5J7EA

Heag pas domain
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
109
structure length
109
Chain Sequence
TNFVLGNAQIVDWPIVYSNDGFCKLSGYHRAEVMQKSSTCSFMYGELTDKDTIEKVRQTFENYEMNSFEILMYKKNRTPVWFFVKIAPIRNEQDKVVLFLCTFSDITAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Potassium voltage-gated channel subfamily H member 1
publication title Crystal Structure of PAS domain from the hEAG Potassium Channel
rcsb
source organism Homo sapiens
total genus 31
structure length 109
sequence length 109
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2016-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5j7eA00
1TS6A 4HOIA 4YWZA 4HI4A 3F1NA 2A24B 4H6JB 3F1OA 4B9OA 1XJ3A 5A8BA 3LIBA 4EQ1A 3NHQA 2J80A 5F5YA 5J3WA 1P97A 4EETB 3HJIA 3FG8A 5G4ZA 5DJTA 1T1AA 5AVFA 3K3CA 5HDSA 1UWPX 3H82A 3LICA 3HJKA 1GSWA 3FC7A 5DKLA 3H7WB 3H9WA 2ZBBA 1T1BA 1XFNA 2VV7A 2BASA 4HJ4A 1S1YA 4LRYC 1XJ4A 3E4OA 2INWA 1UWNX 2QHKA 4GS9B 3BY9A 4BBVA 4I5SA 4L9EA 2P7JA 4HIAA 2PD8A 4KUOA 1LSWA 1OTEA 1DP6A 3UB7A 1LSVA 1S4SA 4PKYG 1VB6A 2A24A 4H6JA 4EXOA 3D72A 4NXBA 4XT2A 3F1NB 3A0VA 2YKHA 4GW9A 3VE3A 4EEUA 3F1OB 3KX0X 1T18A 4HJ3A 2JHEA 4KUKA 3A0RA 5HSQA 3H82B 3RTYA 2L1MA 1LL8A 3LIFA 2PHYA 1BYWA 4EEPA 3C8CA 5HWVA 3ZQ5A 4GS9A 2Z6CA 2EA9A 3MQQA 3RH8B 1P0ZA 3G6OA 5AVEA 3MJQA 4NXGA 3VE4A 3E4QA 5HD5A 5HWWA 3K3DA 5F6AA 4JGOA 5F68A 1OT9A 2WKQA 4GCZA 3GECA 3UB8A 4DJ2A 4E04A 1S1ZA 5HDCA 1T1CA 2JN7A 3E4PA 4RQ9A 1Y28A 2ZOHA 4XT2B 2QJ7A 2V1AA 1D7EA 2V0UA 2PR5A 3CLOA 1OTBA 5G4YA 4I38A 2OOLA 4PKYA 4K08A 4KQDA 3BWLA 2QJ5A 4HJ6A 5I5LA 4BBUA 5HWTA 3MFXA 3NOUC 4WUJA 4F3LA 2VV8A 2GJ3A 4NXEA 1KOUA 4EESA 2L0WA 4WF0A 2D02A 5IS1A 1GSVA 3LYXA 4MN5A 3SW1A 4L9FA 4I3IA 5IU1A 2PYRA 1JNUA 3GDIA 1V9ZA 1X0OA 4I3AA 1DRMA 4WL9A 1OJGA 4HY8A 5HZHA 3MXQA 1LT0A 3ULFA 1WA9A 3F1PB 3LIEA 3UB6A 2KDKA 2I9VA 3B33A 2PR6A 3MQOA 2WKPA 2KX6A 2V9AA 1N9LA 2V1BA 1S67L 4MN6A 2W0NA 3P7NA 4L9GA 3LIAA 2Z6DA 2V0WA 4F3LB 2D01A 4R70A 1V9YA 1TS8A 3UE6A 1TS0A 1OTDA 5J7EA 3LI8A 4LRXC 2YKFA 3CWFA 5HD3A 1LSXA 3F1PA 4R6LA 2VLGA 1N9OA 3NOPC 1F98A 5TBMB 1NWZA 5HDDA 3NOTC 4WLAA 1XFQA 4JGPA 3T50A 3OLOA 5DJUA 4I3JA 4HP9A 3MR0A 4GHIA 5J4EA 3VOLA 1ODVA 4EERA 2H28A 2OWJA 1OTIA 5KIZA 2OWHA 1GSXA 2PYPA 1MZUA 4HP4A 2M1CA 2HV1A 1S66L 5DKKA 3A0SA 3IS2A 4R3AA 2L4RA 2QKPA 2ZOIA 1OJ5A 3ICYA 4NXFA 3C2WA 4LLOB 1G28A 3UMEA 1XJ6A 3UMDA 4I39A 1F9IA 3EWKA 3CAXA 4WN5A 1S4RA 3BY8A 5TBMA 1UGUA 3NJAA 3UB9A 2QWSA 2W27A 3LI9A 2PD7A 1DP8A 2WKRA 4BBTA 5F69A 5EFWA 2PDRA 1D06A 3LUQA 3IBRA 1DP9A 3PYPA 4JGQA 4GHIB 3H7WA 3EEHA 1EW0A 4DJ3A 4LPZA 2R78A 4HNBA 2VEAA 1N9NA 1XJ2A 1OTAA 4HQAA 2CMNA 1T19A 2K7SA 3PHYA 4HH3A 4JGRA 3IS2B 4EW7A 2B02A 4R38A 4LRZE 4M4XA 1TS7A 3LIDA 4HH2A 4HHDA 2VV6A 1OT6A
chains in the Genus database with same CATH superfamily
3F1NA 3QP1A 2ZMVA 4LV0A 3MKEA 1ZTUA 3LIBA 3NHQA 3G35A 2J80A 5F5YA 5E2EA 5EVLA 4MMNA 1K56A 1JWZA 1PW1A 1T1AA 5DJTA 5CGWA 3K3CA 1U60A 4DDYA 5TFQA 3H82A 1FILA 3HJKA 3FC7A 1CF0A 5FDSA 2XRNA 2ZBBA 3VP0A 5FAQA 1XFNA 5M1AA 2HDRA 1FR1A 1N9BA 3TSGA 4BLMA 2XROA 1KVMA 1MXOA 3IWQA 1UWNX 4GS9B 5DF7A 1XKZA 3BY9A 2PU2A 1L0EA 3UDXA 4YOFA 3UB7A 4R1GA 4DXCA 2RCXA 3IXDA 3A3DA 5HW3A 3EOIA 2A24A 4JXGA 2OAQ1 3GV9A 4KQOA 1H5XA 1TVFA 4NK3A 4XT2A 3IWOA 3A0VA 1K56D 3VE3A 3HUOA 3F1OB 3KX0X 4WZ4A 1T18A 1HTZA 3TE8A 4OPQA 1BLCA 2EX2A 4ZTKA 4KUKA 4FTXA 2B95A 4LFUA 1IELA 3RTYA 4X6TA 4CLCB 1NZUA 2HGVA 1K0KA 3LIFA 4KZ7A 4PMAA 4UA7A 4OKPA 4BJPA 3VP1A 2C6WB 3G2YA 3ZQ5A 4LENA 1PI4A 2ZL1A 3AGDA 1P0ZA 5EM1A 4Q0HA 1VETB 1ES4A 2J3WA 5AVEA 4GOGA 3UB5P 3VOYA 5HAQA 1MKMA 2BTFP 3PR6A 2J7VA 3ZDJA 4OVDA 1YLPA 4MEZA 5CHUA 1S0WA 4QPRA 2HJEA 1O7EA 2XK1A 3KYZA 5GHZA 1QMFA 4E04A 1K38A 1FIKA 5HDCA 3T4TA 2JN7A 3MXSA 4QB8A 4WZ5C 2XA7S 1IOUA 3A3EA 2BLSA 1ES5A 2Y2NA 2V1AA 2V0UA 5GHYA 4Z1WA 1KGEA 2JBFA 1KE3A 3T4KA 3OOVA 1OTBA 3HL9A 3SS5A 5F82A 2W3FA 2PBDP 3C4PA 1XX2A 1OPXA 4Q0IA 3GMWA 1NYMA 1D1JA 5EVIA 1YQSA 3FKVA 3ZVTA 4GDNA 1ESUA 3SS3A 4C3QA 1CI8A 2QJ5A 3T4SA 5I5LA 3IH9A 1DJAA 3GR2A 1IEMA 2XEPA 2QPNA 5HPIA 4D60A 1PYYA 4WF0A 5IS1A 1GSVA 4GB7A 4OONA 1PZOA 3IXGA 4MN5A 1A0KA 3FKWA 3IHBA 5CEBA 3DAVA 3Q7VB 1E3UA 2PYRA 2JC7A 3GDIA 1V9ZA 2B5RA 1YMSA 1OJGA 4WEJA 1WA9A 3F1PB 2OSUA 2WK0A 3LIEA 4NKPA 2KDKA 1GHIA 2I9VA 1W63M 2A3UA 2V8FA 2ZQ9A 4DXBA 5EVID 5F83A 3G2ZA 4EUVA 3CMZA 1Q2QA 2WKPA 3ZG0A 2KX6A 3S7PA 1S67L 4RYEA 4MN6A 4KQRA 2ZQCA 4P87A 3JPUA 3DWZA 3G31A 3RJUA 1OMEA 3UE3A 5E2HA 4EBPA 1FCMA 2D01A 4F3LB 4ZRRA 2G2UA 4BWIA 1TS8A 4KZ6A 1TS0A 4GLQA 1LHYA 4N92A 2ZC7A 1KDSA 2OLUA 1O07A 4OH0A 3S22A 3CWFA 3HLEA 5CHJA 1LSXA 1VHMA 1YLJA 4KENB 2HPBA 2ZM8A 2VLGA 3NOPC 3FPVA 2CC1A 5HDDA 2GX5A 1XFQA 3IX8A 2JCHA 5DF9A 5CERA 2XGNA 5FQMA 4HP9A 1PRQA 2EFUA 5J4EA 4MLLA 1ODVA 3G4PA 4OQHA 2VKSA 1PWCA 3D9YA 4H8RA 3B3XA 3KYQA 3GRJA 2R9WA 4ID4A 2HV1A 3UY6A 1J3WA 1NYYA 3PXPA 1YAXA 3A0SA 2XDMA 5FATA 2L4RA 1GA9A 1K54A 2ZOIA 4AFIA 4GKUA 2WAEA 4JF5A 4MBKA 1MY8A 1G28A 3BRMA 3UMEA 1XJ6A 3TG9A 3UMDA 3ITBA 3PAEA 4KZ9A 3CAXA 4P6ZM 4WN5A 3EEAA 1S4RA 1G6OA 5J8XA 2QWSA 3S7NA 5L07A 2GDNA 5L8MA 2WKRA 4Q8IA 4ZJ1A 5F69A 5EFWA 1LI9A 4ZDXA 5CXWA 2ZC3B 5FQKA 4ARZA 5M18A 2JKGA 5CX7A 3BQ8A 3H7WA 4XXRA 3QP5A 4E3JA 2G7UA 4LPZA 4HNBA 1PI5A 3JVUA 5EVEA 3AGFA 2Q9NA 3BECA 3SH8A 1RGYA 2Q0OA 2O9AA 4N1HA 5FL3A 2W1TA 3D4FA 3LIDA 2JKRI 4HH2A 3ZCZA 4JXVA 1BLSA 4S2JA 4O01A 1N4OA 4K91A 3N8RA 3OPHA 5FQJA 2X01A 3UE0A 4DE1A 1TS6A 4HI4A 1H8YA 2A24B 1K6RA 1ZC2A 5A8BA 4EQ1A 4B88A 3UN7A 1P97A 2Y59A 3HJIA 5FSRA 2ZM0A 1YMXA 1YT4A 4KZ3A 3ZNYA 5AVFA 5HDSA 1PWDA 4UQIS 1GSWA 3PBSA 5DKLA 3W4PA 3H9WA 3HUNA 1T1BA 4UHUA 2VV7A 4K0XA 4PM5A 1PZPA 3P09A 1IYQA 3ZHHA 3BJNA 1CEFA 2INWA 3PBQA 4EU0A 1Z09A 2ZL1B 4R23A 3L9KA 2P7JA 2G2WA 2Y2GA 5TR7A 2P08A 1LSVA 2EFXA 3O87A 5FDHA 2NUPC 1VB6A 4LV1A 2EXAA 5FI7A 3M6HA 3UPNA 4P85A 2HF6A 3N8LA 3D72A 4X56A 5HX9A 3G30A 5FAOA 3WRTA 4PPRA 5I94A 4Q0JA 2AVXA 3LR0A 1PFLA 3UPPA 1BT5A 3HLBA 5FQQA 1Z6FA 3NECA 1KE0A 2JKTI 3A3JA 3LEZA 4NEED 1XA7A 4EQIA 4IHQA 2XQZA 3MF0A 3SS4A 2P9VB 4EEPA 4O7DA 3MMHA 1ZKJA 2IWDA 5HL6A 5EVIB 4CJNA 2E8JA 3G6OA 4QJGA 3MJQA 4DDSA 3IXHA 1JTDA 4NXGA 3VE4A 5HD5A 3K3DA 3T1QB 2WUQA 2WGWA 2W1RA 3SH7A 4JKTA 1RCJA 4FCFA 1OT9A 3A3FA 2J3TC 4PM9A 4JF4A 3U4LP 1IFQA 2FFFB 2K31A 3O5YA 3UB8A 2Y55A 5EOOA 1ZG4A 1S1ZA 1CEGA 3IF5A 3W4OA 3T1SA 4OP5A 2FH5A 2V20A 2Y2IA 3DW0A 4QY6A 5AJGA 4RQ9A 5HARA 5EVIC 1XGIA 3CI6A 2PR5A 4B4ZA 4OPZA 3PAGA 5CGXA 2OOLA 3QHYA 2Y2KA 5HAIA 1J9MA 4PKYA 4K08A 4X1MA 3BWLA 1ES3A 4HJ6A 4BBUA 2ZQAA 3MFXA 4BL3A 4WUJA 3CITA 4NXEA 3HLWA 4IBXA 2HP5A 2L0WA 4BD0A 2D02A 3MKFA 1P9RA 3MZDA 1ES2A 4I3IA 2XH9A 1MWSA 3WS2A 4KQQA 2H10A 4KG5A 3E2LA 4Y13A 2QYBA 4FD8A 4JLFA 4WL9A 1ERQA 2Y4AA 4FH4A 3MXQA 3ULFA 2A49A 4DE2A 2OAP1 3S1YA 2BG1A 2VGKA 1E4DA 2VX8A 1W79A 1IKGA 4GDBA 2XD1A 2IA2A 3BFGA 4PM6A 4S2NC 1M6KA 4BMWA 2V9AA 1N9LA 5L2FA 4KG2A 4OPRA 1XXMA 2ZMAA 5DTSA 5F1FA 3P7NA 2Y2JA 3CZDA 4RA7A 2VGJA 2J8YA 5GLCA 5IT5A 2XFTA 1V9YA 3UE6A 2JKRM 3ZG9B 1K57A 4EV4A 2P74A 3WS5A 3VP3A 4N9KA 3LI8A 3GSGA 4UA9A 2WKIA 5KSHA 2DMWA 1SKFA 4M3KA 4GD6A 1F98A 3EQUA 3M2KA 2M7VA 3HLDA 3QP8A 4OP8A 4JGPA 1FSYA 5DJUA 4GN2A 4P6ZS 1STZA 3MR0A 4GHIA 1FQGA 5DTKA 3VOLA 3DTMA 1K54C 1KE4A 3EQVA 1E25A 1VQQA 3PBOA 5CHMA 3DBAA 1GSXA 3NDGA 3MFDA 1MZUA 3OZHA 4EUZA 3IQAA 3OPRA 3T1XA 3TJZC 1KGGA 2ZJ9A 1MPLA 1YKDA 4R3AA 3MS6A 5DTTA 5EE8A 3ZG7B 1OJ5A 5L10A 5DFXA 1TDLA 3ICYA 3KO6A 3C2WA 1IYOA 3V5MA 1EI5A 3I7JA 3E2KA 3IBJA 4I39A 3LR3A 1ZG6A 4OQ0A 1IYSA 3RXXA 4GNUA 3EWKA 1L3LA 4R3JA 3IF6B 3BY8A 1RP5A 1YLTA 4OQIA 3VFFA 3TOIA 4QWOA 1H0MA 5L09A 3TW8A 1PW8A 4BBTA 3ISGA 4Y3IA 5FA7A 3IX3A 4WYYA 2OV5A 1DP9A 3PYPA 3UNWA 4JGQA 2JKTM 2KOIA 2HDUA 1RGZA 3BW6A 3EEHA 1CK3A 1EW0A 3N6IA 3O3VA 4JBFA 1HVBA 3LR4A 4X69A 5EM0A 3NIAA 4DF6A 1K25A 2VEAA 3LFVA 1XJ2A 3IF6C 2KLIA 4ETZA 4BENA 4HEFA 1T19A 2VJWA 1BULA 4ESPA 3CJMA 3PHYA 4BL2A 3IS2B 1E3UD 2HJ9C 1L0DA 1EROA 5LBRA 1TS7A 4C75A 1Q2PA 3W4QA 5FASA 1WYCA 4FH2A 3A3IA 3TRCA 4IUHA 3T4OA 3NY4A 1EWZA 1MBLA 2ZC5B 3VV4A 4YWZA 3MZFA 1NLYA 1NZOA 3S7QA 3D3OA 3F1OA 4B9OA 1L2SA 5M19A 1KDWA 1GA0A 3ZFZA 3QP2A 4DRTA 4Y17A 5J3WA 4EETB 2DCFA 2ZC6B 3FG8A 4OQGA 2IWCA 4OLDA 4N9LA 2PAVP 1UWPX 1DJCA 4CLCA 4UEYA 1NJ4A 1PNEA 3BM6A 4YINA 3C7UA 2WYXA 1VETA 3BEBA 1XA1A 3C7VA 1G68A 3T4QA 2QHKA 4O8GA 4Y0OA 3BLMA 4BBVA 3Q81A 4I5SA 4L9EA 3QNBA 4S2PA 4MN7A 3T12B 5FAPA 4HIAA 2PD8A 4KUOA 1LSWA 1OTEA 4K0WA 1S4SA 4LCLA 3AGEA 5GHXA 2WGWB 4DE3A 2QZ6A 4H6JA 4ZAMA 1ZHHB 2IWBA 4EXOA 3HCYA 2A2LA 3F1NB 4GW9A 4EEUA 4XUXA 1BUEA 4CLCD 3LR5A 1I2SA 4LGWA 2M7UA 4HJ3A 1JWPA 4E3NA 2JHEA 4QD4A 1NY0A 3VP4A 5HSQA 3H82B 4X53A 1W8QA 2PHYA 1BYWA 4Y7PA 3BLSA 2R9XA 2NUTC 3C8CA 1K4FA 2Z6CA 4X55A 4EBNA 1VEUA 1SZVA 5F6AA 3Q82A 5HL1A 5F68A 4RX3A 3Q7VA 2Y8HA 2WKQA 4GCZA 3GECA 3OPLA 4Y0TA 3P98A 4DJ2A 2C5WB 2I72A 3BFDA 4JXSA 1MWTA 1T1CA 3R7WA 4RX2A 1YSPA 4B93A 4BD1A 4MDZA 3E4PA 1Y28A 2K2NA 2FFYA 2ZOHA 2GNXA 4XT2B 2VK3A 2XLNA 2UWXA 1TF1A 3NC8A 1D7EA 3E0YA 4U0TA 3IH8A 2LB5A 2H0TA 1XPBA 3BYDA 2MJ6A 3CLOA 4DE0A 5EOEA 1F5MA 4I38A 1DY6A 3WS1A 3KSIA 1IKIA 1BSGA 3RXWA 3NOUC 3HLCA 4F3LA 2VV8A 1FOFA 2HDQA 1G6AA 1KOUA 4EESA 3VP2A 2Y2OA 3HVFA 3SW1A 5FI6A 5CTNA 3UDFA 3PBRA 3V3RA 5AQBA 1X0OA 1DRMA 3OC2A 3HBRA 3V67A 4X25A 4L0LA 1FCOA 2Y2QA 4HY8A 3B47A 3CG5A 5K5BA 2WAFA 1SCWA 1LT0A 3GQZA 4S2LA 3UB6A 4R3BA 3B33A 3S7OA 3MBZA 2PR6A 4EWFA 5KZHA 3MQOA 2V8CA 1K57C 1ONHA 2W0NA 2EWVA 3JVVA 5FEFA 4L9GA 1ONGA 5EPHA 1WYBA 4E6WA 4QY5A 4MCWA 1BLPA 1PIOA 3SH9A 2DRWA 3FYZA 1MWUA 1ESIA 4PAUA 4U0XA 3N8SA 5FQIA 5J7EA 4NG2A 2YKFA 3M6BA 1CI9A 4DN0A 2W3DA 2HZ5A 1AWIA 1N9OA 5HPFA 3NULA 1W7FA 3FWLA 3NOTC 3LO7A 3EGDC 4ZBEA 4RVAA 5FQ9A 4YFMA 3OLOA 2VGLM 4I3JA 4HESA 1HD8A 3LCEA 1P9WA 1FCNA 3CUEA 5FI2A 2H28A 5AQAA 2Y91A 4OOYA 2OWJA 4OPYA 3Q1FA 3N7WA 5A90A 3BFCA 2OWHA 4UA6A 1Y54A 2PYPA 2VZWA 2WGVA 4HP4A 4WM9A 5DKKA 2RL3A 4E3LA 2V2FF 5DFYA 4OOMA 4II7A 2X02A 3ZVWA 1BTLA 3L7HA 1BLHA 3OCLA 3ZG5A 4FUWA 3LEQA 3DTIA 5E2GA 1F9IA 3G32A 4F94A 5TBMA 4FSFA 3NJAA 3UB9A 4A5RA 3LI9A 2P04A 2W3EA 3UDIA 3NDEA 4G3KA 4UQIM 2X71A 2PDRA 3PBTA 5A92A 3LUQA 2WKEA 5A93A 4Z9QA 3KYEA 4C6YA 1MKIA 4Y5FA 3LY4A 3R4KA 3U2AA 4BQMA 1CJFA 1N9NA 2PBYA 2ACGA 2WKHA 2H0YA 4ETXA 2Y2LA 2CMNA 2K7SA 1HZOA 1Y4OA 4JGRA 3HUMA 4OLGA 1JVJA 4EW7A 4Y2FA 2B02A 5CRFA 2UV0E 4LRZE 5EUAA 3T4LA 2ZQ7A 4M4XA 1PWGA 1I5QA 4IUKA 1DJBA 3UPOA 4GJ4A 1K55A 1G5UA 1GHPA 2JE5A 1YM1A 4EBLA 3LGOA 1OT6A 5CGSA 4ZJ2A 3S4XA 3IX4A 3NCKA 3QNCA 4HOIA 2XD5A 5BOHA 5TJJA 4CLCC 4H6JB 1XJ3A 3CPTA 3MSHA 3WS0A 3V39A 5G4ZA 3MQ0A 3LICA 4ARZB 2ZC4B 2VA0A 3H7WB 3M2JA 2P9VA 4KZAA 4HJ4A 2BASA 4MNRA 1MC0A 4X1LA 1S1YA 4LRYC 1XJ4A 3FV7A 3E4OA 4XUZA 1C3BA 3CHWP 1SDEA 3G34A 1W5DA 1SKOA 3HREA 4E3OA 1VEUB 2W1TB 3GVBA 5GL9A 1TD5A 1DP6A 2Y2HA 1H3QA 1TDGA 4PKYG 3Q7ZA 3DWKA 3GTCA 1W8YA 3BFEA 2JKFA 5A91A 1HLUP 3OCNA 4NXBA 2Z2MB 3PTEA 1L0FA 1MWRA 2J3TD 1KGFA 1JWVA 3KSGA 1ALQA 3MZEA 2PT7A 2YKHA 1L0GA 2ZMFA 2Y79A 1FSWA 4IBRA 3R7WB 1LL9A 4HBUA 3WRZA 2XFSA 3A0RA 5U47A 3IXBA 4E6XA 4D2OA 3N4IA 2O9CA 2Y2MA 2J9PA 3IWIA 2L1MA 1LL8A 5KSCA 5TGFA 1KVLA 4E3MA 5HWVA 4NETA 4GS9A 1LI0A 3QP4A 2EA9A 2XR0A 3MQQA 3RH8B 3QP6A 2WZXA 2XSSA 1CQAA 3E4QA 5HWWA 4O0PA 1GHMA 5GLAA 2ZLYA 4JGOA 4S2NA 4WBGA 4PHTA 3PBNA 2W3GA 4G3VA 4P6BA 4YNRA 1LLBA 4LV2A 2J9OA 1XGJA 1ERMA 2B18A 2ZQ8A 2HP9A 4N1XA 1K6SA 4B4XA 1S6RA 3BFFA 4QHCA 3FPWA 2EXBA 2QJ7A 2E8IA 2ZM2A 1NRJA 2V1ZA 2WGIA 1FR6A 4P0MA 4JPMA 4WZ5A 5G4YA 5EV0A 4KZ5A 1TEMA 3T1RA 4JXWA 3OBFA 3NI9A 4E3KA 1AXBA 4Y15A 3P01A 4KQDA 5CTMA 1W63Q 4CQHA 4E3IA 5F1GA 5GLDA 5HWTA 4S2KA 3OPPA 4OOLA 5HAPA 2GJ3A 4DMZA 5KMWA 4HBTA 2FZ0A 3LYXA 2DNSA 4MBFA 2XA7M 1WE4A 4L9FA 3ZNTA 5IU1A 3KSHA 4DKIA 2OLVA 2WZZA 1JNUA 4KZ4A 4I3AA 5E43A 2EX8A 5MC7A 4R4RA 4ME4A 5HZHA 3JYIA 2O99A 3ZYTA 2QMIA 1VM1A 3RFBA 5CEDA 3W2ZA 1YSQA 5HFOA 2O0YA 4CLCE 5AQ7A 3KSFA 3V50A 1JTGA 3VOZA 3VSLA 3VMAA 3HLGA 5G18A 3B42A 2EX9A 3UO9A 1SHVA 2V1BA 3T4JA 3SZTA 3HLFA 5C5KA 2VGLS 1NRFA 4IEDA 3LIAA 1I2WA 2Z6DA 2V0WA 3C4OA 4R70A 1H8MA 2Q9MA 4MBHA 1OTDA 3K2NA 2PRFA 4KZBA 3IF6A 5JYOA 4LRXC 1GCEA 1YLZA 3UE1A 5HD3A 3MXRA 4IVIA 3F1PA 4R6LA 4S2MA 4ZJ3A 4FOFA 5EECA 4G3WA 3WWXA 5FEGA 2Z2LB 3CUEC 3BQAA 2H5SA 4PM8A 5TBMB 1NWZA 4WLAA 3ITAA 4Y0UA 3ZG8B 3T50A 5DVAA 2EX6A 4GD8A 1IYPA 3C38A 4S2OA 5GLBA 5IHVA 1SDNA 4EERA 1LL5A 1OTIA 4KG6A 5E2FA 3VSKA 5KIZA 4WELA 1YLWA 2M1CA 2XF3A 1S66L 4R0QA 4U3TA 5DF8A 3O88A 3IS2A 2QKPA 2Y2PA 3IT9A 3FZCA 4CPKA 4NXFA 3DTKA 2HDSA 4LLOB 2LB9A 2O9BA 2PU4A 1H8ZA 3SOIA 1M40A 4LCMA 3W8KA 5D3OA 3EGXC 3ZGAB 1UGUA 1YPRA 3C30A 1NLZA 2W27A 2EWWA 4QU3A 4WMCA 2ZD8A 2PD7A 1DP8A 3Q07A 3LY3A 3O86A 3NBLA 1YLYA 1BZAA 1D06A 4LV3A 3IBRA 4IVKA 4KZ8A 1XP4A 1QMEA 4IJGA 3V3SA 4GHIB 3CPTB 4DJ3A 2R78A 4S2IA 2WADA 1OTAA 5AQ9A 3E98A 4HQAA 4PM7A 3WS4A 4UAAA 1K55C 1K4EA 4JF6A 4HH3A 1ACFA 4GZBA 5JYPA 4R38A 3DTEA 2HP6A 4WEKA 4X68A 3C5AA 1NXYA 4R4SA 5CECA 4HHDA 2GZAA 2VV6A 1SKOB 2ZQDA 3IHAA 4WMCD 2W3HA 3VFHA 1F2KA
chains in the Genus database with same CATH topology
3VV4A 1TS6A 4HOIA 4YWZA 4HI4A 3F1NA 5TJJA 2A24B 1NLYA 4CLCC 4H6JB 3S7QA 3D3OA 3F1OA 4B9OA 1XJ3A 2ZMVA 1ZTUA 5A8BA 3LIBA 4EQ1A 3NHQA 2J80A 5F5YA 5J3WA 1P97A 4EETB 3HJIA 3FG8A 4MMNA 5G4ZA 5DJTA 1T1AA 5AVFA 3K3CA 5HDSA 1UWPX 3MQ0A 3H82A 3LICA 4UQIS 4ARZB 3HJKA 1GSWA 2VA0A 3FC7A 4CLCA 3PBSA 5DKLA 3H7WB 4UEYA 3H9WA 2XRNA 2ZBBA 1T1BA 1XFNA 2VV7A 2BASA 4HJ4A 1MC0A 1S1YA 4LRYC 1XJ4A 2XROA 3E4OA 3BJNA 2INWA 3PBQA 4EU0A 3T4QA 1UWNX 2QHKA 4GS9B 4O8GA 3BY9A 4BBVA 4I5SA 4L9EA 2P7JA 4MN7A 2W1TB 4HIAA 2PD8A 4KUOA 1LSWA 1TD5A 1OTEA 4YOFA 1DP6A 3UB7A 1H3QA 2P08A 1LSVA 1S4SA 4PKYG 2NUPC 1VB6A 3EOIA 2A24A 4H6JA 1ZHHB 2OAQ1 3OCNA 2HF6A 4EXOA 4KQOA 3D72A 4NXBA 3HCYA 2J3TD 3KSGA 4XT2A 3F1NB 2A2LA 3A0VA 2PT7A 2YKHA 4GW9A 2ZMFA 3VE3A 4EEUA 4Q0JA 2Y79A 3F1OB 3KX0X 1T18A 3LR0A 3R7WB 3TE8A 4CLCD 3LR5A 2M7UA 4HJ3A 2JHEA 4KUKA 3A0RA 2JKTI 4NEED 5HSQA 2O9CA 3H82B 4IHQA 3RTYA 4CLCB 2L1MA 1LL8A 2HGVA 3LIFA 2PHYA 3MF0A 1BYWA 4EEPA 4BJPA 2NUTC 3C8CA 5HWVA 3ZQ5A 4GS9A 2Z6CA 3MMHA 2EA9A 3MQQA 3RH8B 1P0ZA 5HL6A 4Q0HA 3G6OA 2XSSA 2J3WA 5AVEA 3MJQA 4NXGA 3VE4A 3E4QA 5HD5A 5HWWA 3K3DA 4O0PA 5F6AA 1MKMA 4JGOA 3PR6A 2W1RA 5F68A 1OT9A 2Y8HA 2WKQA 2J3TC 4PHTA 4QPRA 2HJEA 4GCZA 1IFQA 3O5YA 2K31A 3PBNA 3GECA 2W3GA 3KYZA 3UB8A 4G3VA 4DJ2A 4YNRA 4E04A 1S1ZA 5HDCA 3R7WA 3T4TA 1T1CA 2JN7A 2B18A 2FH5A 2XA7S 1YSPA 5AJGA 1IOUA 4B93A 4MDZA 3E4PA 4RQ9A 1Y28A 2K2NA 2ZOHA 2GNXA 4XT2B 3FPWA 1TF1A 2QJ7A 2V1AA 1D7EA 2V0UA 3E0YA 3CI6A 1NRJA 2LB5A 4Z1WA 2MJ6A 2PR5A 3CLOA 3T4KA 3OOVA 1OTBA 1F5MA 5G4YA 2W3FA 4I38A 2OOLA 1OPXA 4Q0IA 3OBFA 4PKYA 4K08A 3P01A 4KQDA 3KSIA 1W63Q 3BWLA 4CQHA 2QJ5A 4HJ6A 5I5LA 3T4SA 4BBUA 5HWTA 3MFXA 3NOUC 4OOLA 4WUJA 4F3LA 2VV8A 2GJ3A 3CITA 4NXEA 4DMZA 1KOUA 5HPIA 4EESA 2L0WA 4WF0A 2D02A 5IS1A 1GSVA 2FZ0A 3LYXA 1P9RA 2XA7M 4MN5A 3SW1A 4L9FA 4I3IA 5IU1A 3KSHA 3PBRA 2PYRA 1JNUA 3GDIA 1V9ZA 1X0OA 4I3AA 2QYBA 1DRMA 3OC2A 3V67A 4WL9A 4L0LA 1OJGA 5MC7A 4HY8A 4ME4A 3B47A 5HZHA 4WEJA 2O99A 3ZYTA 5K5BA 3MXQA 1LT0A 3ULFA 3RFBA 1WA9A 3F1PB 3W2ZA 3LIEA 4NKPA 3UB6A 1YSQA 2KDKA 2OAP1 2I9VA 1W63M 3B33A 2O0YA 3S7OA 4CLCE 3KSFA 2VX8A 4EUVA 2PR6A 3MQOA 2WKPA 2IA2A 2KX6A 3B42A 4BMWA 3S7PA 2V9AA 1N9LA 2V1BA 3T4JA 1S67L 4MN6A 5C5KA 2W0NA 2EWVA 2VGLS 3JVVA 3P7NA 4L9GA 3LIAA 2Z6DA 3UE3A 2V0WA 4F3LB 5IT5A 2D01A 4R70A 4ZRRA 4MCWA 1V9YA 4BWIA 1TS8A 4PAUA 1H8MA 3UE6A 1TS0A 2JKRM 4GLQA 1OTDA 3K2NA 5J7EA 3LI8A 4LRXC 2YKFA 5KSHA 4DN0A 2DMWA 2W3DA 3CWFA 5HD3A 1LSXA 1VHMA 3F1PA 4R6LA 4FOFA 2VLGA 4G3WA 3CUEC 1N9OA 3BQAA 3NOPC 1F98A 3EQUA 5HPFA 3FPVA 5TBMB 2M7VA 1NWZA 3NOTC 4WLAA 5HDDA 2GX5A 3EGDC 1XFQA 5DF9A 4JGPA 3T50A 3OLOA 5DJUA 4P6ZS 1STZA 2VGLM 4I3JA 4HP9A 3MR0A 4GHIA 1P9WA 5J4EA 3VOLA 3CUEA 3C38A 1ODVA 4EERA 2H28A 3EQVA 2VKSA 3PBOA 2OWJA 1OTIA 5KIZA 3DBAA 2OWHA 1GSXA 3KYQA 4WELA 2PYPA 2VZWA 1MZUA 4HP4A 2M1CA 2HV1A 1S66L 3TJZC 5DKKA 3PXPA 1YAXA 3A0SA 3IS2A 1YKDA 4R3AA 2L4RA 2QKPA 2ZOIA 1OJ5A 5DFXA 4AFIA 5DFYA 4OOMA 3ICYA 4NXFA 3KO6A 4II7A 3C2WA 4LLOB 2LB9A 2O9BA 1G28A 3UMEA 1XJ6A 3OCLA 3EGXC 3UMDA 4I39A 3IBJA 3LR3A 1F9IA 3EWKA 3CAXA 4P6ZM 4WN5A 3EEAA 1S4RA 3BY8A 5TBMA 4FSFA 1G6OA 1UGUA 3NJAA 3C30A 3UB9A 1NLZA 2QWSA 2W27A 3LI9A 2EWWA 3S7NA 2P04A 2W3EA 2PD7A 1DP8A 3TW8A 5L8MA 2WKRA 4G3KA 4BBTA 5F69A 4UQIM 5EFWA 2PDRA 3PBTA 4Y3IA 1D06A 3LUQA 3IBRA 1DP9A 3PYPA 4IJGA 4ARZA 4JGQA 2JKTM 2KOIA 4GHIB 3BW6A 4Y5FA 5CX7A 3BQ8A 3EEHA 3H7WA 1EW0A 3R4KA 4DJ3A 2G7UA 4LPZA 2R78A 3U2AA 3LR4A 4HNBA 2VEAA 1N9NA 3JVUA 3LFVA 1XJ2A 1OTAA 2KLIA 3E98A 4HQAA 4ETZA 4ETXA 2CMNA 1T19A 2K7SA 2VJWA 3PHYA 4HH3A 4JGRA 3IS2B 4EW7A 4Y2FA 2B02A 4R38A 2HJ9C 4LRZE 3T4LA 2O9AA 4WEKA 4M4XA 5LBRA 5FL3A 2W1TA 1TS7A 4IUKA 3LIDA 2JKRI 4HH2A 4HHDA 4GJ4A 4O01A 2GZAA 2VV6A 3TRCA 4IUHA 2W3HA 3T4OA 1OT6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TS6 A;  4HOI A;  4YWZ A;  4HI4 A;  3F1N A;  2A24 B;  4H6J B;  3F1O A;  4B9O A;  1XJ3 A;  5A8B A;  3LIB A;  4EQ1 A;  3NHQ A;  2J80 A;  5F5Y A;  5J3W A;  1P97 A;  4EET B;  3HJI A;  3FG8 A;  5G4Z A;  5DJT A;  1T1A A;  5AVF A;  3K3C A;  5HDS A;  1UWP X;  3H82 A;  3LIC A;  3HJK A;  1GSW A;  3FC7 A;  5DKL A;  3H7W B;  3H9W A;  2ZBB A;  1T1B A;  1XFN A;  2VV7 A;  2BAS A;  4HJ4 A;  1S1Y A;  4LRY C;  1XJ4 A;  3E4O A;  2INW A;  1UWN X;  2QHK A;  4GS9 B;  3BY9 A;  4BBV A;  4I5S A;  4L9E A;  2P7J A;  4HIA A;  2PD8 A;  4KUO A;  1LSW A;  1OTE A;  1DP6 A;  3UB7 A;  1LSV A;  1S4S A;  4PKY G;  1VB6 A;  2A24 A;  4H6J A;  4EXO A;  3D72 A;  4NXB A;  4XT2 A;  3F1N B;  3A0V A;  2YKH A;  4GW9 A;  3VE3 A;  4EEU A;  3F1O B;  3KX0 X;  1T18 A;  4HJ3 A;  2JHE A;  4KUK A;  3A0R A;  5HSQ A;  3H82 B;  3RTY A;  2L1M A;  1LL8 A;  3LIF A;  2PHY A;  1BYW A;  4EEP A;  3C8C A;  5HWV A;  3ZQ5 A;  4GS9 A;  2Z6C A;  2EA9 A;  3MQQ A;  3RH8 B;  1P0Z A;  3G6O A;  5AVE A;  3MJQ A;  4NXG A;  3VE4 A;  3E4Q A;  5HD5 A;  5HWW A;  3K3D A;  5F6A A;  4JGO A;  5F68 A;  1OT9 A;  2WKQ A;  4GCZ A;  3GEC A;  3UB8 A;  4DJ2 A;  4E04 A;  1S1Z A;  5HDC A;  1T1C A;  2JN7 A;  3E4P A;  4RQ9 A;  1Y28 A;  2ZOH A;  4XT2 B;  2QJ7 A;  2V1A A;  1D7E A;  2V0U A;  2PR5 A;  3CLO A;  1OTB A;  5G4Y A;  4I38 A;  2OOL A;  4PKY A;  4K08 A;  4KQD A;  3BWL A;  2QJ5 A;  4HJ6 A;  5I5L A;  4BBU A;  5HWT A;  3MFX A;  3NOU C;  4WUJ A;  4F3L A;  2VV8 A;  2GJ3 A;  4NXE A;  1KOU A;  4EES A;  2L0W A;  4WF0 A;  2D02 A;  5IS1 A;  1GSV A;  3LYX A;  4MN5 A;  3SW1 A;  4L9F A;  4I3I A;  5IU1 A;  2PYR A;  1JNU A;  3GDI A;  1V9Z A;  1X0O A;  4I3A A;  1DRM A;  4WL9 A;  1OJG A;  4HY8 A;  5HZH A;  3MXQ A;  1LT0 A;  3ULF A;  1WA9 A;  3F1P B;  3LIE A;  3UB6 A;  2KDK A;  2I9V A;  3B33 A;  2PR6 A;  3MQO A;  2WKP A;  2KX6 A;  2V9A A;  1N9L A;  2V1B A;  1S67 L;  4MN6 A;  2W0N A;  3P7N A;  4L9G A;  3LIA A;  2Z6D A;  2V0W A;  4F3L B;  2D01 A;  4R70 A;  1V9Y A;  1TS8 A;  3UE6 A;  1TS0 A;  1OTD A;  5J7E A;  3LI8 A;  4LRX C;  2YKF A;  3CWF A;  5HD3 A;  1LSX A;  3F1P A;  4R6L A;  2VLG A;  1N9O A;  3NOP C;  1F98 A;  5TBM B;  1NWZ A;  5HDD A;  3NOT C;  4WLA A;  1XFQ A;  4JGP A;  3T50 A;  3OLO A;  5DJU A;  4I3J A;  4HP9 A;  3MR0 A;  4GHI A;  5J4E A;  3VOL A;  1ODV A;  4EER A;  2H28 A;  2OWJ A;  1OTI A;  5KIZ A;  2OWH A;  1GSX A;  2PYP A;  1MZU A;  4HP4 A;  2M1C A;  2HV1 A;  1S66 L;  5DKK A;  3A0S A;  3IS2 A;  4R3A A;  2L4R A;  2QKP A;  2ZOI A;  1OJ5 A;  3ICY A;  4NXF A;  3C2W A;  4LLO B;  1G28 A;  3UME A;  1XJ6 A;  3UMD A;  4I39 A;  1F9I A;  3EWK A;  3CAX A;  4WN5 A;  1S4R A;  3BY8 A;  5TBM A;  1UGU A;  3NJA A;  3UB9 A;  2QWS A;  2W27 A;  3LI9 A;  2PD7 A;  1DP8 A;  2WKR A;  4BBT A;  5F69 A;  5EFW A;  2PDR A;  1D06 A;  3LUQ A;  3IBR A;  1DP9 A;  3PYP A;  4JGQ A;  4GHI B;  3H7W A;  3EEH A;  1EW0 A;  4DJ3 A;  4LPZ A;  2R78 A;  4HNB A;  2VEA A;  1N9N A;  1XJ2 A;  1OTA A;  4HQA A;  2CMN A;  1T19 A;  2K7S A;  3PHY A;  4HH3 A;  4JGR A;  3IS2 B;  4EW7 A;  2B02 A;  4R38 A;  4LRZ E;  4M4X A;  1TS7 A;  3LID A;  4HH2 A;  4HHD A;  2VV6 A;  1OT6 A; 
#chains in the Genus database with same CATH topology
 3F1N A;  3QP1 A;  2ZMV A;  4LV0 A;  3MKE A;  1ZTU A;  3LIB A;  3NHQ A;  3G35 A;  2J80 A;  5F5Y A;  5E2E A;  5EVL A;  4MMN A;  1K56 A;  1JWZ A;  1PW1 A;  1T1A A;  5DJT A;  5CGW A;  3K3C A;  1U60 A;  4DDY A;  5TFQ A;  3H82 A;  1FIL A;  3HJK A;  3FC7 A;  1CF0 A;  5FDS A;  2XRN A;  2ZBB A;  3VP0 A;  5FAQ A;  1XFN A;  5M1A A;  2HDR A;  1FR1 A;  1N9B A;  3TSG A;  4BLM A;  2XRO A;  1KVM A;  1MXO A;  3IWQ A;  1UWN X;  4GS9 B;  5DF7 A;  1XKZ A;  3BY9 A;  2PU2 A;  1L0E A;  3UDX A;  4YOF A;  3UB7 A;  4R1G A;  4DXC A;  2RCX A;  3IXD A;  3A3D A;  5HW3 A;  3EOI A;  2A24 A;  4JXG A;  2OAQ 1;  3GV9 A;  4KQO A;  1H5X A;  1TVF A;  4NK3 A;  4XT2 A;  3IWO A;  3A0V A;  1K56 D;  3VE3 A;  3HUO A;  3F1O B;  3KX0 X;  4WZ4 A;  1T18 A;  1HTZ A;  3TE8 A;  4OPQ A;  1BLC A;  2EX2 A;  4ZTK A;  4KUK A;  4FTX A;  2B95 A;  4LFU A;  1IEL A;  3RTY A;  4X6T A;  4CLC B;  1NZU A;  2HGV A;  1K0K A;  3LIF A;  4KZ7 A;  4PMA A;  4UA7 A;  4OKP A;  4BJP A;  3VP1 A;  2C6W B;  3G2Y A;  3ZQ5 A;  4LEN A;  1PI4 A;  2ZL1 A;  3AGD A;  1P0Z A;  5EM1 A;  4Q0H A;  1VET B;  1ES4 A;  2J3W A;  5AVE A;  4GOG A;  3UB5 P;  3VOY A;  5HAQ A;  1MKM A;  2BTF P;  3PR6 A;  2J7V A;  3ZDJ A;  4OVD A;  1YLP A;  4MEZ A;  5CHU A;  1S0W A;  4QPR A;  2HJE A;  1O7E A;  2XK1 A;  3KYZ A;  5GHZ A;  1QMF A;  4E04 A;  1K38 A;  1FIK A;  5HDC A;  3T4T A;  2JN7 A;  3MXS A;  4QB8 A;  4WZ5 C;  2XA7 S;  1IOU A;  3A3E A;  2BLS A;  1ES5 A;  2Y2N A;  2V1A A;  2V0U A;  5GHY A;  4Z1W A;  1KGE A;  2JBF A;  1KE3 A;  3T4K A;  3OOV A;  1OTB A;  3HL9 A;  3SS5 A;  5F82 A;  2W3F A;  2PBD P;  3C4P A;  1XX2 A;  1OPX A;  4Q0I A;  3GMW A;  1NYM A;  1D1J A;  5EVI A;  1YQS A;  3FKV A;  3ZVT A;  4GDN A;  1ESU A;  3SS3 A;  4C3Q A;  1CI8 A;  2QJ5 A;  3T4S A;  5I5L A;  3IH9 A;  1DJA A;  3GR2 A;  1IEM A;  2XEP A;  2QPN A;  5HPI A;  4D60 A;  1PYY A;  4WF0 A;  5IS1 A;  1GSV A;  4GB7 A;  4OON A;  1PZO A;  3IXG A;  4MN5 A;  1A0K A;  3FKW A;  3IHB A;  5CEB A;  3DAV A;  3Q7V B;  1E3U A;  2PYR A;  2JC7 A;  3GDI A;  1V9Z A;  2B5R A;  1YMS A;  1OJG A;  4WEJ A;  1WA9 A;  3F1P B;  2OSU A;  2WK0 A;  3LIE A;  4NKP A;  2KDK A;  1GHI A;  2I9V A;  1W63 M;  2A3U A;  2V8F A;  2ZQ9 A;  4DXB A;  5EVI D;  5F83 A;  3G2Z A;  4EUV A;  3CMZ A;  1Q2Q A;  2WKP A;  3ZG0 A;  2KX6 A;  3S7P A;  1S67 L;  4RYE A;  4MN6 A;  4KQR A;  2ZQC A;  4P87 A;  3JPU A;  3DWZ A;  3G31 A;  3RJU A;  1OME A;  3UE3 A;  5E2H A;  4EBP A;  1FCM A;  2D01 A;  4F3L B;  4ZRR A;  2G2U A;  4BWI A;  1TS8 A;  4KZ6 A;  1TS0 A;  4GLQ A;  1LHY A;  4N92 A;  2ZC7 A;  1KDS A;  2OLU A;  1O07 A;  4OH0 A;  3S22 A;  3CWF A;  3HLE A;  5CHJ A;  1LSX A;  1VHM A;  1YLJ A;  4KEN B;  2HPB A;  2ZM8 A;  2VLG A;  3NOP C;  3FPV A;  2CC1 A;  5HDD A;  2GX5 A;  1XFQ A;  3IX8 A;  2JCH A;  5DF9 A;  5CER A;  2XGN A;  5FQM A;  4HP9 A;  1PRQ A;  2EFU A;  5J4E A;  4MLL A;  1ODV A;  3G4P A;  4OQH A;  2VKS A;  1PWC A;  3D9Y A;  4H8R A;  3B3X A;  3KYQ A;  3GRJ A;  2R9W A;  4ID4 A;  2HV1 A;  3UY6 A;  1J3W A;  1NYY A;  3PXP A;  1YAX A;  3A0S A;  2XDM A;  5FAT A;  2L4R A;  1GA9 A;  1K54 A;  2ZOI A;  4AFI A;  4GKU A;  2WAE A;  4JF5 A;  4MBK A;  1MY8 A;  1G28 A;  3BRM A;  3UME A;  1XJ6 A;  3TG9 A;  3UMD A;  3ITB A;  3PAE A;  4KZ9 A;  3CAX A;  4P6Z M;  4WN5 A;  3EEA A;  1S4R A;  1G6O A;  5J8X A;  2QWS A;  3S7N A;  5L07 A;  2GDN A;  5L8M A;  2WKR A;  4Q8I A;  4ZJ1 A;  5F69 A;  5EFW A;  1LI9 A;  4ZDX A;  5CXW A;  2ZC3 B;  5FQK A;  4ARZ A;  5M18 A;  2JKG A;  5CX7 A;  3BQ8 A;  3H7W A;  4XXR A;  3QP5 A;  4E3J A;  2G7U A;  4LPZ A;  4HNB A;  1PI5 A;  3JVU A;  5EVE A;  3AGF A;  2Q9N A;  3BEC A;  3SH8 A;  1RGY A;  2Q0O A;  2O9A A;  4N1H A;  5FL3 A;  2W1T A;  3D4F A;  3LID A;  2JKR I;  4HH2 A;  3ZCZ A;  4JXV A;  1BLS A;  4S2J A;  4O01 A;  1N4O A;  4K91 A;  3N8R A;  3OPH A;  5FQJ A;  2X01 A;  3UE0 A;  4DE1 A;  1TS6 A;  4HI4 A;  1H8Y A;  2A24 B;  1K6R A;  1ZC2 A;  5A8B A;  4EQ1 A;  4B88 A;  3UN7 A;  1P97 A;  2Y59 A;  3HJI A;  5FSR A;  2ZM0 A;  1YMX A;  1YT4 A;  4KZ3 A;  3ZNY A;  5AVF A;  5HDS A;  1PWD A;  4UQI S;  1GSW A;  3PBS A;  5DKL A;  3W4P A;  3H9W A;  3HUN A;  1T1B A;  4UHU A;  2VV7 A;  4K0X A;  4PM5 A;  1PZP A;  3P09 A;  1IYQ A;  3ZHH A;  3BJN A;  1CEF A;  2INW A;  3PBQ A;  4EU0 A;  1Z09 A;  2ZL1 B;  4R23 A;  3L9K A;  2P7J A;  2G2W A;  2Y2G A;  5TR7 A;  2P08 A;  1LSV A;  2EFX A;  3O87 A;  5FDH A;  2NUP C;  1VB6 A;  4LV1 A;  2EXA A;  5FI7 A;  3M6H A;  3UPN A;  4P85 A;  2HF6 A;  3N8L A;  3D72 A;  4X56 A;  5HX9 A;  3G30 A;  5FAO A;  3WRT A;  4PPR A;  5I94 A;  4Q0J A;  2AVX A;  3LR0 A;  1PFL A;  3UPP A;  1BT5 A;  3HLB A;  5FQQ A;  1Z6F A;  3NEC A;  1KE0 A;  2JKT I;  3A3J A;  3LEZ A;  4NEE D;  1XA7 A;  4EQI A;  4IHQ A;  2XQZ A;  3MF0 A;  3SS4 A;  2P9V B;  4EEP A;  4O7D A;  3MMH A;  1ZKJ A;  2IWD A;  5HL6 A;  5EVI B;  4CJN A;  2E8J A;  3G6O A;  4QJG A;  3MJQ A;  4DDS A;  3IXH A;  1JTD A;  4NXG A;  3VE4 A;  5HD5 A;  3K3D A;  3T1Q B;  2WUQ A;  2WGW A;  2W1R A;  3SH7 A;  4JKT A;  1RCJ A;  4FCF A;  1OT9 A;  3A3F A;  2J3T C;  4PM9 A;  4JF4 A;  3U4L P;  1IFQ A;  2FFF B;  2K31 A;  3O5Y A;  3UB8 A;  2Y55 A;  5EOO A;  1ZG4 A;  1S1Z A;  1CEG A;  3IF5 A;  3W4O A;  3T1S A;  4OP5 A;  2FH5 A;  2V20 A;  2Y2I A;  3DW0 A;  4QY6 A;  5AJG A;  4RQ9 A;  5HAR A;  5EVI C;  1XGI A;  3CI6 A;  2PR5 A;  4B4Z A;  4OPZ A;  3PAG A;  5CGX A;  2OOL A;  3QHY A;  2Y2K A;  5HAI A;  1J9M A;  4PKY A;  4K08 A;  4X1M A;  3BWL A;  1ES3 A;  4HJ6 A;  4BBU A;  2ZQA A;  3MFX A;  4BL3 A;  4WUJ A;  3CIT A;  4NXE A;  3HLW A;  4IBX A;  2HP5 A;  2L0W A;  4BD0 A;  2D02 A;  3MKF A;  1P9R A;  3MZD A;  1ES2 A;  4I3I A;  2XH9 A;  1MWS A;  3WS2 A;  4KQQ A;  2H10 A;  4KG5 A;  3E2L A;  4Y13 A;  2QYB A;  4FD8 A;  4JLF A;  4WL9 A;  1ERQ A;  2Y4A A;  4FH4 A;  3MXQ A;  3ULF A;  2A49 A;  4DE2 A;  2OAP 1;  3S1Y A;  2BG1 A;  2VGK A;  1E4D A;  2VX8 A;  1W79 A;  1IKG A;  4GDB A;  2XD1 A;  2IA2 A;  3BFG A;  4PM6 A;  4S2N C;  1M6K A;  4BMW A;  2V9A A;  1N9L A;  5L2F A;  4KG2 A;  4OPR A;  1XXM A;  2ZMA A;  5DTS A;  5F1F A;  3P7N A;  2Y2J A;  3CZD A;  4RA7 A;  2VGJ A;  2J8Y A;  5GLC A;  5IT5 A;  2XFT A;  1V9Y A;  3UE6 A;  2JKR M;  3ZG9 B;  1K57 A;  4EV4 A;  2P74 A;  3WS5 A;  3VP3 A;  4N9K A;  3LI8 A;  3GSG A;  4UA9 A;  2WKI A;  5KSH A;  2DMW A;  1SKF A;  4M3K A;  4GD6 A;  1F98 A;  3EQU A;  3M2K A;  2M7V A;  3HLD A;  3QP8 A;  4OP8 A;  4JGP A;  1FSY A;  5DJU A;  4GN2 A;  4P6Z S;  1STZ A;  3MR0 A;  4GHI A;  1FQG A;  5DTK A;  3VOL A;  3DTM A;  1K54 C;  1KE4 A;  3EQV A;  1E25 A;  1VQQ A;  3PBO A;  5CHM A;  3DBA A;  1GSX A;  3NDG A;  3MFD A;  1MZU A;  3OZH A;  4EUZ A;  3IQA A;  3OPR A;  3T1X A;  3TJZ C;  1KGG A;  2ZJ9 A;  1MPL A;  1YKD A;  4R3A A;  3MS6 A;  5DTT A;  5EE8 A;  3ZG7 B;  1OJ5 A;  5L10 A;  5DFX A;  1TDL A;  3ICY A;  3KO6 A;  3C2W A;  1IYO A;  3V5M A;  1EI5 A;  3I7J A;  3E2K A;  3IBJ A;  4I39 A;  3LR3 A;  1ZG6 A;  4OQ0 A;  1IYS A;  3RXX A;  4GNU A;  3EWK A;  1L3L A;  4R3J A;  3IF6 B;  3BY8 A;  1RP5 A;  1YLT A;  4OQI A;  3VFF A;  3TOI A;  4QWO A;  1H0M A;  5L09 A;  3TW8 A;  1PW8 A;  4BBT A;  3ISG A;  4Y3I A;  5FA7 A;  3IX3 A;  4WYY A;  2OV5 A;  1DP9 A;  3PYP A;  3UNW A;  4JGQ A;  2JKT M;  2KOI A;  2HDU A;  1RGZ A;  3BW6 A;  3EEH A;  1CK3 A;  1EW0 A;  3N6I A;  3O3V A;  4JBF A;  1HVB A;  3LR4 A;  4X69 A;  5EM0 A;  3NIA A;  4DF6 A;  1K25 A;  2VEA A;  3LFV A;  1XJ2 A;  3IF6 C;  2KLI A;  4ETZ A;  4BEN A;  4HEF A;  1T19 A;  2VJW A;  1BUL A;  4ESP A;  3CJM A;  3PHY A;  4BL2 A;  3IS2 B;  1E3U D;  2HJ9 C;  1L0D A;  1ERO A;  5LBR A;  1TS7 A;  4C75 A;  1Q2P A;  3W4Q A;  5FAS A;  1WYC A;  4FH2 A;  3A3I A;  3TRC A;  4IUH A;  3T4O A;  3NY4 A;  1EWZ A;  1MBL A;  2ZC5 B;  3VV4 A;  4YWZ A;  3MZF A;  1NLY A;  1NZO A;  3S7Q A;  3D3O A;  3F1O A;  4B9O A;  1L2S A;  5M19 A;  1KDW A;  1GA0 A;  3ZFZ A;  3QP2 A;  4DRT A;  4Y17 A;  5J3W A;  4EET B;  2DCF A;  2ZC6 B;  3FG8 A;  4OQG A;  2IWC A;  4OLD A;  4N9L A;  2PAV P;  1UWP X;  1DJC A;  4CLC A;  4UEY A;  1NJ4 A;  1PNE A;  3BM6 A;  4YIN A;  3C7U A;  2WYX A;  1VET A;  3BEB A;  1XA1 A;  3C7V A;  1G68 A;  3T4Q A;  2QHK A;  4O8G A;  4Y0O A;  3BLM A;  4BBV A;  3Q81 A;  4I5S A;  4L9E A;  3QNB A;  4S2P A;  4MN7 A;  3T12 B;  5FAP A;  4HIA A;  2PD8 A;  4KUO A;  1LSW A;  1OTE A;  4K0W A;  1S4S A;  4LCL A;  3AGE A;  5GHX A;  2WGW B;  4DE3 A;  2QZ6 A;  4H6J A;  4ZAM A;  1ZHH B;  2IWB A;  4EXO A;  3HCY A;  2A2L A;  3F1N B;  4GW9 A;  4EEU A;  4XUX A;  1BUE A;  4CLC D;  3LR5 A;  1I2S A;  4LGW A;  2M7U A;  4HJ3 A;  1JWP A;  4E3N A;  2JHE A;  4QD4 A;  1NY0 A;  3VP4 A;  5HSQ A;  3H82 B;  4X53 A;  1W8Q A;  2PHY A;  1BYW A;  4Y7P A;  3BLS A;  2R9X A;  2NUT C;  3C8C A;  1K4F A;  2Z6C A;  4X55 A;  4EBN A;  1VEU A;  1SZV A;  5F6A A;  3Q82 A;  5HL1 A;  5F68 A;  4RX3 A;  3Q7V A;  2Y8H A;  2WKQ A;  4GCZ A;  3GEC A;  3OPL A;  4Y0T A;  3P98 A;  4DJ2 A;  2C5W B;  2I72 A;  3BFD A;  4JXS A;  1MWT A;  1T1C A;  3R7W A;  4RX2 A;  1YSP A;  4B93 A;  4BD1 A;  4MDZ A;  3E4P A;  1Y28 A;  2K2N A;  2FFY A;  2ZOH A;  2GNX A;  4XT2 B;  2VK3 A;  2XLN A;  2UWX A;  1TF1 A;  3NC8 A;  1D7E A;  3E0Y A;  4U0T A;  3IH8 A;  2LB5 A;  2H0T A;  1XPB A;  3BYD A;  2MJ6 A;  3CLO A;  4DE0 A;  5EOE A;  1F5M A;  4I38 A;  1DY6 A;  3WS1 A;  3KSI A;  1IKI A;  1BSG A;  3RXW A;  3NOU C;  3HLC A;  4F3L A;  2VV8 A;  1FOF A;  2HDQ A;  1G6A A;  1KOU A;  4EES A;  3VP2 A;  2Y2O A;  3HVF A;  3SW1 A;  5FI6 A;  5CTN A;  3UDF A;  3PBR A;  3V3R A;  5AQB A;  1X0O A;  1DRM A;  3OC2 A;  3HBR A;  3V67 A;  4X25 A;  4L0L A;  1FCO A;  2Y2Q A;  4HY8 A;  3B47 A;  3CG5 A;  5K5B A;  2WAF A;  1SCW A;  1LT0 A;  3GQZ A;  4S2L A;  3UB6 A;  4R3B A;  3B33 A;  3S7O A;  3MBZ A;  2PR6 A;  4EWF A;  5KZH A;  3MQO A;  2V8C A;  1K57 C;  1ONH A;  2W0N A;  2EWV A;  3JVV A;  5FEF A;  4L9G A;  1ONG A;  5EPH A;  1WYB A;  4E6W A;  4QY5 A;  4MCW A;  1BLP A;  1PIO A;  3SH9 A;  2DRW A;  3FYZ A;  1MWU A;  1ESI A;  4PAU A;  4U0X A;  3N8S A;  5FQI A;  5J7E A;  4NG2 A;  2YKF A;  3M6B A;  1CI9 A;  4DN0 A;  2W3D A;  2HZ5 A;  1AWI A;  1N9O A;  5HPF A;  3NUL A;  1W7F A;  3FWL A;  3NOT C;  3LO7 A;  3EGD C;  4ZBE A;  4RVA A;  5FQ9 A;  4YFM A;  3OLO A;  2VGL M;  4I3J A;  4HES A;  1HD8 A;  3LCE A;  1P9W A;  1FCN A;  3CUE A;  5FI2 A;  2H28 A;  5AQA A;  2Y91 A;  4OOY A;  2OWJ A;  4OPY A;  3Q1F A;  3N7W A;  5A90 A;  3BFC A;  2OWH A;  4UA6 A;  1Y54 A;  2PYP A;  2VZW A;  2WGV A;  4HP4 A;  4WM9 A;  5DKK A;  2RL3 A;  4E3L A;  2V2F F;  5DFY A;  4OOM A;  4II7 A;  2X02 A;  3ZVW A;  1BTL A;  3L7H A;  1BLH A;  3OCL A;  3ZG5 A;  4FUW A;  3LEQ A;  3DTI A;  5E2G A;  1F9I A;  3G32 A;  4F94 A;  5TBM A;  4FSF A;  3NJA A;  3UB9 A;  4A5R A;  3LI9 A;  2P04 A;  2W3E A;  3UDI A;  3NDE A;  4G3K A;  4UQI M;  2X71 A;  2PDR A;  3PBT A;  5A92 A;  3LUQ A;  2WKE A;  5A93 A;  4Z9Q A;  3KYE A;  4C6Y A;  1MKI A;  4Y5F A;  3LY4 A;  3R4K A;  3U2A A;  4BQM A;  1CJF A;  1N9N A;  2PBY A;  2ACG A;  2WKH A;  2H0Y A;  4ETX A;  2Y2L A;  2CMN A;  2K7S A;  1HZO A;  1Y4O A;  4JGR A;  3HUM A;  4OLG A;  1JVJ A;  4EW7 A;  4Y2F A;  2B02 A;  5CRF A;  2UV0 E;  4LRZ E;  5EUA A;  3T4L A;  2ZQ7 A;  4M4X A;  1PWG A;  1I5Q A;  4IUK A;  1DJB A;  3UPO A;  4GJ4 A;  1K55 A;  1G5U A;  1GHP A;  2JE5 A;  1YM1 A;  4EBL A;  3LGO A;  1OT6 A;  5CGS A;  4ZJ2 A;  3S4X A;  3IX4 A;  3NCK A;  3QNC A;  4HOI A;  2XD5 A;  5BOH A;  5TJJ A;  4CLC C;  4H6J B;  1XJ3 A;  3CPT A;  3MSH A;  3WS0 A;  3V39 A;  5G4Z A;  3MQ0 A;  3LIC A;  4ARZ B;  2ZC4 B;  2VA0 A;  3H7W B;  3M2J A;  2P9V A;  4KZA A;  4HJ4 A;  2BAS A;  4MNR A;  1MC0 A;  4X1L A;  1S1Y A;  4LRY C;  1XJ4 A;  3FV7 A;  3E4O A;  4XUZ A;  1C3B A;  3CHW P;  1SDE A;  3G34 A;  1W5D A;  1SKO A;  3HRE A;  4E3O A;  1VEU B;  2W1T B;  3GVB A;  5GL9 A;  1TD5 A;  1DP6 A;  2Y2H A;  1H3Q A;  1TDG A;  4PKY G;  3Q7Z A;  3DWK A;  3GTC A;  1W8Y A;  3BFE A;  2JKF A;  5A91 A;  1HLU P;  3OCN A;  4NXB A;  2Z2M B;  3PTE A;  1L0F A;  1MWR A;  2J3T D;  1KGF A;  1JWV A;  3KSG A;  1ALQ A;  3MZE A;  2PT7 A;  2YKH A;  1L0G A;  2ZMF A;  2Y79 A;  1FSW A;  4IBR A;  3R7W B;  1LL9 A;  4HBU A;  3WRZ A;  2XFS A;  3A0R A;  5U47 A;  3IXB A;  4E6X A;  4D2O A;  3N4I A;  2O9C A;  2Y2M A;  2J9P A;  3IWI A;  2L1M A;  1LL8 A;  5KSC A;  5TGF A;  1KVL A;  4E3M A;  5HWV A;  4NET A;  4GS9 A;  1LI0 A;  3QP4 A;  2EA9 A;  2XR0 A;  3MQQ A;  3RH8 B;  3QP6 A;  2WZX A;  2XSS A;  1CQA A;  3E4Q A;  5HWW A;  4O0P A;  1GHM A;  5GLA A;  2ZLY A;  4JGO A;  4S2N A;  4WBG A;  4PHT A;  3PBN A;  2W3G A;  4G3V A;  4P6B A;  4YNR A;  1LLB A;  4LV2 A;  2J9O A;  1XGJ A;  1ERM A;  2B18 A;  2ZQ8 A;  2HP9 A;  4N1X A;  1K6S A;  4B4X A;  1S6R A;  3BFF A;  4QHC A;  3FPW A;  2EXB A;  2QJ7 A;  2E8I A;  2ZM2 A;  1NRJ A;  2V1Z A;  2WGI A;  1FR6 A;  4P0M A;  4JPM A;  4WZ5 A;  5G4Y A;  5EV0 A;  4KZ5 A;  1TEM A;  3T1R A;  4JXW A;  3OBF A;  3NI9 A;  4E3K A;  1AXB A;  4Y15 A;  3P01 A;  4KQD A;  5CTM A;  1W63 Q;  4CQH A;  4E3I A;  5F1G A;  5GLD A;  5HWT A;  4S2K A;  3OPP A;  4OOL A;  5HAP A;  2GJ3 A;  4DMZ A;  5KMW A;  4HBT A;  2FZ0 A;  3LYX A;  2DNS A;  4MBF A;  2XA7 M;  1WE4 A;  4L9F A;  3ZNT A;  5IU1 A;  3KSH A;  4DKI A;  2OLV A;  2WZZ A;  1JNU A;  4KZ4 A;  4I3A A;  5E43 A;  2EX8 A;  5MC7 A;  4R4R A;  4ME4 A;  5HZH A;  3JYI A;  2O99 A;  3ZYT A;  2QMI A;  1VM1 A;  3RFB A;  5CED A;  3W2Z A;  1YSQ A;  5HFO A;  2O0Y A;  4CLC E;  5AQ7 A;  3KSF A;  3V50 A;  1JTG A;  3VOZ A;  3VSL A;  3VMA A;  3HLG A;  5G18 A;  3B42 A;  2EX9 A;  3UO9 A;  1SHV A;  2V1B A;  3T4J A;  3SZT A;  3HLF A;  5C5K A;  2VGL S;  1NRF A;  4IED A;  3LIA A;  1I2W A;  2Z6D A;  2V0W A;  3C4O A;  4R70 A;  1H8M A;  2Q9M A;  4MBH A;  1OTD A;  3K2N A;  2PRF A;  4KZB A;  3IF6 A;  5JYO A;  4LRX C;  1GCE A;  1YLZ A;  3UE1 A;  5HD3 A;  3MXR A;  4IVI A;  3F1P A;  4R6L A;  4S2M A;  4ZJ3 A;  4FOF A;  5EEC A;  4G3W A;  3WWX A;  5FEG A;  2Z2L B;  3CUE C;  3BQA A;  2H5S A;  4PM8 A;  5TBM B;  1NWZ A;  4WLA A;  3ITA A;  4Y0U A;  3ZG8 B;  3T50 A;  5DVA A;  2EX6 A;  4GD8 A;  1IYP A;  3C38 A;  4S2O A;  5GLB A;  5IHV A;  1SDN A;  4EER A;  1LL5 A;  1OTI A;  4KG6 A;  5E2F A;  3VSK A;  5KIZ A;  4WEL A;  1YLW A;  2M1C A;  2XF3 A;  1S66 L;  4R0Q A;  4U3T A;  5DF8 A;  3O88 A;  3IS2 A;  2QKP A;  2Y2P A;  3IT9 A;  3FZC A;  4CPK A;  4NXF A;  3DTK A;  2HDS A;  4LLO B;  2LB9 A;  2O9B A;  2PU4 A;  1H8Z A;  3SOI A;  1M40 A;  4LCM A;  3W8K A;  5D3O A;  3EGX C;  3ZGA B;  1UGU A;  1YPR A;  3C30 A;  1NLZ A;  2W27 A;  2EWW A;  4QU3 A;  4WMC A;  2ZD8 A;  2PD7 A;  1DP8 A;  3Q07 A;  3LY3 A;  3O86 A;  3NBL A;  1YLY A;  1BZA A;  1D06 A;  4LV3 A;  3IBR A;  4IVK A;  4KZ8 A;  1XP4 A;  1QME A;  4IJG A;  3V3S A;  4GHI B;  3CPT B;  4DJ3 A;  2R78 A;  4S2I A;  2WAD A;  1OTA A;  5AQ9 A;  3E98 A;  4HQA A;  4PM7 A;  3WS4 A;  4UAA A;  1K55 C;  1K4E A;  4JF6 A;  4HH3 A;  1ACF A;  4GZB A;  5JYP A;  4R38 A;  3DTE A;  2HP6 A;  4WEK A;  4X68 A;  3C5A A;  1NXY A;  4R4S A;  5CEC A;  4HHD A;  2GZA A;  2VV6 A;  1SKO B;  2ZQD A;  3IHA A;  4WMC D;  2W3H A;  3VFH A;  1F2K A; 
#chains in the Genus database with same CATH homology
 3VV4 A;  1TS6 A;  4HOI A;  4YWZ A;  4HI4 A;  3F1N A;  5TJJ A;  2A24 B;  1NLY A;  4CLC C;  4H6J B;  3S7Q A;  3D3O A;  3F1O A;  4B9O A;  1XJ3 A;  2ZMV A;  1ZTU A;  5A8B A;  3LIB A;  4EQ1 A;  3NHQ A;  2J80 A;  5F5Y A;  5J3W A;  1P97 A;  4EET B;  3HJI A;  3FG8 A;  4MMN A;  5G4Z A;  5DJT A;  1T1A A;  5AVF A;  3K3C A;  5HDS A;  1UWP X;  3MQ0 A;  3H82 A;  3LIC A;  4UQI S;  4ARZ B;  3HJK A;  1GSW A;  2VA0 A;  3FC7 A;  4CLC A;  3PBS A;  5DKL A;  3H7W B;  4UEY A;  3H9W A;  2XRN A;  2ZBB A;  1T1B A;  1XFN A;  2VV7 A;  2BAS A;  4HJ4 A;  1MC0 A;  1S1Y A;  4LRY C;  1XJ4 A;  2XRO A;  3E4O A;  3BJN A;  2INW A;  3PBQ A;  4EU0 A;  3T4Q A;  1UWN X;  2QHK A;  4GS9 B;  4O8G A;  3BY9 A;  4BBV A;  4I5S A;  4L9E A;  2P7J A;  4MN7 A;  2W1T B;  4HIA A;  2PD8 A;  4KUO A;  1LSW A;  1TD5 A;  1OTE A;  4YOF A;  1DP6 A;  3UB7 A;  1H3Q A;  2P08 A;  1LSV A;  1S4S A;  4PKY G;  2NUP C;  1VB6 A;  3EOI A;  2A24 A;  4H6J A;  1ZHH B;  2OAQ 1;  3OCN A;  2HF6 A;  4EXO A;  4KQO A;  3D72 A;  4NXB A;  3HCY A;  2J3T D;  3KSG A;  4XT2 A;  3F1N B;  2A2L A;  3A0V A;  2PT7 A;  2YKH A;  4GW9 A;  2ZMF A;  3VE3 A;  4EEU A;  4Q0J A;  2Y79 A;  3F1O B;  3KX0 X;  1T18 A;  3LR0 A;  3R7W B;  3TE8 A;  4CLC D;  3LR5 A;  2M7U A;  4HJ3 A;  2JHE A;  4KUK A;  3A0R A;  2JKT I;  4NEE D;  5HSQ A;  2O9C A;  3H82 B;  4IHQ A;  3RTY A;  4CLC B;  2L1M A;  1LL8 A;  2HGV A;  3LIF A;  2PHY A;  3MF0 A;  1BYW A;  4EEP A;  4BJP A;  2NUT C;  3C8C A;  5HWV A;  3ZQ5 A;  4GS9 A;  2Z6C A;  3MMH A;  2EA9 A;  3MQQ A;  3RH8 B;  1P0Z A;  5HL6 A;  4Q0H A;  3G6O A;  2XSS A;  2J3W A;  5AVE A;  3MJQ A;  4NXG A;  3VE4 A;  3E4Q A;  5HD5 A;  5HWW A;  3K3D A;  4O0P A;  5F6A A;  1MKM A;  4JGO A;  3PR6 A;  2W1R A;  5F68 A;  1OT9 A;  2Y8H A;  2WKQ A;  2J3T C;  4PHT A;  4QPR A;  2HJE A;  4GCZ A;  1IFQ A;  3O5Y A;  2K31 A;  3PBN A;  3GEC A;  2W3G A;  3KYZ A;  3UB8 A;  4G3V A;  4DJ2 A;  4YNR A;  4E04 A;  1S1Z A;  5HDC A;  3R7W A;  3T4T A;  1T1C A;  2JN7 A;  2B18 A;  2FH5 A;  2XA7 S;  1YSP A;  5AJG A;  1IOU A;  4B93 A;  4MDZ A;  3E4P A;  4RQ9 A;  1Y28 A;  2K2N A;  2ZOH A;  2GNX A;  4XT2 B;  3FPW A;  1TF1 A;  2QJ7 A;  2V1A A;  1D7E A;  2V0U A;  3E0Y A;  3CI6 A;  1NRJ A;  2LB5 A;  4Z1W A;  2MJ6 A;  2PR5 A;  3CLO A;  3T4K A;  3OOV A;  1OTB A;  1F5M A;  5G4Y A;  2W3F A;  4I38 A;  2OOL A;  1OPX A;  4Q0I A;  3OBF A;  4PKY A;  4K08 A;  3P01 A;  4KQD A;  3KSI A;  1W63 Q;  3BWL A;  4CQH A;  2QJ5 A;  4HJ6 A;  5I5L A;  3T4S A;  4BBU A;  5HWT A;  3MFX A;  3NOU C;  4OOL A;  4WUJ A;  4F3L A;  2VV8 A;  2GJ3 A;  3CIT A;  4NXE A;  4DMZ A;  1KOU A;  5HPI A;  4EES A;  2L0W A;  4WF0 A;  2D02 A;  5IS1 A;  1GSV A;  2FZ0 A;  3LYX A;  1P9R A;  2XA7 M;  4MN5 A;  3SW1 A;  4L9F A;  4I3I A;  5IU1 A;  3KSH A;  3PBR A;  2PYR A;  1JNU A;  3GDI A;  1V9Z A;  1X0O A;  4I3A A;  2QYB A;  1DRM A;  3OC2 A;  3V67 A;  4WL9 A;  4L0L A;  1OJG A;  5MC7 A;  4HY8 A;  4ME4 A;  3B47 A;  5HZH A;  4WEJ A;  2O99 A;  3ZYT A;  5K5B A;  3MXQ A;  1LT0 A;  3ULF A;  3RFB A;  1WA9 A;  3F1P B;  3W2Z A;  3LIE A;  4NKP A;  3UB6 A;  1YSQ A;  2KDK A;  2OAP 1;  2I9V A;  1W63 M;  3B33 A;  2O0Y A;  3S7O A;  4CLC E;  3KSF A;  2VX8 A;  4EUV A;  2PR6 A;  3MQO A;  2WKP A;  2IA2 A;  2KX6 A;  3B42 A;  4BMW A;  3S7P A;  2V9A A;  1N9L A;  2V1B A;  3T4J A;  1S67 L;  4MN6 A;  5C5K A;  2W0N A;  2EWV A;  2VGL S;  3JVV A;  3P7N A;  4L9G A;  3LIA A;  2Z6D A;  3UE3 A;  2V0W A;  4F3L B;  5IT5 A;  2D01 A;  4R70 A;  4ZRR A;  4MCW A;  1V9Y A;  4BWI A;  1TS8 A;  4PAU A;  1H8M A;  3UE6 A;  1TS0 A;  2JKR M;  4GLQ A;  1OTD A;  3K2N A;  5J7E A;  3LI8 A;  4LRX C;  2YKF A;  5KSH A;  4DN0 A;  2DMW A;  2W3D A;  3CWF A;  5HD3 A;  1LSX A;  1VHM A;  3F1P A;  4R6L A;  4FOF A;  2VLG A;  4G3W A;  3CUE C;  1N9O A;  3BQA A;  3NOP C;  1F98 A;  3EQU A;  5HPF A;  3FPV A;  5TBM B;  2M7V A;  1NWZ A;  3NOT C;  4WLA A;  5HDD A;  2GX5 A;  3EGD C;  1XFQ A;  5DF9 A;  4JGP A;  3T50 A;  3OLO A;  5DJU A;  4P6Z S;  1STZ A;  2VGL M;  4I3J A;  4HP9 A;  3MR0 A;  4GHI A;  1P9W A;  5J4E A;  3VOL A;  3CUE A;  3C38 A;  1ODV A;  4EER A;  2H28 A;  3EQV A;  2VKS A;  3PBO A;  2OWJ A;  1OTI A;  5KIZ A;  3DBA A;  2OWH A;  1GSX A;  3KYQ A;  4WEL A;  2PYP A;  2VZW A;  1MZU A;  4HP4 A;  2M1C A;  2HV1 A;  1S66 L;  3TJZ C;  5DKK A;  3PXP A;  1YAX A;  3A0S A;  3IS2 A;  1YKD A;  4R3A A;  2L4R A;  2QKP A;  2ZOI A;  1OJ5 A;  5DFX A;  4AFI A;  5DFY A;  4OOM A;  3ICY A;  4NXF A;  3KO6 A;  4II7 A;  3C2W A;  4LLO B;  2LB9 A;  2O9B A;  1G28 A;  3UME A;  1XJ6 A;  3OCL A;  3EGX C;  3UMD A;  4I39 A;  3IBJ A;  3LR3 A;  1F9I A;  3EWK A;  3CAX A;  4P6Z M;  4WN5 A;  3EEA A;  1S4R A;  3BY8 A;  5TBM A;  4FSF A;  1G6O A;  1UGU A;  3NJA A;  3C30 A;  3UB9 A;  1NLZ A;  2QWS A;  2W27 A;  3LI9 A;  2EWW A;  3S7N A;  2P04 A;  2W3E A;  2PD7 A;  1DP8 A;  3TW8 A;  5L8M A;  2WKR A;  4G3K A;  4BBT A;  5F69 A;  4UQI M;  5EFW A;  2PDR A;  3PBT A;  4Y3I A;  1D06 A;  3LUQ A;  3IBR A;  1DP9 A;  3PYP A;  4IJG A;  4ARZ A;  4JGQ A;  2JKT M;  2KOI A;  4GHI B;  3BW6 A;  4Y5F A;  5CX7 A;  3BQ8 A;  3EEH A;  3H7W A;  1EW0 A;  3R4K A;  4DJ3 A;  2G7U A;  4LPZ A;  2R78 A;  3U2A A;  3LR4 A;  4HNB A;  2VEA A;  1N9N A;  3JVU A;  3LFV A;  1XJ2 A;  1OTA A;  2KLI A;  3E98 A;  4HQA A;  4ETZ A;  4ETX A;  2CMN A;  1T19 A;  2K7S A;  2VJW A;  3PHY A;  4HH3 A;  4JGR A;  3IS2 B;  4EW7 A;  4Y2F A;  2B02 A;  4R38 A;  2HJ9 C;  4LRZ E;  3T4L A;  2O9A A;  4WEK A;  4M4X A;  5LBR A;  5FL3 A;  2W1T A;  1TS7 A;  4IUK A;  3LID A;  2JKR I;  4HH2 A;  4HHD A;  4GJ4 A;  4O01 A;  2GZA A;  2VV6 A;  3TRC A;  4IUH A;  2W3H A;  3T4O A;  1OT6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...