHA 4HOIA 1YLYA 4DXBA 4HH2A 4HEFA 2XLNA 5J7EA 2OAQ1 1LL9A 2K7SA 1P9RA 4BD1A 5L09A 3ZNTA 1ES2A 2Y2QA 1RGZA 4OLGA 4B9OA 4Z9QA 1V9YA 1K55C 1ZG4A 4GOGA 2H5SA 1CJFA 3LO7A 5HL1A 3ZG7B 2P08A 4OONA 5HL6A 4LFUA 1PZPA 4YWZA 3CWFA 1PNEA 1MY8A 2J3TD 2KOIA 2FFYA 5HDSA 3BEBA 1MC0A 1LI0A 3NI9A 3MSHA 5CEBA 4LRYC 3HLWA 3CJMA 4PAUA 4DRTA 3LIFA 4OOYA 5F68A 1XFQA 2G2UA 1D06A 4PM7A 1MWUA 2ZMAA 4R6LA 3T1QB 4G3WA 3NC8A 5FEFA 5GLCA 4KQDA 4OOMA 1S66L 2VA0A 3LEZA 4EBLA 4UA6A 3LYXA 4GN2A 1VB6A 5I94A 5FL3A 2B95A 3VE3A 5GHYA 4A5RA 4R3BA 3HLGA 3C7VA 5FDSA 1L0FA 5AQBA 4PM5A 2PDRA 1GA9A 4G3KA 5JYPA 1ZTUA 5GHZA 4JF6A 3ZQ5A 3GVBA 1IKIA 3ZG8B 1WYCA 1LLBA 1M40A 4LLOB 1DY6A 1PI5A 2JKRI 1KE0A 3O5YA 3ZG9B 4ZAMA 4OPYA 3JPUA 3N4IA 4KZAA 3HLEA 2X02A 2WADA 5DVAA 2J3TC 5EUAA 3TSGA 2PRFA 1YSQA 3O86A 3IF6A 1VQQA 1BUEA 4EQIA 3F1NA 3GSGA 4WEJA 5TGFA 2LB9A 4MDZA 3HLFA 5EECA 3QP2A 4XT2A 4X55A 4DE2A 2HDQA 4PMAA 1G6OA 4EBNA 1BLCA 4KZ9A 4IBRA 3BFDA 4FH4A 3KSHA 3PHYA 3ZYTA 2HV1A 5LBRA 5FATA 4HP4A 1LL5A 3MF0A 5J4EA 3I7JA 3OBFA 2Q9MA 2BASA 4OOLA 4Y13A 3UB5P 2Y2OA 1OJGA 1OTBA 5DTKA 2EX8A 2QKPA 3E2KA 1BLSA 2ZOHA 3KSGA 1RGYA 3F1PA 3RXWA 2OV5A 2X71A 2O9AA 4OLDA 4X1MA 1I5QA 2XF3A 5KZHA 2MJ6A 3GECA 3VFFA 4DKIA 1AWIA 2PR5A 4ZBEA 2DMWA 4NG2A 3G6OA 5F82A 2KDKA 2ZQAA 5FSRA 3LI9A 3W8KA 5HAQA 5DF8A 2O99A 5CGXA 5EVID 2HDRA 2IA2A 4IBXA 2ZOIA 4R3AA 1OPXA 1BLPA 2C5WB 3VSLA 1S4SA 2NUTC 5EVEA 3S4XA 4U3TA 5DFYA 4R4SA 4RX3A 1MWTA 3Q07A 1J3WA 3IBRA 5FA7A 2OLUA 3O88A 2W3HA 3KSFA 4WYYA 3MQOA 5CGWA 4PKYA 3TG9A 4NXBA 4DE0A 3RTYA 3R7WB 4IVIA 4S2PA 3RXXA 4F94A 2JKRM 1NJ4A 3FPWA 3DAVA 1OTDA 3S22A 3V3RA 4D2OA 5CRFA 4GHIB 2ZD8A 4R70A 2WGWA 3M6HA 2RCXA 4MLLA 3CMZA 3V50A 2HP5A 2PR6A 1SCWA 4Q0JA 2Y2IA 2OWHA 2VGLM 2WKHA 2W1TB 3BM6A 3NY4A 4E6XA 2EXAA 4ZRRA 2WAEA 2OWJA 4OQ0A 1K56D 2ZQ9A 2INWA 2WKPA 2HJEA 1GSVA 2WZXA 3FKVA 3GTCA 3MBZA 4GDNA 5TBMB 5EVIC 4LV3A 1YLPA 5DKKA 4PM6A 4DJ3A 4LENA 3T50A 4KENB 4E3MA 1FQGA 1MPLA 2JCHA 2PBDP 3EQUA 1GHIA 4NK3A 3N8LA 1H8MA 1O07A 2FFFB 5EOOA 2Y91A 4ETXA 4HY8A 5HD3A 1F98A 2PD8A 5DF9A 4HBTA 2A24B 3NOPC 3MJQA 1IOUA 3MR0A 3MXQA 2ZJ9A 3UDIA 3GQZA 4FUWA 3K2NA 3HUNA 1DJAA 2M7VA 1T18A 3HJIA 2Y2GA 1N9NA 2WKIA 2YKHA 4I3IA 2PU4A 1JWVA 1CEGA 1P0ZA 4PM9A 4RQ9A 3V3SA 5HSQA 3IF6C 1LT0A 2EWWA 2XK1A 1YSPA 1TDGA 1PW1A 5FAPA 3U2AA 4CPKA 2WGIA 3F1OA 4OH0A 1K4EA 4NETA 3BLSA 4GCZA 3HUMA 3D4FA 3RH8B 4KZBA 2J9OA 4FCFA 5DTTA 3LY4A 2CMNA 3ITAA 3M6BA 3HLDA 2Y79A 4Y0OA 2Y2MA 3B3XA 3QNCA 3LI8A 3LUQA 4GD6A 3QP1A 2Y2PA 2EFUA 5HAPA 5EPHA 3U4LP 1DJBA 1FCNA 4E3LA 3BFGA 1PFLA 3C38A 5KMWA 1YLWA 1ONHA 1E3UD 3MQ0A 4EETB 5A90A 3E4QA 4JXWA 5IU1A 3B47A 1SKOA 4WN5A 4WELA 4R1GA 4KQRA 4LRXC 1IKGA 1SDEA 3PYPA 4XUXA 2HF6A 3PBNA 4B4XA 5HWVA 1NZOA 3IXHA 5E2HA 4JXSA 1K57C 4UEYA 1OMEA 2WAFA 2ZM0A 4EV4A 3QHYA 4MCWA 4Y2FA 5HWWA 3BYDA 1KVMA 2ZM8A 2HJ9C 1LL8A 2I9VA 4EQ1A 2HZ5A 4K08A 5A93A 3ZG0A 3G31A 4R3JA 3C2WA 3UY6A 2QWSA 4EWFA 3N7WA 2HP9A 1OJ5A 3P7NA 3T1RA 4B4ZA 4DE1A 5EE8A 3C8CA 2Z2MB 4HI4A 4CJNA 1QMEA 3WRTA 4X1LA 2PYRA 3W4PA 3V5MA 4KUKA 1XGJA 3MMHA 3Q1FA 2Y55A 3D72A 1PIOA 3ULFA 3PBTA 3KYQA 2Q9NA 1MXOA 1I2WA 3N8SA 5F1GA 4QPRA 3DW0A 2VV8A 3S7OA 1NYMA 3TRCA 3UB8A 3IS2A 3JVVA 1Q2PA 1Q2QA 2ZC4B 4OPQA 1ZKJA 1IFQA 1FR6A 3BY8A 5HDCA 3HLCA 5KSCA 1V9ZA 2P9VA 3EOIA 1XKZA 1NXYA 3MQQA 1HZOA 2V1AA 1JNUA 5G18A 4LCMA 1GHMA 1BLHA 1IYSA 4LPZA 5DJTA 4JKTA 1S0WA 4EEPA 3ZFZA 5EM1A 3LR5A 3BQAA 4DE3A 1XA1A 1AXBA 1S67L 1JWPA 3DWZA 2IWBA 2W1TA 4UHUA 1DP8A 4BENA 2QJ7A 4S2IA 3M2JA 1YLZA 1F5MA 3FZCA 4P87A 3VP0A 4NKPA 4Y17A 2I72A 3DTIA 1ESIA 4GW9A 4JF5A 2EX9A 3DBAA 2VV7A 3HCYA 1IELA 3KYEA 1N9OA 5G4ZA 2ZC5B 3ZVTA 1G6AA 5FQIA 1HD8A 4HIAA 1ALQA 1OTEA 2G7UA 5A92A 3UDFA 5EVIA 1XGIA 5DJUA 1ODVA 3IBJA 5GL9A 3KSIA 4LV0A 2JN7A 2XGNA 3Q7ZA 2VEAA 4Y0UA 4OVDA 3G32A 2X01A 5CECA 5GHXA 2VGJA 3HREA 4ZJ3A 2XRNA 3ZG5A 4QB8A 3SS5A 1YKDA 1KOUA 3QP6A 3UB9A 4EBPA 4E3KA 2GJ3A 3H9WA 3LIBA 2A3UA 1Y4OA 3OLOA 4QU3A 3WWXA 1Y28A 4O7DA 2VJWA 5F1FA 5U47A 4O01A 4S2NA 5J8XA 4K91A 5CX7A 2EXBA 3IHAA 4F3LB 2Q0OA 3CHWP 1E25A 1GSXA 4E3OA 3PXPA 1ES5A 2ZL1B 3NHQA 1IYPA 4H6JA 5TR7A 5L8MA 2L1MA 4FOFA 1LSVA 4WM9A 4C3QA 2VV6A 5F69A 4LGWA 4WBGA 1IYQA 1L0GA 4R38A 5AQAA 1YQSA 4HP9A 5AQ7A 2JC7A 2Y2JA 1FIKA 4LV1A 1Z09A 2XD1A 3EQVA 1K56A 3Q7VA 1TD5A 3H7WB 1DP9A 2XA7M 1K6SA 1L2SA 2GNXA 3UDXA 5EV0A 4E6WA 1MZUA 5DF7A 2J9PA 4MN7A 1VEUB 3UB6A 4RA7A 2EFXA 1FCMA 3A3FA 1SKFA 1PW8A 4Q8IA 2ZQ7A 2ZC7A 3QP4A 4S2MA 1SHVA 3TW8A 3BWLA 1PYYA 2JBFA 2EX6A 4X56A 3LR0A 3IHBA 1X0OA 2VLGA 3W2ZA 4DN0A 1XA7A 3KX0X 5F6AA 4P85A 2UV0E 3CLOA 2ZM2A 2OLVA 2Y2HA 3H82A 4GS9A 1K57A 4QJGA 1T1CA 5J3WA 4IUHA 3C4OA 2W27A 1YLJA 3T1XA 5TFQA 1JVJA 1NRJA 2JKGA 3P01A 4ARZB 2R9XA 3G4PA 4KZ8A 2K31A 2W1RA 3CPTB 4K0WA 4MBFA 1JTGA 3OPLA 4CLCA 3BY9A 3VFHA 3EGXC 3IXDA 3WS2A 3K3DA 1L0EA 4KZ7A 1K4FA 2K2NA 5M18A 3E4PA 3MFXA 1CEFA 2D02A 3NDGA 5DKLA 2V8FA 3BFEA 1MKMA 4WUJA 1KGFA 3IXGA 4NXGA 3NULA 5HD5A 2ZQDA 4ZTKA 3UE3A 4MBHA 1W8YA 3SH9A 3WS0A 3TOIA 2XFTA 3BW6A 4WL9A 2JHEA 2XEPA 3N8RA 4MMNA 4JGRA 1E3UA 4BWIA 2H0TA 1WA9A 5L10A 2UWXA 1QMFA 1VETB 3LGOA 3UMEA 4YNRA 4GD8A 4CLCE 4C75A 3AGEA 4OPZA 5FI7A 2H28A 3CG5A 3MXRA 4MN6A 3A3EA 1UGUA 1DRMA 1G28A 1IEMA 3NECA 3HVFA 4E3JA 2GDNA 1CI8A 2Y2NA 4JLFA 4OP5A 3PBRA 4WLAA 4BL2A 4WEKA 1BTLA 5MC7A 1PZOA 1XJ2A 4ZDXA 4EU0A 4Y5FA 3QNBA 2YKFA 1H3QA 4P6BA 3IX3A 3L7HA 3UE6A 4Q0IA 5L07A 3BFFA 4WMCD 4BD0A 2Z6DA 3T4OA 4GDBA 4OQHA 4Q0HA 3QP5A 1HVBA 3IX8A 1NZUA 4M4XA 3OCNA 4N92A 3UO9A 3GR2A 1EWZA 3B33A 3VP4A 1KGGA 2DRWA 1JTDA 3FG8A 3NBLA 4ZJ1A 1D7EA 1NWZA 1W7FA 3IH8A 2M1CA 4S2NC 1XX2A 2XA7S 4OPRA 3W4QA 4BBTA 2HP6A 4JPMA 1TDLA 1O7EA 2ZQCA 4KQOA 5A8BA 3ICYA 3P09A 5F83A 3LR4A 2O9CA 2O0YA 4K0XA 3ZVWA 5KSHA 2XSSA 1NLYA 3NJAA 3A3DA 4OKPA 2J7VA 2ZLYA 1SDNA 2D01A 4EW7A 4CQHA 4KZ5A 1OTIA 3D3OA 4CLCD 2BLSA 3BFCA 3EWKA 3CI6A 3T4LA 3VMAA 3DTMA 3NOTC 5GLBA 2WKRA 5GLAA 4JXGA 3A0SA 1UWPX 1YT4A 3VV4A 3PBQA 5HZHA 3C30A 3ITBA 4YFMA 1FOFA 1Z6FA 4EXOA 4KZ3A 3T12B 3AGFA 2PHYA 4YOFA 1K0KA 4MBKA 3IF6B 4PPRA 1TEMA 4RX2A 5HW3A 3F1NB 1T19A 3S7QA 3OPRA 2PBYA 4P0MA 3IF5A 2WK0A 2XFSA 4XT2B 4GJ4A
chains in the Genus database with same CATH topology
4I38A 3S7NA 1P97A 1F5MA 2W3DA 4EEUA 4NKPA 4IJGA 3LIDA 2GZAA 3KSHA 3PHYA 4GW9A 1ZHHB 4L9GA 3DBAA 3ZYTA 2HV1A 2VV7A 1XJ4A 1S4RA 5LBRA 3HCYA 1N9OA 4HP4A 5G4ZA 3GDIA 3MF0A 5J4EA 4IHQA 3OCLA 3OBFA 2BASA 4OOLA 4P6ZM 5AVFA 1OJGA 1OTBA 1TS0A 2QKPA 4HIAA 3PBOA 4L9EA 2ZOHA 3KSGA 1OTEA 2G7UA 4CLCC 3F1PA 4G3VA 3LICA 5IT5A 4EERA 4DJ2A 4BBVA 3JVUA 2EWVA 2O9AA 5DJUA 1ODVA 3IBJA 3F1PB 3KSIA 2MJ6A 2JN7A 3LIAA 3GECA 2VEAA 2PR5A 2DMWA 3G6OA 3EEAA 4PHTA 1EW0A 2KDKA 3LI9A 4BJPA 2XRNA 2P7JA 1YKDA 2O99A 2J80A 1KOUA 4I39A 3UB9A 2PD7A 2EA9A 2IA2A 2ZOIA 4R3AA 2ZMFA 1OPXA 2NUPC 2GJ3A 3H9WA 3LIBA 1S4SA 2NUTC 1UWNX 2V9AA 3A0VA 3OLOA 5DFYA 4UQIS 1Y28A 1LSXA 1OT6A 2VJWA 3T4SA 2J3WA 2FZ0A 3IBRA 4O01A 5HWTA 4F3LA 2W3HA 3T4JA 3KSFA 5CX7A 3MQOA 1OTAA 1YAXA 4PKYA 4F3LB 3R7WA 4WF0A 1OT9A 4NXBA 1GSXA 1T1AA 3RTYA 3PXPA 3R7WB 4GHIA 3NHQA 2JKRM 3FPWA 3LR3A 4H6JA 4B93A 1OTDA 5L8MA 2V0UA 4GHIB 4R70A 2W3EA 2L1MA 2W3FA 4FOFA 1LSVA 4H6JB 5AVEA 2VV6A 5F69A 4HNBA 3VE4A 3OOVA 4O0PA 5HPFA 2PR6A 4R38A 3BJNA 3SW1A 4HP9A 4Q0JA 3T4TA 2OWHA 3H7WA 3BQ8A 3EQVA 1GSWA 2VGLM 2HGVA 2W1TB 1T1BA 5I5LA 1TD5A 3H7WB 1DP9A 2XA7M 1TF1A 3KO6A 4ZRRA 2A2LA 4KUOA 2GNXA 1W63Q 4HH3A 2Z6CA 1MZUA 2OWJA 2VX8A 4MN7A 5TBMA 5HDDA 2INWA 2W3GA 2Y8HA 2VZWA 2GX5A 2WKPA 2HJEA 3UB6A 1GSVA 4NEED 2O9BA 5TBMB 3K3CA 5DKKA 5HPIA 3TW8A 3BWLA 4DJ3A 3LR0A 3T50A 4HHDA 1X0OA 2VLGA 3EQUA 3W2ZA 4DN0A 3KX0X 5AJGA 1BYWA 1DP6A 1XJ6A 4Y3IA 5F6AA 3E0YA 4Z1WA 3T4KA 3CLOA 1H8MA 3PBSA 3H82A 4GS9A 4BBUA 4NXEA 1T1CA 4ETXA 5J3WA 4IUHA 3A0RA 2A24A 4HY8A 4O8GA 2W27A 5HD3A 2OOLA 1F98A 3H82B 3NOUC 2ZMVA 4GS9B 2PD8A 5EFWA 3RFBA 4FSFA 5DF9A 2A24B 3NOPC 2V0WA 5IS1A 3MJQA 2VGLS 1IOUA 3S7PA 2L0WA 3MR0A 3MXQA 3EGDC 4ARZA 4GLQA 1NRJA 3K2NA 5G4YA 1TS6A 3P01A 4JGQA 2M7VA 1T18A 2LB5A 4ARZB 3HJIA 2K31A 2W1RA 1W63M 1N9NA 4CLCA 3BY9A 3EGXC 3UB7A 2YKHA 3EEHA 4I3IA 5DFXA 3K3DA 2VKSA 4E04A 1P0ZA 2M7UA 4CLCB 4BMWA 3TJZC 4RQ9A 3VOLA 2K2NA 3FPVA 3OC2A 4AFIA 5HSQA 3E4PA 3CUEA 1LT0A 2EWWA 3MFXA 4II7A 1YSPA 2D02A 5KIZA 5DKLA 2FH5A 1P9WA 1MKMA 4WUJA 1S1YA 4LRZE 4P6ZS 2WKQA 3U2AA 3LIEA 3F1OA 4NXGA 5K5BA 5C5KA 3TE8A 5HD5A 1N9LA 4GCZA 3UE3A 3F1OB 1XFNA 3E4OA 3RH8B 1VHMA 3PR6A 1F9IA 2CMNA 4JGPA 3BW6A 4WL9A 2JHEA 2KLIA 2R78A 4MMNA 4JGRA 2Y79A 4DMZA 4HQAA 4BWIA 3LI8A 2JKTI 1WA9A 4HOIA 3LUQA 4HH2A 4I5SA 5J7EA 2OAQ1 4ME4A 3UMEA 3FC7A 4IUKA 4YNRA 2K7SA 1P9RA 4CLCE 3C38A 4EETB 3MQ0A 2H28A 3LFVA 4B9OA 3E4QA 5IU1A 3B47A 4MN6A 4WN5A 1V9YA 4WELA 1UGUA 2V1BA 1DRMA 1G28A 3UMDA 4LRXC 2P08A 4HJ3A 2L4RA 5HL6A 3PYPA 2QHKA 3PBRA 4MN5A 4WLAA 3E98A 4WEKA 2HF6A 3PBNA 4L0LA 4YWZA 3CWFA 5MC7A 5HWVA 1XJ2A 3CITA 2XROA 2J3TD 4UQIM 4EU0A 4Y5FA 2YKFA 1H3QA 2KOIA 5HDSA 3UE6A 4Q0IA 4UEYA 1MC0A 4EESA 2Z6DA 4MCWA 4Y2FA 3T4OA 5HWWA 4Q0HA 2PT7A 4LRYC 2HJ9C 1LL8A 4M4XA 3OCNA 2I9VA 4PAUA 4EQ1A 4ETZA 5TJJA 3LIFA 1LSWA 4K08A 5F68A 1XFQA 3B33A 2B18A 1D06A 3C2WA 2QWSA 3FG8A 1OJ5A 3P7NA 4R6LA 4G3WA 1D7EA 1NWZA 2M1CA 4KQDA 2XA7S 3CUEC 4OOMA 3C8CA 4BBTA 1STZA 3R4KA 4HI4A 1S66L 3CAXA 2VA0A 2KX6A 4HJ4A 3LYXA 2PYRA 3V67A 1VB6A 4KUKA 4KQOA 5A8BA 3ICYA 3MMHA 2OAP1 5FL3A 3LR4A 3VE3A 2O9CA 1TS7A 2O0YA 3D72A 5KSHA 3ULFA 2XSSA 3PBTA 3KYQA 1NLYA 3NJAA 3KYZA 4QPRA 5F5YA 2PDRA 2D01A 2VV8A 3S7OA 4EW7A 4G3KA 3TRCA 3HJKA 3IS2A 3JVVA 3UB8A 4CQHA 1OTIA 1ZTUA 3D3OA 1IFQA 4CLCD 1TS8A 3ZQ5A 3IS2B 3BY8A 3EWKA 5HDCA 3CI6A 3T4LA 2W0NA 3NOTC 2QYBA 1V9ZA 2B02A 2WKRA 3A0SA 4HJ6A 3EOIA 1UWPX 4LLOB 4JGOA 2JKRI 3MQQA 3VV4A 3O5YA 2V1AA 3PBQA 5HZHA 3C30A 1JNUA 4I3AA 4NXFA 4LPZA 5DJTA 4PKYG 2ZBBA 4I3JA 4EXOA 2J3TC 2P04A 1YSQA 1XJ3A 1S1ZA 4L9FA 4EEPA 2PHYA 2QJ5A 4YOFA 3F1NA 3LR5A 2JKTM 3T4QA 1NLZA 3BQAA 4WEJA 2LB9A 3F1NB 4MDZA 3B42A 1S67L 2PYPA 1T19A 2W1TA 4EUVA 4XT2A 3S7QA 1DP8A 4XT2B 2QJ7A 1G6OA 4GJ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I38 A;  1P97 A;  4EEU A;  3LID A;  3PHY A;  4GW9 A;  4L9G A;  2HV1 A;  2VV7 A;  1XJ4 A;  1S4R A;  1N9O A;  4HP4 A;  5G4Z A;  3GDI A;  5J4E A;  2BAS A;  5AVF A;  1OJG A;  1OTB A;  1TS0 A;  2QKP A;  4HIA A;  4L9E A;  2ZOH A;  1OTE A;  3F1P A;  3LIC A;  4EER A;  4DJ2 A;  4BBV A;  5DJU A;  1ODV A;  3F1P B;  2JN7 A;  3LIA A;  3GEC A;  2VEA A;  2PR5 A;  3G6O A;  1EW0 A;  2KDK A;  3LI9 A;  2P7J A;  2J80 A;  1KOU A;  4I39 A;  3UB9 A;  2PD7 A;  2EA9 A;  2ZOI A;  4R3A A;  2GJ3 A;  3H9W A;  3LIB A;  1S4S A;  1UWN X;  2V9A A;  3A0V A;  3OLO A;  1Y28 A;  1LSX A;  1OT6 A;  3IBR A;  5HWT A;  4F3L A;  3MQO A;  1OTA A;  4PKY A;  4F3L B;  4WF0 A;  1OT9 A;  4NXB A;  1GSX A;  1T1A A;  3RTY A;  4GHI A;  3NHQ A;  4H6J A;  1OTD A;  2V0U A;  4GHI B;  4R70 A;  2L1M A;  1LSV A;  4H6J B;  5AVE A;  2VV6 A;  5F69 A;  4HNB A;  3VE4 A;  2PR6 A;  4R38 A;  3SW1 A;  4HP9 A;  2OWH A;  3H7W A;  1GSW A;  1T1B A;  5I5L A;  3H7W B;  1DP9 A;  4KUO A;  4HH3 A;  2Z6C A;  1MZU A;  2OWJ A;  5TBM A;  5HDD A;  2INW A;  2WKP A;  3UB6 A;  1GSV A;  5TBM B;  3K3C A;  5DKK A;  3BWL A;  4DJ3 A;  3T50 A;  4HHD A;  1X0O A;  2VLG A;  3KX0 X;  1BYW A;  1DP6 A;  1XJ6 A;  5F6A A;  3CLO A;  3H82 A;  4GS9 A;  4BBU A;  4NXE A;  1T1C A;  5J3W A;  3A0R A;  2A24 A;  4HY8 A;  2W27 A;  5HD3 A;  2OOL A;  1F98 A;  3H82 B;  3NOU C;  4GS9 B;  5EFW A;  2PD8 A;  2A24 B;  3NOP C;  2V0W A;  5IS1 A;  3MJQ A;  2L0W A;  3MR0 A;  3MXQ A;  5G4Y A;  1TS6 A;  4JGQ A;  1T18 A;  3HJI A;  1N9N A;  3BY9 A;  3UB7 A;  2YKH A;  3EEH A;  4I3I A;  3K3D A;  4E04 A;  1P0Z A;  4RQ9 A;  3VOL A;  5HSQ A;  3E4P A;  1LT0 A;  3MFX A;  2D02 A;  5KIZ A;  5DKL A;  4WUJ A;  1S1Y A;  4LRZ E;  2WKQ A;  3LIE A;  3F1O A;  4NXG A;  5HD5 A;  1N9L A;  4GCZ A;  3F1O B;  1XFN A;  3E4O A;  3RH8 B;  1F9I A;  2CMN A;  4JGP A;  4WL9 A;  2JHE A;  2R78 A;  4JGR A;  4HQA A;  3LI8 A;  1WA9 A;  4HOI A;  3LUQ A;  4HH2 A;  4I5S A;  5J7E A;  3UME A;  3FC7 A;  2K7S A;  4EET B;  2H28 A;  4B9O A;  3E4Q A;  5IU1 A;  4MN6 A;  4WN5 A;  1V9Y A;  1UGU A;  2V1B A;  1DRM A;  1G28 A;  3UMD A;  4LRX C;  4HJ3 A;  2L4R A;  3PYP A;  2QHK A;  4MN5 A;  4WLA A;  4YWZ A;  3CWF A;  5HWV A;  1XJ2 A;  2YKF A;  5HDS A;  3UE6 A;  4EES A;  2Z6D A;  5HWW A;  4LRY C;  1LL8 A;  4M4X A;  2I9V A;  4EQ1 A;  3LIF A;  1LSW A;  4K08 A;  5F68 A;  1XFQ A;  3B33 A;  1D06 A;  3C2W A;  2QWS A;  3FG8 A;  1OJ5 A;  3P7N A;  4R6L A;  1D7E A;  1NWZ A;  2M1C A;  4KQD A;  3C8C A;  4BBT A;  4HI4 A;  1S66 L;  3CAX A;  2KX6 A;  4HJ4 A;  3LYX A;  2PYR A;  1VB6 A;  4KUK A;  5A8B A;  3ICY A;  3VE3 A;  1TS7 A;  3D72 A;  3ULF A;  3NJA A;  5F5Y A;  2PDR A;  2D01 A;  2VV8 A;  4EW7 A;  3HJK A;  3IS2 A;  3UB8 A;  1OTI A;  1TS8 A;  3ZQ5 A;  3IS2 B;  3BY8 A;  3EWK A;  5HDC A;  2W0N A;  3NOT C;  1V9Z A;  2B02 A;  2WKR A;  3A0S A;  4HJ6 A;  1UWP X;  4LLO B;  4JGO A;  3MQQ A;  2V1A A;  5HZH A;  1JNU A;  4I3A A;  4NXF A;  4LPZ A;  5DJT A;  4PKY G;  2ZBB A;  4I3J A;  4EXO A;  1XJ3 A;  1S1Z A;  4L9F A;  4EEP A;  2PHY A;  2QJ5 A;  3F1N A;  3F1N B;  1S67 L;  2PYP A;  1T19 A;  4XT2 A;  1DP8 A;  4XT2 B;  2QJ7 A; 
#chains in the Genus database with same CATH topology
 4RVA A;  1PRQ A;  1MBL A;  4I38 A;  4U0T A;  3S7N A;  1ERQ A;  4D60 A;  1GA0 A;  5E43 A;  1ZHH B;  1KDS A;  4L9G A;  1XJ4 A;  1S4R A;  1WYB A;  2R9W A;  1K25 A;  1CK3 A;  3PTE A;  5JYO A;  3GDI A;  4N1H A;  1NRF A;  3SS4 A;  4IHQ A;  5E2F A;  4P6Z M;  4BLM A;  5AVF A;  4BL3 A;  1TS0 A;  5CTN A;  3SZT A;  3MKE A;  4L9E A;  2V2F F;  1E4D A;  4CLC C;  5FDH A;  4G3V A;  3LY3 A;  4DJ2 A;  3JVU A;  2EWV A;  3F1P B;  2VK3 A;  1YMX A;  1ES3 A;  1FSY A;  3LIA A;  1YMS A;  3VSK A;  2JE5 A;  3EEA A;  4PHT A;  2Y59 A;  5AQ9 A;  3MZF A;  4BJP A;  3G2Z A;  2P7J A;  2PD7 A;  3UPP A;  2PU2 A;  2ZMF A;  3G34 A;  2NUP C;  5BOH A;  5DTS A;  2ZC6 B;  1W8Q A;  1LSX A;  2J3W A;  2FZ0 A;  5FAS A;  2HDU A;  5HWT A;  3G35 A;  4KG5 A;  1OTA A;  1YAX A;  3R7W A;  5L2F A;  4WF0 A;  3MXS A;  2BTF P;  1T1A A;  4GHI A;  3LR3 A;  1FSW A;  4B93 A;  1FCO A;  4GKU A;  5AVE A;  2WGW B;  1LHY A;  4O0P A;  4IVK A;  4N1X A;  5E2E A;  1NY0 A;  2DCF A;  3BQ8 A;  3FKW A;  1GSW A;  3MS6 A;  5I5L A;  1TF1 A;  1FR1 A;  2A2L A;  5CXW A;  1KGE A;  5M19 A;  2WYX A;  1NYY A;  2VX8 A;  3OPH A;  4WZ5 C;  2H0Y A;  5TBM A;  2W3G A;  2GX5 A;  5EM0 A;  3K3C A;  3C5A A;  3D9Y A;  4GZB A;  4OQG A;  2OSU A;  3SS3 A;  5FAO A;  5HX9 A;  5FI6 A;  2WGV A;  2J8Y A;  1DP6 A;  4Y3I A;  2H10 A;  3E0Y A;  4Y15 A;  3MZE A;  4Z1W A;  2ACG A;  2XQZ A;  2QMI A;  3T4K A;  1C3B A;  3PBS A;  4GB7 A;  1MWS A;  3OPP A;  4X69 A;  4BBU A;  4DXC A;  1F2K A;  4U0X A;  3A0R A;  2A24 A;  3NOU C;  5EFW A;  4C6Y A;  3C4P A;  1XP4 A;  3S7P A;  2L0W A;  2G2W A;  1G5U A;  4JGQ A;  2LB5 A;  4S2K A;  4QD4 A;  4X25 A;  1PI4 A;  5E2G A;  2ZQ8 A;  4Y7P A;  3UB7 A;  4JXV A;  5DFX A;  3IXB A;  3TJZ C;  4S2O A;  3VOL A;  3FPV A;  3OC2 A;  3VP1 A;  1GCE A;  2WKE A;  5FQJ A;  1S1Y A;  4P6Z S;  2PAV P;  3LIE A;  5K5B A;  5C5K A;  3SH7 A;  1ESU A;  4HBU A;  5IHV A;  1N9L A;  4QY5 A;  1KE4 A;  1H0M A;  3F1O B;  1S6R A;  3P98 A;  1VHM A;  3PR6 A;  4KZ6 A;  4WZ4 A;  3V39 A;  4BQM A;  5CGS A;  2HDS A;  4LV2 A;  3VP3 A;  4ID4 A;  4JBF A;  2JKT I;  1ONG A;  3UPN A;  4OP8 A;  4I5S A;  4ME4 A;  3VOY A;  3FC7 A;  4IUK A;  2Z2L B;  1XXM A;  4DDY A;  4DF6 A;  3IWI A;  3E2L A;  3LFV A;  5FEG A;  3A3J A;  3MKF A;  3IQA A;  2V1B A;  3ZNY A;  1SKO B;  3UMD A;  4WMC A;  1IYO A;  4HJ3 A;  4ESP A;  2A49 A;  2L4R A;  3VOZ A;  1MKI A;  2WUQ A;  2QHK A;  3M2K A;  4MN5 A;  3E98 A;  4L0L A;  2XRO A;  3CIT A;  4UQI M;  3IWO A;  4MEZ A;  1W79 A;  1K54 C;  4EES A;  4N9K A;  2PT7 A;  3UNW A;  3WS1 A;  4PM8 A;  1I2S A;  4S2J A;  3S1Y A;  4ETZ A;  1PWG A;  5TJJ A;  1LSW A;  3PAG A;  5D3O A;  3BLM A;  2B18 A;  2IWC A;  2B5R A;  1ERM A;  1VM1 A;  2AVX A;  5GLD A;  4KG6 A;  3CUE C;  1ZG6 A;  3FYZ A;  1STZ A;  3R4K A;  1SZV A;  3CAX A;  2KX6 A;  4HJ4 A;  2WZZ A;  1N9B A;  3V67 A;  3QP8 A;  2OAP 1;  1ES4 A;  1TS7 A;  4X68 A;  4IED A;  3UE0 A;  4QY6 A;  3KYZ A;  3O3V A;  5F5Y A;  3Q82 A;  3HJK A;  1TS8 A;  2E8I A;  3IS2 B;  2JKF A;  4UAA A;  1FIL A;  2W0N A;  2QYB A;  4XUZ A;  4HES A;  2B02 A;  4R23 A;  4HJ6 A;  4JGO A;  2P9V B;  1CI9 A;  4I3A A;  4NXF A;  5A91 A;  1YPR A;  4PKY G;  2ZBB A;  2XDM A;  4I3J A;  2P04 A;  1J9M A;  1XJ3 A;  4JF4 A;  1S1Z A;  4L9F A;  3C7U A;  3ZDJ A;  2QJ5 A;  2JKT M;  3T4Q A;  1NLZ A;  3ZCZ A;  1ERO A;  3T1S A;  3B42 A;  3CZD A;  2PYP A;  5FQM A;  4EUV A;  3FV7 A;  3GV9 A;  1ACF A;  1N4O A;  5CHU A;  3UPO A;  1P97 A;  2HPB A;  2W3D A;  4EEU A;  4KZ4 A;  1CQA A;  1A0K A;  4IJG A;  3LID A;  1L0D A;  4S2L A;  2GZA A;  3IH9 A;  3ZHH A;  1G68 A;  3BEC A;  1H8Y A;  1BSG A;  1H5X A;  4M3K A;  4GNU A;  5CER A;  1D1J A;  3JYI A;  1PWC A;  4E3I A;  2XH9 A;  4FH2 A;  3DTE A;  3OCL A;  3MFD A;  4B88 A;  4WZ5 A;  1K55 A;  3PAE A;  3HL9 A;  2BG1 A;  1MWR A;  2V8C A;  3PBO A;  1JWZ A;  3BRM A;  3LIC A;  5IT5 A;  4EER A;  3HUO A;  4BBV A;  3GRJ A;  3IX4 A;  5EVI B;  4YIN A;  3HBR A;  5HAR A;  1Y54 A;  1EW0 A;  5EOE A;  4DDS A;  4MNR A;  1K38 A;  2J80 A;  4I39 A;  2EA9 A;  4H8R A;  5CTM A;  1WE4 A;  3ZGA B;  4N9L A;  1GHP A;  4QWO A;  1HLU P;  1UWN X;  3G2Y A;  5FAQ A;  2V9A A;  3A0V A;  5HAI A;  4FTX A;  4UQI S;  1OT6 A;  5HFO A;  3T4S A;  1RP5 A;  2P74 A;  5M1A A;  4F3L A;  2CC1 A;  3T4J A;  4ZJ2 A;  1U60 A;  2ZL1 A;  1OT9 A;  2DNS A;  4XXR A;  1RCJ A;  1BT5 A;  1EI5 A;  3GMW A;  1H8Z A;  2Y2K A;  2V0U A;  4R0Q A;  2W3E A;  2W3F A;  2QPN A;  4H6J B;  4HNB A;  1KE3 A;  3OOV A;  3VE4 A;  5HPF A;  3BJN A;  3SW1 A;  3T4T A;  1XPB A;  5CED A;  3H7W A;  3WS4 A;  5EVL A;  2HGV A;  1T1B A;  1W5D A;  5FI2 A;  1M6K A;  3RJU A;  3KO6 A;  3Q7V B;  3W4O A;  4KUO A;  2VGK A;  3SH8 A;  1W63 Q;  4HH3 A;  2Z6C A;  3VP2 A;  1VEU A;  1BZA A;  4X53 A;  5HDD A;  2Y8H A;  4KQQ A;  2VZW A;  4RYE A;  4R4R A;  4NEE D;  1BUL A;  3SOI A;  1KVL A;  1YLT A;  2O9B A;  4FD8 A;  1L3L A;  3NDE A;  5HPI A;  3NCK A;  4Y0T A;  4QHC A;  5FQQ A;  3DWK A;  4HHD A;  3WS5 A;  5FQK A;  2V20 A;  3HLB A;  2XR0 A;  3ISG A;  3G30 A;  4UA7 A;  5AJG A;  1KDW A;  1BYW A;  1K6R A;  1XJ6 A;  3IWQ A;  3N6I A;  5CHM A;  3IT9 A;  2Y4A A;  4NXE A;  3LCE A;  1K54 A;  1HTZ A;  4O8G A;  2OOL A;  3A3I A;  3H82 B;  4GS9 B;  2ZMV A;  3RFB A;  4FSF A;  2QZ6 A;  3MZD A;  5IS1 A;  2V0W A;  2VGL S;  4UA9 A;  1TVF A;  3FWL A;  3EGD C;  2E8J A;  4ARZ A;  4GLQ A;  3CPT A;  5G4Y A;  1TS6 A;  1PWD A;  3L9K A;  2IWD A;  2ZC3 B;  1DJC A;  1W63 M;  4LCL A;  3AGD A;  3DTK A;  3UN7 A;  3EEH A;  1LI9 A;  2VKS A;  4OQI A;  2M7U A;  4CLC B;  4BMW A;  4E04 A;  4EUZ A;  2C6W B;  3O87 A;  4AFI A;  3LEQ A;  3CUE A;  1CF0 A;  4II7 A;  2EX2 A;  2Y2L A;  3Q81 A;  5KIZ A;  2FH5 A;  1P9W A;  4LRZ E;  3UE1 A;  2V1Z A;  2WKQ A;  4KG2 A;  3TE8 A;  1ZC2 A;  2XD5 A;  4E3N A;  1XFN A;  3E4O A;  2RL3 A;  5FQ9 A;  5CHJ A;  1F9I A;  4JGP A;  2KLI A;  3NIA A;  1YM1 A;  2R78 A;  4DMZ A;  4X6T A;  3WRZ A;  4HQA A;  1VET A;  3OZH A;  4HOI A;  1YLY A;  4DXB A;  4HH2 A;  4HEF A;  2XLN A;  5J7E A;  2OAQ 1;  1LL9 A;  2K7S A;  1P9R A;  4BD1 A;  5L09 A;  3ZNT A;  1ES2 A;  2Y2Q A;  1RGZ A;  4OLG A;  4B9O A;  4Z9Q A;  1V9Y A;  1K55 C;  1ZG4 A;  4GOG A;  2H5S A;  1CJF A;  3LO7 A;  5HL1 A;  3ZG7 B;  2P08 A;  4OON A;  5HL6 A;  4LFU A;  1PZP A;  4YWZ A;  3CWF A;  1PNE A;  1MY8 A;  2J3T D;  2KOI A;  2FFY A;  5HDS A;  3BEB A;  1MC0 A;  1LI0 A;  3NI9 A;  3MSH A;  5CEB A;  4LRY C;  3HLW A;  3CJM A;  4PAU A;  4DRT A;  3LIF A;  4OOY A;  5F68 A;  1XFQ A;  2G2U A;  1D06 A;  4PM7 A;  1MWU A;  2ZMA A;  4R6L A;  3T1Q B;  4G3W A;  3NC8 A;  5FEF A;  5GLC A;  4KQD A;  4OOM A;  1S66 L;  2VA0 A;  3LEZ A;  4EBL A;  4UA6 A;  3LYX A;  4GN2 A;  1VB6 A;  5I94 A;  5FL3 A;  2B95 A;  3VE3 A;  5GHY A;  4A5R A;  4R3B A;  3HLG A;  3C7V A;  5FDS A;  1L0F A;  5AQB A;  4PM5 A;  2PDR A;  1GA9 A;  4G3K A;  5JYP A;  1ZTU A;  5GHZ A;  4JF6 A;  3ZQ5 A;  3GVB A;  1IKI A;  3ZG8 B;  1WYC A;  1LLB A;  1M40 A;  4LLO B;  1DY6 A;  1PI5 A;  2JKR I;  1KE0 A;  3O5Y A;  3ZG9 B;  4ZAM A;  4OPY A;  3JPU A;  3N4I A;  4KZA A;  3HLE A;  2X02 A;  2WAD A;  5DVA A;  2J3T C;  5EUA A;  3TSG A;  2PRF A;  1YSQ A;  3O86 A;  3IF6 A;  1VQQ A;  1BUE A;  4EQI A;  3F1N A;  3GSG A;  4WEJ A;  5TGF A;  2LB9 A;  4MDZ A;  3HLF A;  5EEC A;  3QP2 A;  4XT2 A;  4X55 A;  4DE2 A;  2HDQ A;  4PMA A;  1G6O A;  4EBN A;  1BLC A;  4KZ9 A;  4IBR A;  3BFD A;  4FH4 A;  3KSH A;  3PHY A;  3ZYT A;  2HV1 A;  5LBR A;  5FAT A;  4HP4 A;  1LL5 A;  3MF0 A;  5J4E A;  3I7J A;  3OBF A;  2Q9M A;  2BAS A;  4OOL A;  4Y13 A;  3UB5 P;  2Y2O A;  1OJG A;  1OTB A;  5DTK A;  2EX8 A;  2QKP A;  3E2K A;  1BLS A;  2ZOH A;  3KSG A;  1RGY A;  3F1P A;  3RXW A;  2OV5 A;  2X71 A;  2O9A A;  4OLD A;  4X1M A;  1I5Q A;  2XF3 A;  5KZH A;  2MJ6 A;  3GEC A;  3VFF A;  4DKI A;  1AWI A;  2PR5 A;  4ZBE A;  2DMW A;  4NG2 A;  3G6O A;  5F82 A;  2KDK A;  2ZQA A;  5FSR A;  3LI9 A;  3W8K A;  5HAQ A;  5DF8 A;  2O99 A;  5CGX A;  5EVI D;  2HDR A;  2IA2 A;  4IBX A;  2ZOI A;  4R3A A;  1OPX A;  1BLP A;  2C5W B;  3VSL A;  1S4S A;  2NUT C;  5EVE A;  3S4X A;  4U3T A;  5DFY A;  4R4S A;  4RX3 A;  1MWT A;  3Q07 A;  1J3W A;  3IBR A;  5FA7 A;  2OLU A;  3O88 A;  2W3H A;  3KSF A;  4WYY A;  3MQO A;  5CGW A;  4PKY A;  3TG9 A;  4NXB A;  4DE0 A;  3RTY A;  3R7W B;  4IVI A;  4S2P A;  3RXX A;  4F94 A;  2JKR M;  1NJ4 A;  3FPW A;  3DAV A;  1OTD A;  3S22 A;  3V3R A;  4D2O A;  5CRF A;  4GHI B;  2ZD8 A;  4R70 A;  2WGW A;  3M6H A;  2RCX A;  4MLL A;  3CMZ A;  3V50 A;  2HP5 A;  2PR6 A;  1SCW A;  4Q0J A;  2Y2I A;  2OWH A;  2VGL M;  2WKH A;  2W1T B;  3BM6 A;  3NY4 A;  4E6X A;  2EXA A;  4ZRR A;  2WAE A;  2OWJ A;  4OQ0 A;  1K56 D;  2ZQ9 A;  2INW A;  2WKP A;  2HJE A;  1GSV A;  2WZX A;  3FKV A;  3GTC A;  3MBZ A;  4GDN A;  5TBM B;  5EVI C;  4LV3 A;  1YLP A;  5DKK A;  4PM6 A;  4DJ3 A;  4LEN A;  3T50 A;  4KEN B;  4E3M A;  1FQG A;  1MPL A;  2JCH A;  2PBD P;  3EQU A;  1GHI A;  4NK3 A;  3N8L A;  1H8M A;  1O07 A;  2FFF B;  5EOO A;  2Y91 A;  4ETX A;  4HY8 A;  5HD3 A;  1F98 A;  2PD8 A;  5DF9 A;  4HBT A;  2A24 B;  3NOP C;  3MJQ A;  1IOU A;  3MR0 A;  3MXQ A;  2ZJ9 A;  3UDI A;  3GQZ A;  4FUW A;  3K2N A;  3HUN A;  1DJA A;  2M7V A;  1T18 A;  3HJI A;  2Y2G A;  1N9N A;  2WKI A;  2YKH A;  4I3I A;  2PU4 A;  1JWV A;  1CEG A;  1P0Z A;  4PM9 A;  4RQ9 A;  3V3S A;  5HSQ A;  3IF6 C;  1LT0 A;  2EWW A;  2XK1 A;  1YSP A;  1TDG A;  1PW1 A;  5FAP A;  3U2A A;  4CPK A;  2WGI A;  3F1O A;  4OH0 A;  1K4E A;  4NET A;  3BLS A;  4GCZ A;  3HUM A;  3D4F A;  3RH8 B;  4KZB A;  2J9O A;  4FCF A;  5DTT A;  3LY4 A;  2CMN A;  3ITA A;  3M6B A;  3HLD A;  2Y79 A;  4Y0O A;  2Y2M A;  3B3X A;  3QNC A;  3LI8 A;  3LUQ A;  4GD6 A;  3QP1 A;  2Y2P A;  2EFU A;  5HAP A;  5EPH A;  3U4L P;  1DJB A;  1FCN A;  4E3L A;  3BFG A;  1PFL A;  3C38 A;  5KMW A;  1YLW A;  1ONH A;  1E3U D;  3MQ0 A;  4EET B;  5A90 A;  3E4Q A;  4JXW A;  5IU1 A;  3B47 A;  1SKO A;  4WN5 A;  4WEL A;  4R1G A;  4KQR A;  4LRX C;  1IKG A;  1SDE A;  3PYP A;  4XUX A;  2HF6 A;  3PBN A;  4B4X A;  5HWV A;  1NZO A;  3IXH A;  5E2H A;  4JXS A;  1K57 C;  4UEY A;  1OME A;  2WAF A;  2ZM0 A;  4EV4 A;  3QHY A;  4MCW A;  4Y2F A;  5HWW A;  3BYD A;  1KVM A;  2ZM8 A;  2HJ9 C;  1LL8 A;  2I9V A;  4EQ1 A;  2HZ5 A;  4K08 A;  5A93 A;  3ZG0 A;  3G31 A;  4R3J A;  3C2W A;  3UY6 A;  2QWS A;  4EWF A;  3N7W A;  2HP9 A;  1OJ5 A;  3P7N A;  3T1R A;  4B4Z A;  4DE1 A;  5EE8 A;  3C8C A;  2Z2M B;  4HI4 A;  4CJN A;  1QME A;  3WRT A;  4X1L A;  2PYR A;  3W4P A;  3V5M A;  4KUK A;  1XGJ A;  3MMH A;  3Q1F A;  2Y55 A;  3D72 A;  1PIO A;  3ULF A;  3PBT A;  3KYQ A;  2Q9N A;  1MXO A;  1I2W A;  3N8S A;  5F1G A;  4QPR A;  3DW0 A;  2VV8 A;  3S7O A;  1NYM A;  3TRC A;  3UB8 A;  3IS2 A;  3JVV A;  1Q2P A;  1Q2Q A;  2ZC4 B;  4OPQ A;  1ZKJ A;  1IFQ A;  1FR6 A;  3BY8 A;  5HDC A;  3HLC A;  5KSC A;  1V9Z A;  2P9V A;  3EOI A;  1XKZ A;  1NXY A;  3MQQ A;  1HZO A;  2V1A A;  1JNU A;  5G18 A;  4LCM A;  1GHM A;  1BLH A;  1IYS A;  4LPZ A;  5DJT A;  4JKT A;  1S0W A;  4EEP A;  3ZFZ A;  5EM1 A;  3LR5 A;  3BQA A;  4DE3 A;  1XA1 A;  1AXB A;  1S67 L;  1JWP A;  3DWZ A;  2IWB A;  2W1T A;  4UHU A;  1DP8 A;  4BEN A;  2QJ7 A;  4S2I A;  3M2J A;  1YLZ A;  1F5M A;  3FZC A;  4P87 A;  3VP0 A;  4NKP A;  4Y17 A;  2I72 A;  3DTI A;  1ESI A;  4GW9 A;  4JF5 A;  2EX9 A;  3DBA A;  2VV7 A;  3HCY A;  1IEL A;  3KYE A;  1N9O A;  5G4Z A;  2ZC5 B;  3ZVT A;  1G6A A;  5FQI A;  1HD8 A;  4HIA A;  1ALQ A;  1OTE A;  2G7U A;  5A92 A;  3UDF A;  5EVI A;  1XGI A;  5DJU A;  1ODV A;  3IBJ A;  5GL9 A;  3KSI A;  4LV0 A;  2JN7 A;  2XGN A;  3Q7Z A;  2VEA A;  4Y0U A;  4OVD A;  3G32 A;  2X01 A;  5CEC A;  5GHX A;  2VGJ A;  3HRE A;  4ZJ3 A;  2XRN A;  3ZG5 A;  4QB8 A;  3SS5 A;  1YKD A;  1KOU A;  3QP6 A;  3UB9 A;  4EBP A;  4E3K A;  2GJ3 A;  3H9W A;  3LIB A;  2A3U A;  1Y4O A;  3OLO A;  4QU3 A;  3WWX A;  1Y28 A;  4O7D A;  2VJW A;  5F1F A;  5U47 A;  4O01 A;  4S2N A;  5J8X A;  4K91 A;  5CX7 A;  2EXB A;  3IHA A;  4F3L B;  2Q0O A;  3CHW P;  1E25 A;  1GSX A;  4E3O A;  3PXP A;  1ES5 A;  2ZL1 B;  3NHQ A;  1IYP A;  4H6J A;  5TR7 A;  5L8M A;  2L1M A;  4FOF A;  1LSV A;  4WM9 A;  4C3Q A;  2VV6 A;  5F69 A;  4LGW A;  4WBG A;  1IYQ A;  1L0G A;  4R38 A;  5AQA A;  1YQS A;  4HP9 A;  5AQ7 A;  2JC7 A;  2Y2J A;  1FIK A;  4LV1 A;  1Z09 A;  2XD1 A;  3EQV A;  1K56 A;  3Q7V A;  1TD5 A;  3H7W B;  1DP9 A;  2XA7 M;  1K6S A;  1L2S A;  2GNX A;  3UDX A;  5EV0 A;  4E6W A;  1MZU A;  5DF7 A;  2J9P A;  4MN7 A;  1VEU B;  3UB6 A;  4RA7 A;  2EFX A;  1FCM A;  3A3F A;  1SKF A;  1PW8 A;  4Q8I A;  2ZQ7 A;  2ZC7 A;  3QP4 A;  4S2M A;  1SHV A;  3TW8 A;  3BWL A;  1PYY A;  2JBF A;  2EX6 A;  4X56 A;  3LR0 A;  3IHB A;  1X0O A;  2VLG A;  3W2Z A;  4DN0 A;  1XA7 A;  3KX0 X;  5F6A A;  4P85 A;  2UV0 E;  3CLO A;  2ZM2 A;  2OLV A;  2Y2H A;  3H82 A;  4GS9 A;  1K57 A;  4QJG A;  1T1C A;  5J3W A;  4IUH A;  3C4O A;  2W27 A;  1YLJ A;  3T1X A;  5TFQ A;  1JVJ A;  1NRJ A;  2JKG A;  3P01 A;  4ARZ B;  2R9X A;  3G4P A;  4KZ8 A;  2K31 A;  2W1R A;  3CPT B;  4K0W A;  4MBF A;  1JTG A;  3OPL A;  4CLC A;  3BY9 A;  3VFH A;  3EGX C;  3IXD A;  3WS2 A;  3K3D A;  1L0E A;  4KZ7 A;  1K4F A;  2K2N A;  5M18 A;  3E4P A;  3MFX A;  1CEF A;  2D02 A;  3NDG A;  5DKL A;  2V8F A;  3BFE A;  1MKM A;  4WUJ A;  1KGF A;  3IXG A;  4NXG A;  3NUL A;  5HD5 A;  2ZQD A;  4ZTK A;  3UE3 A;  4MBH A;  1W8Y A;  3SH9 A;  3WS0 A;  3TOI A;  2XFT A;  3BW6 A;  4WL9 A;  2JHE A;  2XEP A;  3N8R A;  4MMN A;  4JGR A;  1E3U A;  4BWI A;  2H0T A;  1WA9 A;  5L10 A;  2UWX A;  1QMF A;  1VET B;  3LGO A;  3UME A;  4YNR A;  4GD8 A;  4CLC E;  4C75 A;  3AGE A;  4OPZ A;  5FI7 A;  2H28 A;  3CG5 A;  3MXR A;  4MN6 A;  3A3E A;  1UGU A;  1DRM A;  1G28 A;  1IEM A;  3NEC A;  3HVF A;  4E3J A;  2GDN A;  1CI8 A;  2Y2N A;  4JLF A;  4OP5 A;  3PBR A;  4WLA A;  4BL2 A;  4WEK A;  1BTL A;  5MC7 A;  1PZO A;  1XJ2 A;  4ZDX A;  4EU0 A;  4Y5F A;  3QNB A;  2YKF A;  1H3Q A;  4P6B A;  3IX3 A;  3L7H A;  3UE6 A;  4Q0I A;  5L07 A;  3BFF A;  4WMC D;  4BD0 A;  2Z6D A;  3T4O A;  4GDB A;  4OQH A;  4Q0H A;  3QP5 A;  1HVB A;  3IX8 A;  1NZU A;  4M4X A;  3OCN A;  4N92 A;  3UO9 A;  3GR2 A;  1EWZ A;  3B33 A;  3VP4 A;  1KGG A;  2DRW A;  1JTD A;  3FG8 A;  3NBL A;  4ZJ1 A;  1D7E A;  1NWZ A;  1W7F A;  3IH8 A;  2M1C A;  4S2N C;  1XX2 A;  2XA7 S;  4OPR A;  3W4Q A;  4BBT A;  2HP6 A;  4JPM A;  1TDL A;  1O7E A;  2ZQC A;  4KQO A;  5A8B A;  3ICY A;  3P09 A;  5F83 A;  3LR4 A;  2O9C A;  2O0Y A;  4K0X A;  3ZVW A;  5KSH A;  2XSS A;  1NLY A;  3NJA A;  3A3D A;  4OKP A;  2J7V A;  2ZLY A;  1SDN A;  2D01 A;  4EW7 A;  4CQH A;  4KZ5 A;  1OTI A;  3D3O A;  4CLC D;  2BLS A;  3BFC A;  3EWK A;  3CI6 A;  3T4L A;  3VMA A;  3DTM A;  3NOT C;  5GLB A;  2WKR A;  5GLA A;  4JXG A;  3A0S A;  1UWP X;  1YT4 A;  3VV4 A;  3PBQ A;  5HZH A;  3C30 A;  3ITB A;  4YFM A;  1FOF A;  1Z6F A;  4EXO A;  4KZ3 A;  3T12 B;  3AGF A;  2PHY A;  4YOF A;  1K0K A;  4MBK A;  3IF6 B;  4PPR A;  1TEM A;  4RX2 A;  5HW3 A;  3F1N B;  1T19 A;  3S7Q A;  3OPR A;  2PBY A;  4P0M A;  3IF5 A;  2WK0 A;  2XFS A;  4XT2 B;  4GJ4 A; 
#chains in the Genus database with same CATH homology
 4I38 A;  3S7N A;  1P97 A;  1F5M A;  2W3D A;  4EEU A;  4NKP A;  4IJG A;  3LID A;  2GZA A;  3KSH A;  3PHY A;  4GW9 A;  1ZHH B;  4L9G A;  3DBA A;  3ZYT A;  2HV1 A;  2VV7 A;  1XJ4 A;  1S4R A;  5LBR A;  3HCY A;  1N9O A;  4HP4 A;  5G4Z A;  3GDI A;  3MF0 A;  5J4E A;  4IHQ A;  3OCL A;  3OBF A;  2BAS A;  4OOL A;  4P6Z M;  5AVF A;  1OJG A;  1OTB A;  1TS0 A;  2QKP A;  4HIA A;  3PBO A;  4L9E A;  2ZOH A;  3KSG A;  1OTE A;  2G7U A;  4CLC C;  3F1P A;  4G3V A;  3LIC A;  5IT5 A;  4EER A;  4DJ2 A;  4BBV A;  3JVU A;  2EWV A;  2O9A A;  5DJU A;  1ODV A;  3IBJ A;  3F1P B;  3KSI A;  2MJ6 A;  2JN7 A;  3LIA A;  3GEC A;  2VEA A;  2PR5 A;  2DMW A;  3G6O A;  3EEA A;  4PHT A;  1EW0 A;  2KDK A;  3LI9 A;  4BJP A;  2XRN A;  2P7J A;  1YKD A;  2O99 A;  2J80 A;  1KOU A;  4I39 A;  3UB9 A;  2PD7 A;  2EA9 A;  2IA2 A;  2ZOI A;  4R3A A;  2ZMF A;  1OPX A;  2NUP C;  2GJ3 A;  3H9W A;  3LIB A;  1S4S A;  2NUT C;  1UWN X;  2V9A A;  3A0V A;  3OLO A;  5DFY A;  4UQI S;  1Y28 A;  1LSX A;  1OT6 A;  2VJW A;  3T4S A;  2J3W A;  2FZ0 A;  3IBR A;  4O01 A;  5HWT A;  4F3L A;  2W3H A;  3T4J A;  3KSF A;  5CX7 A;  3MQO A;  1OTA A;  1YAX A;  4PKY A;  4F3L B;  3R7W A;  4WF0 A;  1OT9 A;  4NXB A;  1GSX A;  1T1A A;  3RTY A;  3PXP A;  3R7W B;  4GHI A;  3NHQ A;  2JKR M;  3FPW A;  3LR3 A;  4H6J A;  4B93 A;  1OTD A;  5L8M A;  2V0U A;  4GHI B;  4R70 A;  2W3E A;  2L1M A;  2W3F A;  4FOF A;  1LSV A;  4H6J B;  5AVE A;  2VV6 A;  5F69 A;  4HNB A;  3VE4 A;  3OOV A;  4O0P A;  5HPF A;  2PR6 A;  4R38 A;  3BJN A;  3SW1 A;  4HP9 A;  4Q0J A;  3T4T A;  2OWH A;  3H7W A;  3BQ8 A;  3EQV A;  1GSW A;  2VGL M;  2HGV A;  2W1T B;  1T1B A;  5I5L A;  1TD5 A;  3H7W B;  1DP9 A;  2XA7 M;  1TF1 A;  3KO6 A;  4ZRR A;  2A2L A;  4KUO A;  2GNX A;  1W63 Q;  4HH3 A;  2Z6C A;  1MZU A;  2OWJ A;  2VX8 A;  4MN7 A;  5TBM A;  5HDD A;  2INW A;  2W3G A;  2Y8H A;  2VZW A;  2GX5 A;  2WKP A;  2HJE A;  3UB6 A;  1GSV A;  4NEE D;  2O9B A;  5TBM B;  3K3C A;  5DKK A;  5HPI A;  3TW8 A;  3BWL A;  4DJ3 A;  3LR0 A;  3T50 A;  4HHD A;  1X0O A;  2VLG A;  3EQU A;  3W2Z A;  4DN0 A;  3KX0 X;  5AJG A;  1BYW A;  1DP6 A;  1XJ6 A;  4Y3I A;  5F6A A;  3E0Y A;  4Z1W A;  3T4K A;  3CLO A;  1H8M A;  3PBS A;  3H82 A;  4GS9 A;  4BBU A;  4NXE A;  1T1C A;  4ETX A;  5J3W A;  4IUH A;  3A0R A;  2A24 A;  4HY8 A;  4O8G A;  2W27 A;  5HD3 A;  2OOL A;  1F98 A;  3H82 B;  3NOU C;  2ZMV A;  4GS9 B;  2PD8 A;  5EFW A;  3RFB A;  4FSF A;  5DF9 A;  2A24 B;  3NOP C;  2V0W A;  5IS1 A;  3MJQ A;  2VGL S;  1IOU A;  3S7P A;  2L0W A;  3MR0 A;  3MXQ A;  3EGD C;  4ARZ A;  4GLQ A;  1NRJ A;  3K2N A;  5G4Y A;  1TS6 A;  3P01 A;  4JGQ A;  2M7V A;  1T18 A;  2LB5 A;  4ARZ B;  3HJI A;  2K31 A;  2W1R A;  1W63 M;  1N9N A;  4CLC A;  3BY9 A;  3EGX C;  3UB7 A;  2YKH A;  3EEH A;  4I3I A;  5DFX A;  3K3D A;  2VKS A;  4E04 A;  1P0Z A;  2M7U A;  4CLC B;  4BMW A;  3TJZ C;  4RQ9 A;  3VOL A;  2K2N A;  3FPV A;  3OC2 A;  4AFI A;  5HSQ A;  3E4P A;  3CUE A;  1LT0 A;  2EWW A;  3MFX A;  4II7 A;  1YSP A;  2D02 A;  5KIZ A;  5DKL A;  2FH5 A;  1P9W A;  1MKM A;  4WUJ A;  1S1Y A;  4LRZ E;  4P6Z S;  2WKQ A;  3U2A A;  3LIE A;  3F1O A;  4NXG A;  5K5B A;  5C5K A;  3TE8 A;  5HD5 A;  1N9L A;  4GCZ A;  3UE3 A;  3F1O B;  1XFN A;  3E4O A;  3RH8 B;  1VHM A;  3PR6 A;  1F9I A;  2CMN A;  4JGP A;  3BW6 A;  4WL9 A;  2JHE A;  2KLI A;  2R78 A;  4MMN A;  4JGR A;  2Y79 A;  4DMZ A;  4HQA A;  4BWI A;  3LI8 A;  2JKT I;  1WA9 A;  4HOI A;  3LUQ A;  4HH2 A;  4I5S A;  5J7E A;  2OAQ 1;  4ME4 A;  3UME A;  3FC7 A;  4IUK A;  4YNR A;  2K7S A;  1P9R A;  4CLC E;  3C38 A;  4EET B;  3MQ0 A;  2H28 A;  3LFV A;  4B9O A;  3E4Q A;  5IU1 A;  3B47 A;  4MN6 A;  4WN5 A;  1V9Y A;  4WEL A;  1UGU A;  2V1B A;  1DRM A;  1G28 A;  3UMD A;  4LRX C;  2P08 A;  4HJ3 A;  2L4R A;  5HL6 A;  3PYP A;  2QHK A;  3PBR A;  4MN5 A;  4WLA A;  3E98 A;  4WEK A;  2HF6 A;  3PBN A;  4L0L A;  4YWZ A;  3CWF A;  5MC7 A;  5HWV A;  1XJ2 A;  3CIT A;  2XRO A;  2J3T D;  4UQI M;  4EU0 A;  4Y5F A;  2YKF A;  1H3Q A;  2KOI A;  5HDS A;  3UE6 A;  4Q0I A;  4UEY A;  1MC0 A;  4EES A;  2Z6D A;  4MCW A;  4Y2F A;  3T4O A;  5HWW A;  4Q0H A;  2PT7 A;  4LRY C;  2HJ9 C;  1LL8 A;  4M4X A;  3OCN A;  2I9V A;  4PAU A;  4EQ1 A;  4ETZ A;  5TJJ A;  3LIF A;  1LSW A;  4K08 A;  5F68 A;  1XFQ A;  3B33 A;  2B18 A;  1D06 A;  3C2W A;  2QWS A;  3FG8 A;  1OJ5 A;  3P7N A;  4R6L A;  4G3W A;  1D7E A;  1NWZ A;  2M1C A;  4KQD A;  2XA7 S;  3CUE C;  4OOM A;  3C8C A;  4BBT A;  1STZ A;  3R4K A;  4HI4 A;  1S66 L;  3CAX A;  2VA0 A;  2KX6 A;  4HJ4 A;  3LYX A;  2PYR A;  3V67 A;  1VB6 A;  4KUK A;  4KQO A;  5A8B A;  3ICY A;  3MMH A;  2OAP 1;  5FL3 A;  3LR4 A;  3VE3 A;  2O9C A;  1TS7 A;  2O0Y A;  3D72 A;  5KSH A;  3ULF A;  2XSS A;  3PBT A;  3KYQ A;  1NLY A;  3NJA A;  3KYZ A;  4QPR A;  5F5Y A;  2PDR A;  2D01 A;  2VV8 A;  3S7O A;  4EW7 A;  4G3K A;  3TRC A;  3HJK A;  3IS2 A;  3JVV A;  3UB8 A;  4CQH A;  1OTI A;  1ZTU A;  3D3O A;  1IFQ A;  4CLC D;  1TS8 A;  3ZQ5 A;  3IS2 B;  3BY8 A;  3EWK A;  5HDC A;  3CI6 A;  3T4L A;  2W0N A;  3NOT C;  2QYB A;  1V9Z A;  2B02 A;  2WKR A;  3A0S A;  4HJ6 A;  3EOI A;  1UWP X;  4LLO B;  4JGO A;  2JKR I;  3MQQ A;  3VV4 A;  3O5Y A;  2V1A A;  3PBQ A;  5HZH A;  3C30 A;  1JNU A;  4I3A A;  4NXF A;  4LPZ A;  5DJT A;  4PKY G;  2ZBB A;  4I3J A;  4EXO A;  2J3T C;  2P04 A;  1YSQ A;  1XJ3 A;  1S1Z A;  4L9F A;  4EEP A;  2PHY A;  2QJ5 A;  4YOF A;  3F1N A;  3LR5 A;  2JKT M;  3T4Q A;  1NLZ A;  3BQA A;  4WEJ A;  2LB9 A;  3F1N B;  4MDZ A;  3B42 A;  1S67 L;  2PYP A;  1T19 A;  2W1T A;  4EUV A;  4XT2 A;  3S7Q A;  1DP8 A;  4XT2 B;  2QJ7 A;  1G6O A;  4GJ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...