5KIZA

Solution structure of a repacked version of hif-2 alpha pas-b
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
114
structure length
114
Chain Sequence
GEFLDSKTFLSRFSMDMKFTYCDDRITELIGYHPEELLGRSASEFWHALDSENMTKSHQNLCTKGQVVSGQYRMLAKHGGYVWLETQMTVIYNPRNLQPQCIMAVNYVLSEIEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Endothelial PAS domain-containing protein 1
publication title Repacking of internal hydrated HIF-2 alpha cavity removes allosteric binding site
rcsb
source organism Homo sapiens
total genus 33
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2016-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5kizA00
3E4QA 1XJ3A 3LI9A 3NOTC 3LIFA 4LPZA 1Y28A 4PKYG 3EWKA 4MN6A 5F6AA 4HJ3A 4HI4A 2V1AA 4HQAA 4BBVA 1DP8A 4L9GA 1TS0A 3ULFA 4KUKA 1WA9A 2WKPA 4I39A 5F68A 5HWTA 3LIDA 3IS2A 3VE3A 3LIEA 1T1AA 2VV8A 5G4YA 1XJ6A 3SW1A 3K3CA 2Z6DA 5KIZA 1OT9A 4HHDA 3CLOA 3MR0A 4R6LA 3MQQA 1P97A 4M4XA 2PYPA 3UB9A 3UB6A 4NXGA 3A0SA 3FC7A 4NXEA 4GHIB 3MQOA 1EW0A 5DKLA 3CAXA 2WKQA 5DJTA 5HZHA 1D7EA 3VE4A 3ICYA 1TS8A 5J4EA 4BBTA 1LSXA 5HWVA 2YKHA 2ZOHA 2HV1A 1T1CA 1V9ZA 1S66L 1GSWA 4EETB 5I5LA 5EFWA 1OJGA 2GJ3A 5DKKA 4LRYC 1UWPX 1LT0A 2QKPA 5G4ZA 5IS1A 3T50A 2QHKA 3UMDA 1T19A 2P7JA 4GHIA 1UGUA 5HDDA 2V0UA 4EESA 4XT2B 3UMEA 1XFNA 1BYWA 5J7EA 2H28A 1OTAA 4LLOB 5HD3A 4I3JA 4JGRA 3MXQA 1T18A 4LRXC 1JNUA 4HOIA 4EERA 2W0NA 4F3LB 2A24B 1MZUA 2VV7A 4HP4A 4EQ1A 5HD5A 2QJ5A 1S1YA 1D06A 2QJ7A 3LI8A 4HY8A 4XT2A 2PR6A 4HH2A 2JN7A 5F69A 5AVFA 1V9YA 1XJ2A 4HH3A 3LUQA 4WF0A 4E04A 3BWLA 4HNBA 3F1OB 3E4PA 4EXOA 2V0WA 1OTEA 4R70A 3BY8A 3E4OA 1OJ5A 2PDRA 1OTIA 4GW9A 4I38A 3UE6A 2R78A 1OTBA 1S1ZA 3P7NA 1LL8A 1S4RA 3MJQA 2JHEA 4LRZE 1DRMA 4L9FA 3B33A 3A0RA 4HJ4A 3OLOA 4JGPA 2PR5A 2KDKA 1X0OA 4KUOA 3F1OA 5DJUA 3H7WB 4HJ6A 1VB6A 4HP9A 2VEAA 4EEPA 3C8CA 1TS6A 1P0ZA 1GSXA 3F1NB 3RTYA 3VOLA 2OWHA 4I3AA 1TS7A 5F5YA 1XFQA 2D01A 3NHQA 4I3IA 5J3WA 1LSWA 2PD8A 4WN5A 4EW7A 3CWFA 1NWZA 3PHYA 1S67L 2KX6A 3C2WA 2QWSA 3HJKA 3HJIA 4KQDA 2ZBBA 5HDSA 1ODVA 4HIAA 5IU1A 2CMNA 3IS2B 4GCZA 1N9OA 2EA9A 1OT6A 2V9AA 5AVEA 1T1BA 3KX0X 3NJAA 2PHYA 2W27A 4BBUA 3NOUC 2L4RA 2OOLA 1N9LA 3GECA 4WLAA 4H6JB 2VLGA 5HDCA 1DP9A 4WUJA 2PD7A 4F3LA 2A24A 3LICA 4I5SA 4WL9A 2ZOIA 3UB7A 2L1MA 3LYXA 4JGQA 4NXFA 3EEHA 2YKFA 1N9NA 2I9VA 2M1CA 1G28A 1LSVA 4GS9B 1OTDA 4L9EA 5A8BA 1DP6A 4H6JA 3MFXA 2PYRA 1UWNX 3BY9A 3ZQ5A 3H9WA 4NXBA 1XJ4A 4R3AA 1KOUA 3FG8A 2D02A 5HSQA 4DJ2A 4PKYA 3RH8B 3A0VA 3GDIA 5TBMB 3D72A 4B9OA 4R38A 2Z6CA 3H82B 3F1PB 3K3DA 3IBRA 4GS9A 3LIBA 2B02A 4DJ3A 4MN5A 2K7SA 1GSVA 4YWZA 2V1BA 4RQ9A 3G6OA 5HWWA 4JGOA 2WKRA 3H7WA 1S4SA 4K08A 3LIAA 2BASA 2INWA 2L0WA 2VV6A 3UB8A 3NOPC 3F1NA 2J80A 2OWJA 1F98A 4EEUA 5TBMA 3PYPA 1F9IA 3H82A 3F1PA
chains in the Genus database with same CATH superfamily
3CPTA 3E4QA 3ZNTA 3HVFA 3JVVA 5CHMA 2ACGA 1KE4A 4UQIS 2Y2HA 3AGDA 4PKYG 3OBFA 5CRFA 1W7FA 5F6AA 1P9WA 4HI4A 4OQIA 4BBVA 1DP8A 5E2GA 1JWZA 3VFHA 2HP9A 1XJ6A 5EV0A 2Z6DA 1SKOA 3FWLA 1K4EA 2ZQ9A 4YFMA 1I2SA 5FAQA 4S2OA 2IWCA 4S2IA 2G2UA 5FI7A 2PBYA 3VMAA 5L07A 3FC7A 1M40A 5M1AA 2K31A 1XGIA 1TEMA 3KYZA 1DJCA 2ZC7A 4GHIB 4R4SA 3MQOA 2HPBA 3VE4A 4BBTA 1LSXA 4DDYA 5HWVA 3HLBA 3WS4A 3DTMA 2YKHA 1K0KA 3V50A 3BFGA 3NECA 3DTIA 4KZ3A 2P9VB 1S66L 2EX9A 5I5LA 2JKRM 3UNWA 5FATA 1XKZA 2Y79A 3HREA 5DKKA 1MWUA 4LRYC 5BOHA 1FR6A 1YLZA 4OP5A 1ALQA 2HP6A 5HX9A 3W8KA 2NUTC 3TSGA 4EUVA 3UMDA 1T19A 4KZAA 1UGUA 5EVIA 3TJZC 5HDDA 3MMHA 4KZ5A 1E4DA 4OKPA 3UMEA 4GD6A 1BYWA 4MBHA 3UO9A 3C38A 2Y2LA 4IJGA 4WEJA 3QP6A 4JGRA 2WADA 5JYPA 3O87A 1T18A 2J9OA 1G5UA 2W0NA 2XH9A 2DNSA 3IBJA 2A24B 3T4OA 4DXBA 5JYOA 3UB5P 4E3JA 5TGFA 4CLCE 1PW1A 1FOFA 3LGOA 2XA7S 3VP4A 3OCNA 4EBLA 4N9LA 1PI4A 4ME4A 4NEED 1E3UD 3ZG8B 1PRQA 3E4PA 4R70A 3E4OA 4Y0UA 2PBDP 3PR6A 4NK3A 4OQHA 4MNRA 1JVJA 3W4OA 2PDRA 4PM9A 2R78A 3G4PA 2EXBA 2H0YA 1LI9A 2XGNA 2XLNA 4L9FA 3CI6A 3VOYA 3A0RA 4B4XA 3AGEA 2WK0A 4JGPA 2PR5A 1TF1A 5DJUA 3T1QB 5A92A 1WE4A 2CC1A 5F82A 4JLFA 4PAUA 1VB6A 5M19A 4X25A 2QMIA 4LV2A 1FCOA 1H8YA 1GSXA 3IX3A 3T12B 1TS7A 4OOMA 4O7DA 2O99A 4ZTKA 2HP5A 1IKIA 4CLCD 2XQZA 4JBFA 4RA7A 5L10A 4I3IA 2J8YA 5J3WA 4LENA 2WUQA 4PHTA 2I72A 1VEUA 4EW7A 4JPMA 4YINA 1IOUA 1NYYA 1S67L 2VKSA 2KX6A 3C2WA 3BQ8A 3IWIA 1A0KA 1YSQA 1G6OA 2ZLYA 2ZBBA 4OONA 4R1GA 1ODVA 2XRNA 4IHQA 3NDGA 5IU1A 1FIKA 3MS6A 3IQAA 3B42A 2Y2OA 1GA9A 3FKWA 2X01A 3WS0A 1N9OA 1BLHA 1WYCA 1K57C 2QYBA 1E3UA 2HDUA 4ARZB 3O5YA 2WKHA 3NJAA 2PHYA 2W27A 3NOUC 1YMSA 4WLAA 1YM1A 4A5RA 2Y2NA 1YLWA 3MKEA 2OV5A 2VLGA 3KSFA 4Y3IA 1YLYA 1DP9A 4UHUA 3DTEA 4ETXA 4WUJA 4E3OA 4OPQA 4KZ4A 2A24A 4I5SA 2W1TB 3HL9A 2WGWB 4QD4A 3GV9A 1O07A 3UB7A 3V39A 4PM6A 3EEHA 3LY4A 5DFYA 3P09A 2I9VA 1W5DA 4EBNA 1LSVA 4GS9B 2VGLS 5EECA 4GOGA 4H6JA 2PYRA 3Q1FA 3ZQ5A 3H9WA 2EX6A 4NXBA 4N9KA 1XJ4A 1AXBA 3PBSA 1KDSA 5E2FA 4CJNA 1CI8A 3V3SA 2NUPC 5HSQA 3G2YA 3SOIA 3KSGA 2IA2A 3A0VA 3E0YA 1H3QA 3VSKA 3H82B 4RVAA 4WMCD 3LIBA 4DJ3A 3CPTB 3G34A 2V1BA 3O86A 4P0MA 3IT9A 4LCMA 2JKGA 3FV7A 5FAPA 2OSUA 3S7OA 4HEFA 4K08A 3LIAA 3T4KA 3BW6A 5CECA 4K91A 1MWTA 1EI5A 3IXDA 3UB8A 3NOPC 4EU0A 1S6RA 5E43A 2OWJA 1J3WA 5TBMA 3FPWA 4S2NC 1ESIA 1H0MA 1YKDA 3RXWA 2AVXA 5FDHA 2Y91A 4ID4A 3DBAA 4ESPA 1BULA 1XJ3A 1SKOB 3IWQA 4GZBA 3TE8A 3IX8A 2W3FA 3EWKA 3DWKA 3IXBA 4MN6A 2J9PA 4O8GA 1KVMA 3RFBA 3CJMA 4WZ5C 4Y13A 4HQAA 2GX5A 3UDIA 5A93A 3ULFA 4KUKA 1VETB 1WA9A 3NBLA 2BTFP 5HWTA 3T4SA 3BLMA 1T1AA 1L0FA 3WS5A 5KIZA 5A91A 4UQIM 4KQOA 1P97A 3GTCA 5EM0A 1RP5A 4GLQA 3UB6A 1K54C 4NXGA 1L0DA 5FQIA 3IXGA 3D9YA 1YPRA 4E3NA 1NRFA 5HARA 3VOZA 5EVIB 2W1TA 1D7EA 3BFFA 3MXSA 1ERMA 5TR7A 2ZOHA 3PAEA 2W3HA 2XEPA 1V9ZA 4CLCC 4WMCA 2E8IA 1OJGA 4R3BA 2GJ3A 2Q0OA 2HDRA 1KDWA 3IXHA 3B47A 2IWDA 5HL1A 1ONGA 5EPHA 3M6BA 4EESA 4F94A 1CI9A 2X71A 1XFNA 2O9BA 4HBUA 2WGVA 2B5RA 2V8FA 3BFEA 5HD3A 1XP4A 2JKTM 3I7JA 4I3JA 4LV3A 3EGDC 3RXXA 3MXQA 2A2LA 2JC7A 3P98A 4C75A 4JXVA 2J3WA 1YT4A 3JYIA 1K4FA 2LB9A 4HP4A 4EQ1A 4K0WA 2ZMFA 3QNCA 1MBLA 5EVLA 3FKVA 3LI8A 1K6SA 2JN7A 1LHYA 3IF6C 3N8LA 2V8CA 2ZQ7A 1BLPA 4EXOA 4KQQA 2JKRI 1YMXA 1NYMA 3ZGAB 3BY8A 3HLGA 1OJ5A 4FD8A 3C7VA 4I38A 3NC8A 4N1XA 5CTMA 3UE6A 4R3JA 1OTBA 4N1HA 3BECA 1LL9A 1S4RA 2H10A 2WAFA 4U3TA 1ZKJA 1BLCA 3NI9A 3ZDJA 4DE3A 1TD5A 4LCLA 3UPNA 1IEMA 1RGZA 4IBXA 1M6KA 1VETA 3SS4A 4KUOA 1FCMA 3PBNA 4BENA 3T1SA 1KE3A 1VEUB 1L3LA 3S7PA 4Q0JA 2WGIA 3IWOA 4EEPA 4DKIA 1SZVA 4H8RA 3RTYA 1MY8A 1PW8A 2OWHA 3PTEA 4Q8IA 4QWOA 2WZZA 5EOEA 5KSCA 2FZ0A 3G31A 2IWBA 4MBKA 3A3FA 1XA7A 4PPRA 3NHQA 3PAGA 4WEKA 4WN5A 2JKFA 1C3BA 4OPRA 3MZDA 3MQ0A 5FQQA 4OLGA 1BUEA 1NWZA 3SS5A 3U4LP 5EOOA 2ZC3B 3CUEC 1BLSA 5CEBA 5E2HA 3Q7VA 2QWSA 3HJIA 3NY4A 4B88A 2ZC5B 4HIAA 3OPLA 3OCLA 4O01A 4DMZA 3MZFA 2EX2A 1XXMA 2V9AA 3OOVA 4R0QA 3IHAA 5HPIA 1K57A 3KX0X 4KG6A 4MLLA 2O9CA 5GHZA 5F1GA 5FA7A 4H6JB 4P6ZS 4ZJ1A 4PM7A 3EEAA 5DVAA 3D4FA 4E6WA 3S22A 5TFQA 3T4QA 4XXRA 3E2LA 1YSPA 1WYBA 2ZOIA 1ACFA 1CEFA 2L1MA 4NXFA 1BZAA 5CGXA 2ZM2A 1N9NA 4CLCB 1VHMA 4MMNA 1YLTA 2M1CA 1ONHA 5DTKA 5DF9A 1G28A 1Q2QA 4KG2A 4YNRA 1OTDA 4UA7A 2BLSA 4QJGA 3FPVA 2HDSA 3IH8A 3BFDA 3T1RA 4BL3A 5FSRA 1E25A 3QP8A 4R3AA 4BWIA 3PBTA 2DRWA 3FG8A 1FQGA 2D02A 4L0LA 4BD0A 4LV0A 4Q0HA 1ESUA 2C5WB 3HUMA 3RH8B 2JCHA 3TRCA 5TBMB 3D72A 4S2KA 2C6WB 1JWPA 3BEBA 4NKPA 2HZ5A 5GLAA 4BQMA 4Y0OA 1GHIA 2K7SA 2WZXA 3BM6A 5HWWA 3G6OA 4JGOA 4DXCA 5FEFA 1CEGA 3HBRA 3QP2A 4X1LA 2XFTA 2ZQDA 2XK1A 2BASA 3L9KA 1CJFA 4FH2A 2INWA 2PU4A 3T4TA 2VV6A 1I5QA 1FCNA 3LFVA 3CITA 4X69A 2J80A 3PYPA 3IF6B 5FQ9A 4LV1A 1F9IA 4AFIA 3W4QA 4S2NA 5CXWA 3OC2A 4NETA 3UY6A 4UA9A 4IUHA 2ZMVA 3LIFA 4LPZA 3DTKA 5F83A 1FR1A 4CQHA 1VM1A 5GLBA 2R9XA 5CHUA 3RJUA 4P87A 2V1AA 1ES4A 4WZ5A 3VSLA 3IF5A 1TS0A 4UA6A 3S7NA 4MDZA 3JVUA 3OZHA 4X53A 5G4YA 4DF6A 3SW1A 3K3CA 3Q81A 2WKIA 1RGYA 4B4ZA 5L8MA 4HHDA 5FDSA 3CLOA 3MR0A 4R6LA 3WRTA 2M7UA 5L2FA 4M4XA 2PYPA 3Q07A 5FQMA 4GNUA 4U0XA 1L0GA 2EXAA 1K54A 4XUXA 5J8XA 3UE1A 5M18A 3N4IA 4NXEA 3SZTA 2XSSA 4FTXA 2X02A 4E3KA 3A3EA 1EW0A 3HLEA 2K2NA 2WKQA 1NLYA 5DJTA 1TS8A 3SH7A 5J4EA 4S2MA 5E2EA 1W63Q 2W3GA 2HV1A 1T1CA 3T4JA 4EETB 4CLCA 1K38A 3T1XA 3V3RA 2EFUA 3E98A 4D60A 4QHCA 4RYEA 1W79A 4ZDXA 2OLVA 2Z2MB 4WBGA 1N4OA 1LT0A 3CHWP 2QKPA 5IS1A 3T50A 2QHKA 3G35A 1LLBA 3ITBA 3S4XA 1J9MA 1RCJA 4X68A 4EQIA 3GVBA 5HFOA 1NZUA 1SKFA 5J7EA 2VGJA 1OTAA 4IEDA 4LLOB 4EUZA 3D3OA 2B18A 2J7VA 3ZG7B 1KVLA 1JWVA 3ZG9B 3FZCA 4BLMA 1JNUA 4HOIA 1MWRA 4EERA 3UDXA 2ZD8A 3EQVA 3O3VA 1U60A 4F3LB 5CGSA 5CEDA 1LL5A 5FQJA 3VV4A 5DTTA 1S1YA 2QJ7A 4CPKA 4XT2A 1ES2A 2ZL1A 5CGWA 5F69A 5AVFA 1NY0A 3L7HA 3IF6A 1OMEA 2Y59A 3WRZA 4X6TA 3WS2A 1PFLA 3BWLA 3CZDA 4HNBA 4E04A 2V0WA 2B95A 5GLDA 3CMZA 1L0EA 3QP4A 1K55C 1FSYA 3C5AA 2GDNA 2Y55A 3BJNA 1K6RA 3QP5A 2O9AA 2EWVA 2RL3A 1YLPA 2Y2QA 1LL8A 3MJQA 2JHEA 4GDBA 1DRMA 4MEZA 2OLUA 4JF5A 2VA0A 3B33A 4DE2A 1DY6A 4HJ4A 3OPPA 3VP0A 3MF0A 2KDKA 2JKTI 3F1OA 4G3WA 5HAPA 3PBQA 3MKFA 3ISGA 4G3VA 4KQRA 3H7WB 5F1FA 4DE0A 3WS1A 2XF3A 2ZM8A 4HP9A 1QMEA 4PM8A 4KZ9A 4DN0A 1TS6A 3HUOA 3O88A 3Q7VB 3EOIA 4I3AA 4C3QA 5AQ7A 5F5YA 1BT5A 4U0TA 3M6HA 5D3OA 3HLWA 2EFXA 2PT7A 3A3JA 1EROA 1G68A 3DW0A 4S2JA 5C5KA 2XROA 1YQSA 2XD5A 1CF0A 2XFSA 3E2KA 4JKTA 2FH5A 4B93A 1XGJA 2WKEA 1W63M 4E3IA 1SCWA 4BMWA 3CUEA 4QY5A 3WWXA 4KQDA 4KENB 4JXGA 4KZBA 2Y8HA 5EE8A 5HDSA 3ITAA 3LEZA 2CMNA 1N9BA 1MPLA 1MKMA 3IS2B 1ES5A 4QY6A 4R23A 2EA9A 1OT6A 3ZG0A 5DTSA 3ZFZA 1HLUP 2WYXA 3N8RA 3BYDA 2Y2GA 3G2ZA 2OOLA 1N9LA 2A3UA 3GECA 1KGEA 1PI5A 2ZM0A 2Y2MA 2W3DA 5HDCA 2ZQCA 3M2KA 3R4KA 4QPRA 2PD7A 3NDEA 4Y5FA 3S1YA 3KYQA 4OQ0A 5FI2A 3A3IA 4F3LA 1S0WA 3LICA 4C6YA 3GSGA 4ZAMA 4JGQA 3LYXA 3KSIA 1XX2A 2YKFA 1VQQA 1BTLA 2XA7M 3AGFA 3MSHA 3C7UA 4X56A 1IYSA 1DJAA 2WAEA 2HGVA 3UE3A 3SS3A 4QU3A 1F5MA 1UWNX 4P6ZM 1BSGA 5IHVA 3C4PA 1F2KA 1HVBA 2ZQAA 4HESA 3HLCA 3N8SA 3UPOA 1IYQA 2W3EA 3A3DA 3N7WA 4OLDA 4DJ2A 1MWSA 4PKYA 1Y4OA 2HJ9C 3NULA 4B9OA 2Z6CA 1ES3A 3IBRA 1PZPA 1ZG6A 4MN5A 2Y4AA 3T4LA 1SDNA 3V67A 4YWZA 1GHPA 4RQ9A 3G30A 5HL6A 4UEYA 2V20A 3H7WA 4XUZA 3PBRA 2PRFA 4PMAA 5EM1A 3LY3A 4D2OA 2ZC6B 2OAP1 5HPFA 2UV0E 3R7WB 5FASA 3K2NA 3QNBA 4WYYA 3GR2A 3LO7A 3TOIA 1F98A 4GN2A 4Y7PA 1KGGA 3Q82A 2XR0A 1W8YA 1ZC2A 3F1PA 4EBPA 5AQBA 4UAAA 5GHXA 2ZJ9A 1ZTUA 2KLIA 3LI9A 3NOTC 5G18A 1FSWA 4ZJ2A 5FEGA 1Y28A 5K5BA 4WZ4A 2J3TC 4HJ3A 2HJEA 3LCEA 5CERA 1CQAA 1OPXA 3UE0A 2PAVP 1Y54A 5CTNA 1K25A 4MN7A 3BQAA 4L9GA 2WKPA 4I39A 4WM9A 4Y17A 5F68A 3LIDA 3IS2A 3VE3A 1PWGA 2G7UA 2XD1A 3LIEA 2VV8A 5TJJA 2VJWA 4LFUA 4MCWA 3DWZA 1Q2PA 3LR3A 3LR5A 1OT9A 1W8QA 4JXSA 2Q9NA 3V5MA 3ZNYA 3MQQA 2G2WA 4Q0IA 4ZRRA 4KZ8A 1NRJA 4OPZA 3UB9A 2LB5A 1H5XA 3NCKA 4IBRA 4P6BA 5EVEA 3A0SA 2JBFA 4DE1A 4GD8A 3IH9A 2VGKA 4OP8A 5DKLA 3CAXA 5HZHA 3QP1A 3ICYA 4LGWA 4K0XA 4OVDA 2HF6A 3GQZA 3M2JA 3ZVTA 5HAIA 1GSWA 3SH8A 4E3MA 3GMWA 5EFWA 2HDQA 2VZWA 3PBOA 2H5SA 1KE0A 4EWFA 2Y2IA 3ZCZA 5GLCA 3VP3A 4DDSA 2VGLM 3NIAA 1UWPX 1STZA 3BLSA 1IELA 5GHYA 5G4ZA 5DFXA 3LR0A 1Z6FA 3LEQA 2P7JA 4GHIA 2VX8A 5EVIC 3IHBA 4S2LA 2V0UA 4FSFA 3MZEA 4XT2B 1JTDA 2ZL1B 3QHYA 2H28A 1SHVA 2P9VA 2Z2LB 4PM5A 3B3XA 4KZ7A 2OAQ1 4G3KA 2PU2A 3KO6A 5FQKA 1PWDA 4LRXC 5FI6A 1D1JA 3JPUA 2JE5A 3GRJA 1G6AA 5AJGA 1MZUA 2VV7A 3TG9A 3W2ZA 5HD5A 5AQ9A 2QJ5A 1PZOA 3R7WA 1MKIA 1D06A 1GHMA 3P01A 4HY8A 2PR6A 3IX4A 4HH2A 5GL9A 1PIOA 1V9YA 3ZVWA 1XJ2A 3BRMA 4II7A 4HH3A 1P9RA 1MC0A 2EX8A 3LUQA 4WF0A 1ERQA 3N6IA 4OOYA 3F1OB 3G32A 1OTEA 3ZG5A 1XA1A 4N92A 1K55A 3HCYA 2GNXA 1OTIA 4GW9A 1YLJA 4R4RA 1I2WA 1S1ZA 2ZMAA 3P7NA 2P08A 4LRZE 4S2PA 4HBTA 4YOFA 1TDGA 4QB8A 1HZOA 1IYPA 3OLOA 1KGFA 5CX7A 1JTGA 4BJPA 1QMFA 3FYZA 2W1RA 4OQGA 1X0OA 4GKUA 4KG5A 4BD1A 1H8MA 5KZHA 4HJ6A 4WELA 1XPBA 2R9WA 4RX2A 2Y2JA 2VEAA 3HLDA 1FILA 3C8CA 5U47A 1P0ZA 1TVFA 5KMWA 3F1NB 3VOLA 2GZAA 5DF8A 4X1MA 5L09A 1XFQA 1DJBA 4IUKA 2E8JA 2O0YA 3MXRA 2D01A 1AWIA 2QZ6A 3DAVA 3ZHHA 3EGXC 2VK3A 5FL3A 5KSHA 1LSWA 2DMWA 3KSHA 2UWXA 2PD8A 4Y2FA 3VP1A 4GDNA 3ZYTA 1HTZA 3CWFA 2Y2PA 3HLFA 4OPYA 3LR4A 4FH4A 4ETZA 3PHYA 4RX3A 4MBFA 1LI0A 3W4PA 1YAXA 1K56D 3HJKA 4GJ4A 1NLZA 4E6XA 1PWCA 4Z9QA 2P74A 2V2FF 4IVIA 1ZG4A 2KOIA 2A49A 3HUNA 4X55A 2ZQ8A 2EWWA 3PXPA 4GCZA 3MBZA 5MC7A 5AVEA 1T1BA 3KYEA 4BBUA 2XDMA 2FFYA 2L4RA 1IKGA 5HAQA 4Y0TA 1PNEA 4FCFA 4P85A 4NG2A 5DF7A 2J3TD 2V1ZA 3SH9A 2Y2KA 3C4OA 4JF4A 4EV4A 3C30A 3UDFA 4DRTA 4WL9A 4KZ6A 3S7QA 2M7VA 1GCEA 5IT5A 4ARZA 3CG5A 2DCFA 1IYOA 4FOFA 4L9EA 5A8BA 4Z1WA 3Q7ZA 4JXWA 4JF6A 1DP6A 3U2AA 3MFXA 5FAOA 1PYYA 2ZC4B 2P04A 3BY9A 1ZHHB 1MXOA 3VFFA 3UN7A 1IFQA 1HD8A 2MJ6A 2RCXA 5A90A 1KOUA 4FUWA 1Z09A 5AQAA 3EQUA 2WGWA 5HW3A 3BFCA 3UPPA 4M3KA 5EUAA 3GDIA 5LBRA 4R38A 3F1PB 2BG1A 3K3DA 4GS9A 1H8ZA 2B02A 1TDLA 4O0PA 5I94A 1GSVA 3TW8A 4GB7A 2QPNA 2WKRA 1S4SA 4OH0A 1L2SA 3VP2A 1SDEA 1EWZA 4ZBEA 1K56A 5CHJA 2L0WA 4ZJ3A 5EVID 3OPRA 2H0TA 3F1NA 1CK3A 3MFDA 4IVKA 2Q9MA 4EEUA 1NZOA 4Y15A 1O7EA 2FFFB 3OPHA 3H82A 4OOLA 1NXYA 1NJ4A 4BL2A 4E3LA 1GA0A
chains in the Genus database with same CATH topology
3DBAA 3E4QA 3JVVA 1ZTUA 1XJ3A 2KLIA 3LI9A 3NOTC 4UQIS 4IUHA 2ZMVA 3LIFA 4LPZA 1Y28A 3TE8A 4PKYG 4CQHA 2W3FA 5K5BA 3OBFA 3EWKA 4MN6A 2J3TC 4O8GA 5F6AA 4HJ3A 2HJEA 1OPXA 1P9WA 4HI4A 3RFBA 2V1AA 4HQAA 4BBVA 4MN7A 1DP8A 2GX5A 3BQAA 4L9GA 1TS0A 3ULFA 4KUKA 1WA9A 2WKPA 4I39A 5F68A 5HWTA 3LIDA 3IS2A 3T4SA 3VE3A 3S7NA 2G7UA 4MDZA 3LIEA 1T1AA 2VV8A 3JVUA 5TJJA 2VJWA 5G4YA 1XJ6A 3SW1A 3K3CA 4MCWA 2Z6DA 3LR3A 5KIZA 5L8MA 3LR5A 1OT9A 4HHDA 3CLOA 3MR0A 4R6LA 2M7UA 3MQQA 4UQIM 4KQOA 1P97A 4Q0IA 4M4XA 2PYPA 4ZRRA 1NRJA 3UB9A 4GLQA 3UB6A 4NXGA 2LB5A 3A0SA 3FC7A 2K31A 4NXEA 3KYZA 2XSSA 4GHIB 3MQOA 1EW0A 5DKLA 2K2NA 3CAXA 2WKQA 1NLYA 5DJTA 5HZHA 2W1TA 1D7EA 3VE4A 3ICYA 1TS8A 5J4EA 4BBTA 1LSXA 5HWVA 2YKHA 2ZOHA 2HF6A 2W3HA 1W63Q 2W3GA 2HV1A 1T1CA 3T4JA 1V9ZA 1S66L 4CLCC 1GSWA 4CLCA 4EETB 5I5LA 5EFWA 2VZWA 2JKRM 3PBOA 3E98A 2Y79A 1OJGA 2GJ3A 5DKKA 2VGLM 3B47A 4LRYC 1UWPX 1STZA 1LT0A 2QKPA 5G4ZA 5IS1A 2NUTC 5DFXA 3T50A 3LR0A 4EUVA 2QHKA 3UMDA 1T19A 2P7JA 4GHIA 1UGUA 2VX8A 3TJZC 5HDDA 2V0UA 3MMHA 4FSFA 4EESA 4XT2B 3UMEA 1XFNA 1BYWA 2O9BA 3C38A 5J7EA 2H28A 1OTAA 4LLOB 4IJGA 3D3OA 2B18A 2OAQ1 4G3KA 4WEJA 2JKTM 5HD3A 4I3JA 4JGRA 3EGDC 3KO6A 3MXQA 2A2LA 1T18A 4LRXC 1JNUA 2J3WA 4HOIA 4EERA 2W0NA 3EQVA 3IBJA 5AJGA 4F3LB 2A24B 1MZUA 2LB9A 2VV7A 4HP4A 3T4OA 3W2ZA 4EQ1A 5HD5A 2ZMFA 2QJ5A 3VV4A 3R7WA 1S1YA 4CLCE 1D06A 2QJ7A 3LI8A 3P01A 4HY8A 4XT2A 2PR6A 4HH2A 2JN7A 5F69A 2XA7S 5AVFA 3OCNA 1V9YA 4ME4A 4NEED 1XJ2A 4II7A 4HH3A 1P9RA 1MC0A 3LUQA 4WF0A 4E04A 3BWLA 4HNBA 3F1OB 3E4PA 4EXOA 2V0WA 2JKRI 1OTEA 4R70A 3BY8A 3E4OA 1OJ5A 3HCYA 3PR6A 2PDRA 2GNXA 3BJNA 1OTIA 4GW9A 4I38A 3UE6A 2R78A 2O9AA 2EWVA 1OTBA 1S1ZA 3P7NA 2P08A 1LL8A 1S4RA 3MJQA 2JHEA 4LRZE 1DRMA 4YOFA 4L9FA 2VA0A 3B33A 3CI6A 3A0RA 1TD5A 4HJ4A 3OLOA 4JGPA 2PR5A 5CX7A 4BJPA 2W1RA 1TF1A 3MF0A 2KDKA 1X0OA 4KUOA 3F1OA 2JKTI 3PBNA 4G3WA 5DJUA 3PBQA 4G3VA 3H7WB 1H8MA 4PAUA 4HJ6A 1VB6A 4WELA 3S7PA 4HP9A 4Q0JA 2VEAA 4EEPA 3C8CA 4DN0A 1TS6A 1P0ZA 1GSXA 3EOIA 3F1NB 3RTYA 2GZAA 3VOLA 2OWHA 4I3AA 1TS7A 4OOMA 5F5YA 1XFQA 4IUKA 2O99A 2PT7A 2O0YA 2FZ0A 2D01A 4CLCD 5C5KA 2XROA 3NHQA 4I3IA 5J3WA 3EGXC 4WEKA 5FL3A 5KSHA 1LSWA 2DMWA 2FH5A 3KSHA 4PHTA 4B93A 2PD8A 4WN5A 4Y2FA 4EW7A 3ZYTA 1IOUA 1W63M 3MQ0A 3CWFA 1NWZA 3LR4A 4ETZA 4BMWA 3PHYA 1S67L 3CUEC 2VKSA 2KX6A 3CUEA 3C2WA 1YAXA 3BQ8A 2QWSA 3HJKA 4GJ4A 3HJIA 1YSQA 1G6OA 1NLZA 4KQDA 2ZBBA 2Y8HA 5HDSA 1ODVA 2XRNA 4HIAA 4IHQA 5IU1A 2CMNA 3OCLA 4O01A 1MKMA 3IS2B 3B42A 2KOIA 4DMZA 2EWWA 3PXPA 4GCZA 1N9OA 2EA9A 1OT6A 5MC7A 2V9AA 3OOVA 2QYBA 5HPIA 4ARZB 5AVEA 3O5YA 1T1BA 3KX0X 3NJAA 2O9CA 2PHYA 2W27A 4BBUA 3NOUC 2L4RA 2OOLA 1N9LA 3GECA 4WLAA 4H6JB 4P6ZS 2VLGA 2W3DA 3KSFA 4Y3IA 5HDCA 2J3TD 1DP9A 3EEAA 4ETXA 3R4KA 4QPRA 2PD7A 4WUJA 4Y5FA 3KYQA 3T4QA 4F3LA 3C30A 2A24A 3LICA 1YSPA 4I5SA 2W1TB 4WL9A 2ZOIA 3UB7A 3S7QA 2L1MA 3LYXA 4JGQA 3KSIA 4NXFA 3EEHA 2YKFA 2M7VA 1N9NA 5DFYA 4CLCB 1VHMA 4MMNA 5IT5A 2I9VA 2M1CA 4ARZA 2XA7M 5DF9A 1G28A 1LSVA 4GS9B 4YNRA 1OTDA 2VGLS 4FOFA 4L9EA 5A8BA 4Z1WA 3FPVA 2HGVA 3U2AA 1DP6A 4H6JA 3MFXA 3UE3A 1F5MA 2PYRA 1UWNX 2P04A 3BY9A 4P6ZM 1ZHHB 3ZQ5A 3H9WA 4NXBA 1IFQA 1XJ4A 4R3AA 4BWIA 2MJ6A 3PBSA 3PBTA 1KOUA 3FG8A 2D02A 3EQUA 4L0LA 2NUPC 4Q0HA 5HSQA 2W3EA 4DJ2A 3KSGA 4PKYA 3RH8B 2IA2A 3A0VA 3GDIA 3TRCA 5TBMB 3D72A 3E0YA 2HJ9C 1H3QA 4B9OA 5LBRA 4R38A 2Z6CA 3H82B 3F1PB 4NKPA 3K3DA 3IBRA 4GS9A 3LIBA 2B02A 4DJ3A 4MN5A 3T4LA 4O0PA 3V67A 2K7SA 1GSVA 4YWZA 2V1BA 3TW8A 4RQ9A 3G6OA 5HWWA 4JGOA 5HL6A 4UEYA 2WKRA 3H7WA 3S7OA 1S4SA 4K08A 3LIAA 2BASA 3PBRA 2INWA 3T4KA 3BW6A 2OAP1 5HPFA 3T4TA 2L0WA 3R7WB 2VV6A 3UB8A 3LFVA 3K2NA 3CITA 3NOPC 4EU0A 3F1NA 2J80A 2OWJA 1F98A 4EEUA 5TBMA 3PYPA 3FPWA 1F9IA 3H82A 4AFIA 3F1PA 1YKDA 4OOLA 3OC2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E4Q A;  1XJ3 A;  3LI9 A;  3NOT C;  3LIF A;  4LPZ A;  1Y28 A;  4PKY G;  3EWK A;  4MN6 A;  5F6A A;  4HJ3 A;  4HI4 A;  2V1A A;  4HQA A;  4BBV A;  1DP8 A;  4L9G A;  1TS0 A;  3ULF A;  4KUK A;  1WA9 A;  2WKP A;  4I39 A;  5F68 A;  5HWT A;  3LID A;  3IS2 A;  3VE3 A;  3LIE A;  1T1A A;  2VV8 A;  5G4Y A;  1XJ6 A;  3SW1 A;  3K3C A;  2Z6D A;  5KIZ A;  1OT9 A;  4HHD A;  3CLO A;  3MR0 A;  4R6L A;  3MQQ A;  1P97 A;  4M4X A;  2PYP A;  3UB9 A;  3UB6 A;  4NXG A;  3A0S A;  3FC7 A;  4NXE A;  4GHI B;  3MQO A;  1EW0 A;  5DKL A;  3CAX A;  2WKQ A;  5DJT A;  5HZH A;  1D7E A;  3VE4 A;  3ICY A;  1TS8 A;  5J4E A;  4BBT A;  1LSX A;  5HWV A;  2YKH A;  2ZOH A;  2HV1 A;  1T1C A;  1V9Z A;  1S66 L;  1GSW A;  4EET B;  5I5L A;  5EFW A;  1OJG A;  2GJ3 A;  5DKK A;  4LRY C;  1UWP X;  1LT0 A;  2QKP A;  5G4Z A;  5IS1 A;  3T50 A;  2QHK A;  3UMD A;  1T19 A;  2P7J A;  4GHI A;  1UGU A;  5HDD A;  2V0U A;  4EES A;  4XT2 B;  3UME A;  1XFN A;  1BYW A;  5J7E A;  2H28 A;  1OTA A;  4LLO B;  5HD3 A;  4I3J A;  4JGR A;  3MXQ A;  1T18 A;  4LRX C;  1JNU A;  4HOI A;  4EER A;  2W0N A;  4F3L B;  2A24 B;  1MZU A;  2VV7 A;  4HP4 A;  4EQ1 A;  5HD5 A;  2QJ5 A;  1S1Y A;  1D06 A;  2QJ7 A;  3LI8 A;  4HY8 A;  4XT2 A;  2PR6 A;  4HH2 A;  2JN7 A;  5F69 A;  5AVF A;  1V9Y A;  1XJ2 A;  4HH3 A;  3LUQ A;  4WF0 A;  4E04 A;  3BWL A;  4HNB A;  3F1O B;  3E4P A;  4EXO A;  2V0W A;  1OTE A;  4R70 A;  3BY8 A;  3E4O A;  1OJ5 A;  2PDR A;  1OTI A;  4GW9 A;  4I38 A;  3UE6 A;  2R78 A;  1OTB A;  1S1Z A;  3P7N A;  1LL8 A;  1S4R A;  3MJQ A;  2JHE A;  4LRZ E;  1DRM A;  4L9F A;  3B33 A;  3A0R A;  4HJ4 A;  3OLO A;  4JGP A;  2PR5 A;  2KDK A;  1X0O A;  4KUO A;  3F1O A;  5DJU A;  3H7W B;  4HJ6 A;  1VB6 A;  4HP9 A;  2VEA A;  4EEP A;  3C8C A;  1TS6 A;  1P0Z A;  1GSX A;  3F1N B;  3RTY A;  3VOL A;  2OWH A;  4I3A A;  1TS7 A;  5F5Y A;  1XFQ A;  2D01 A;  3NHQ A;  4I3I A;  5J3W A;  1LSW A;  2PD8 A;  4WN5 A;  4EW7 A;  3CWF A;  1NWZ A;  3PHY A;  1S67 L;  2KX6 A;  3C2W A;  2QWS A;  3HJK A;  3HJI A;  4KQD A;  2ZBB A;  5HDS A;  1ODV A;  4HIA A;  5IU1 A;  2CMN A;  3IS2 B;  4GCZ A;  1N9O A;  2EA9 A;  1OT6 A;  2V9A A;  5AVE A;  1T1B A;  3KX0 X;  3NJA A;  2PHY A;  2W27 A;  4BBU A;  3NOU C;  2L4R A;  2OOL A;  1N9L A;  3GEC A;  4WLA A;  4H6J B;  2VLG A;  5HDC A;  1DP9 A;  4WUJ A;  2PD7 A;  4F3L A;  2A24 A;  3LIC A;  4I5S A;  4WL9 A;  2ZOI A;  3UB7 A;  2L1M A;  3LYX A;  4JGQ A;  4NXF A;  3EEH A;  2YKF A;  1N9N A;  2I9V A;  2M1C A;  1G28 A;  1LSV A;  4GS9 B;  1OTD A;  4L9E A;  5A8B A;  1DP6 A;  4H6J A;  3MFX A;  2PYR A;  1UWN X;  3BY9 A;  3ZQ5 A;  3H9W A;  4NXB A;  1XJ4 A;  4R3A A;  1KOU A;  3FG8 A;  2D02 A;  5HSQ A;  4DJ2 A;  4PKY A;  3RH8 B;  3A0V A;  3GDI A;  5TBM B;  3D72 A;  4B9O A;  4R38 A;  2Z6C A;  3H82 B;  3F1P B;  3K3D A;  3IBR A;  4GS9 A;  3LIB A;  2B02 A;  4DJ3 A;  4MN5 A;  2K7S A;  1GSV A;  4YWZ A;  2V1B A;  4RQ9 A;  3G6O A;  5HWW A;  4JGO A;  2WKR A;  3H7W A;  1S4S A;  4K08 A;  3LIA A;  2BAS A;  2INW A;  2L0W A;  2VV6 A;  3UB8 A;  3NOP C;  3F1N A;  2J80 A;  2OWJ A;  1F98 A;  4EEU A;  5TBM A;  3PYP A;  1F9I A;  3H82 A;  3F1P A; 
#chains in the Genus database with same CATH topology
 3CPT A;  3E4Q A;  3ZNT A;  3HVF A;  3JVV A;  5CHM A;  2ACG A;  1KE4 A;  4UQI S;  2Y2H A;  3AGD A;  4PKY G;  3OBF A;  5CRF A;  1W7F A;  5F6A A;  1P9W A;  4HI4 A;  4OQI A;  4BBV A;  1DP8 A;  5E2G A;  1JWZ A;  3VFH A;  2HP9 A;  1XJ6 A;  5EV0 A;  2Z6D A;  1SKO A;  3FWL A;  1K4E A;  2ZQ9 A;  4YFM A;  1I2S A;  5FAQ A;  4S2O A;  2IWC A;  4S2I A;  2G2U A;  5FI7 A;  2PBY A;  3VMA A;  5L07 A;  3FC7 A;  1M40 A;  5M1A A;  2K31 A;  1XGI A;  1TEM A;  3KYZ A;  1DJC A;  2ZC7 A;  4GHI B;  4R4S A;  3MQO A;  2HPB A;  3VE4 A;  4BBT A;  1LSX A;  4DDY A;  5HWV A;  3HLB A;  3WS4 A;  3DTM A;  2YKH A;  1K0K A;  3V50 A;  3BFG A;  3NEC A;  3DTI A;  4KZ3 A;  2P9V B;  1S66 L;  2EX9 A;  5I5L A;  2JKR M;  3UNW A;  5FAT A;  1XKZ A;  2Y79 A;  3HRE A;  5DKK A;  1MWU A;  4LRY C;  5BOH A;  1FR6 A;  1YLZ A;  4OP5 A;  1ALQ A;  2HP6 A;  5HX9 A;  3W8K A;  2NUT C;  3TSG A;  4EUV A;  3UMD A;  1T19 A;  4KZA A;  1UGU A;  5EVI A;  3TJZ C;  5HDD A;  3MMH A;  4KZ5 A;  1E4D A;  4OKP A;  3UME A;  4GD6 A;  1BYW A;  4MBH A;  3UO9 A;  3C38 A;  2Y2L A;  4IJG A;  4WEJ A;  3QP6 A;  4JGR A;  2WAD A;  5JYP A;  3O87 A;  1T18 A;  2J9O A;  1G5U A;  2W0N A;  2XH9 A;  2DNS A;  3IBJ A;  2A24 B;  3T4O A;  4DXB A;  5JYO A;  3UB5 P;  4E3J A;  5TGF A;  4CLC E;  1PW1 A;  1FOF A;  3LGO A;  2XA7 S;  3VP4 A;  3OCN A;  4EBL A;  4N9L A;  1PI4 A;  4ME4 A;  4NEE D;  1E3U D;  3ZG8 B;  1PRQ A;  3E4P A;  4R70 A;  3E4O A;  4Y0U A;  2PBD P;  3PR6 A;  4NK3 A;  4OQH A;  4MNR A;  1JVJ A;  3W4O A;  2PDR A;  4PM9 A;  2R78 A;  3G4P A;  2EXB A;  2H0Y A;  1LI9 A;  2XGN A;  2XLN A;  4L9F A;  3CI6 A;  3VOY A;  3A0R A;  4B4X A;  3AGE A;  2WK0 A;  4JGP A;  2PR5 A;  1TF1 A;  5DJU A;  3T1Q B;  5A92 A;  1WE4 A;  2CC1 A;  5F82 A;  4JLF A;  4PAU A;  1VB6 A;  5M19 A;  4X25 A;  2QMI A;  4LV2 A;  1FCO A;  1H8Y A;  1GSX A;  3IX3 A;  3T12 B;  1TS7 A;  4OOM A;  4O7D A;  2O99 A;  4ZTK A;  2HP5 A;  1IKI A;  4CLC D;  2XQZ A;  4JBF A;  4RA7 A;  5L10 A;  4I3I A;  2J8Y A;  5J3W A;  4LEN A;  2WUQ A;  4PHT A;  2I72 A;  1VEU A;  4EW7 A;  4JPM A;  4YIN A;  1IOU A;  1NYY A;  1S67 L;  2VKS A;  2KX6 A;  3C2W A;  3BQ8 A;  3IWI A;  1A0K A;  1YSQ A;  1G6O A;  2ZLY A;  2ZBB A;  4OON A;  4R1G A;  1ODV A;  2XRN A;  4IHQ A;  3NDG A;  5IU1 A;  1FIK A;  3MS6 A;  3IQA A;  3B42 A;  2Y2O A;  1GA9 A;  3FKW A;  2X01 A;  3WS0 A;  1N9O A;  1BLH A;  1WYC A;  1K57 C;  2QYB A;  1E3U A;  2HDU A;  4ARZ B;  3O5Y A;  2WKH A;  3NJA A;  2PHY A;  2W27 A;  3NOU C;  1YMS A;  4WLA A;  1YM1 A;  4A5R A;  2Y2N A;  1YLW A;  3MKE A;  2OV5 A;  2VLG A;  3KSF A;  4Y3I A;  1YLY A;  1DP9 A;  4UHU A;  3DTE A;  4ETX A;  4WUJ A;  4E3O A;  4OPQ A;  4KZ4 A;  2A24 A;  4I5S A;  2W1T B;  3HL9 A;  2WGW B;  4QD4 A;  3GV9 A;  1O07 A;  3UB7 A;  3V39 A;  4PM6 A;  3EEH A;  3LY4 A;  5DFY A;  3P09 A;  2I9V A;  1W5D A;  4EBN A;  1LSV A;  4GS9 B;  2VGL S;  5EEC A;  4GOG A;  4H6J A;  2PYR A;  3Q1F A;  3ZQ5 A;  3H9W A;  2EX6 A;  4NXB A;  4N9K A;  1XJ4 A;  1AXB A;  3PBS A;  1KDS A;  5E2F A;  4CJN A;  1CI8 A;  3V3S A;  2NUP C;  5HSQ A;  3G2Y A;  3SOI A;  3KSG A;  2IA2 A;  3A0V A;  3E0Y A;  1H3Q A;  3VSK A;  3H82 B;  4RVA A;  4WMC D;  3LIB A;  4DJ3 A;  3CPT B;  3G34 A;  2V1B A;  3O86 A;  4P0M A;  3IT9 A;  4LCM A;  2JKG A;  3FV7 A;  5FAP A;  2OSU A;  3S7O A;  4HEF A;  4K08 A;  3LIA A;  3T4K A;  3BW6 A;  5CEC A;  4K91 A;  1MWT A;  1EI5 A;  3IXD A;  3UB8 A;  3NOP C;  4EU0 A;  1S6R A;  5E43 A;  2OWJ A;  1J3W A;  5TBM A;  3FPW A;  4S2N C;  1ESI A;  1H0M A;  1YKD A;  3RXW A;  2AVX A;  5FDH A;  2Y91 A;  4ID4 A;  3DBA A;  4ESP A;  1BUL A;  1XJ3 A;  1SKO B;  3IWQ A;  4GZB A;  3TE8 A;  3IX8 A;  2W3F A;  3EWK A;  3DWK A;  3IXB A;  4MN6 A;  2J9P A;  4O8G A;  1KVM A;  3RFB A;  3CJM A;  4WZ5 C;  4Y13 A;  4HQA A;  2GX5 A;  3UDI A;  5A93 A;  3ULF A;  4KUK A;  1VET B;  1WA9 A;  3NBL A;  2BTF P;  5HWT A;  3T4S A;  3BLM A;  1T1A A;  1L0F A;  3WS5 A;  5KIZ A;  5A91 A;  4UQI M;  4KQO A;  1P97 A;  3GTC A;  5EM0 A;  1RP5 A;  4GLQ A;  3UB6 A;  1K54 C;  4NXG A;  1L0D A;  5FQI A;  3IXG A;  3D9Y A;  1YPR A;  4E3N A;  1NRF A;  5HAR A;  3VOZ A;  5EVI B;  2W1T A;  1D7E A;  3BFF A;  3MXS A;  1ERM A;  5TR7 A;  2ZOH A;  3PAE A;  2W3H A;  2XEP A;  1V9Z A;  4CLC C;  4WMC A;  2E8I A;  1OJG A;  4R3B A;  2GJ3 A;  2Q0O A;  2HDR A;  1KDW A;  3IXH A;  3B47 A;  2IWD A;  5HL1 A;  1ONG A;  5EPH A;  3M6B A;  4EES A;  4F94 A;  1CI9 A;  2X71 A;  1XFN A;  2O9B A;  4HBU A;  2WGV A;  2B5R A;  2V8F A;  3BFE A;  5HD3 A;  1XP4 A;  2JKT M;  3I7J A;  4I3J A;  4LV3 A;  3EGD C;  3RXX A;  3MXQ A;  2A2L A;  2JC7 A;  3P98 A;  4C75 A;  4JXV A;  2J3W A;  1YT4 A;  3JYI A;  1K4F A;  2LB9 A;  4HP4 A;  4EQ1 A;  4K0W A;  2ZMF A;  3QNC A;  1MBL A;  5EVL A;  3FKV A;  3LI8 A;  1K6S A;  2JN7 A;  1LHY A;  3IF6 C;  3N8L A;  2V8C A;  2ZQ7 A;  1BLP A;  4EXO A;  4KQQ A;  2JKR I;  1YMX A;  1NYM A;  3ZGA B;  3BY8 A;  3HLG A;  1OJ5 A;  4FD8 A;  3C7V A;  4I38 A;  3NC8 A;  4N1X A;  5CTM A;  3UE6 A;  4R3J A;  1OTB A;  4N1H A;  3BEC A;  1LL9 A;  1S4R A;  2H10 A;  2WAF A;  4U3T A;  1ZKJ A;  1BLC A;  3NI9 A;  3ZDJ A;  4DE3 A;  1TD5 A;  4LCL A;  3UPN A;  1IEM A;  1RGZ A;  4IBX A;  1M6K A;  1VET A;  3SS4 A;  4KUO A;  1FCM A;  3PBN A;  4BEN A;  3T1S A;  1KE3 A;  1VEU B;  1L3L A;  3S7P A;  4Q0J A;  2WGI A;  3IWO A;  4EEP A;  4DKI A;  1SZV A;  4H8R A;  3RTY A;  1MY8 A;  1PW8 A;  2OWH A;  3PTE A;  4Q8I A;  4QWO A;  2WZZ A;  5EOE A;  5KSC A;  2FZ0 A;  3G31 A;  2IWB A;  4MBK A;  3A3F A;  1XA7 A;  4PPR A;  3NHQ A;  3PAG A;  4WEK A;  4WN5 A;  2JKF A;  1C3B A;  4OPR A;  3MZD A;  3MQ0 A;  5FQQ A;  4OLG A;  1BUE A;  1NWZ A;  3SS5 A;  3U4L P;  5EOO A;  2ZC3 B;  3CUE C;  1BLS A;  5CEB A;  5E2H A;  3Q7V A;  2QWS A;  3HJI A;  3NY4 A;  4B88 A;  2ZC5 B;  4HIA A;  3OPL A;  3OCL A;  4O01 A;  4DMZ A;  3MZF A;  2EX2 A;  1XXM A;  2V9A A;  3OOV A;  4R0Q A;  3IHA A;  5HPI A;  1K57 A;  3KX0 X;  4KG6 A;  4MLL A;  2O9C A;  5GHZ A;  5F1G A;  5FA7 A;  4H6J B;  4P6Z S;  4ZJ1 A;  4PM7 A;  3EEA A;  5DVA A;  3D4F A;  4E6W A;  3S22 A;  5TFQ A;  3T4Q A;  4XXR A;  3E2L A;  1YSP A;  1WYB A;  2ZOI A;  1ACF A;  1CEF A;  2L1M A;  4NXF A;  1BZA A;  5CGX A;  2ZM2 A;  1N9N A;  4CLC B;  1VHM A;  4MMN A;  1YLT A;  2M1C A;  1ONH A;  5DTK A;  5DF9 A;  1G28 A;  1Q2Q A;  4KG2 A;  4YNR A;  1OTD A;  4UA7 A;  2BLS A;  4QJG A;  3FPV A;  2HDS A;  3IH8 A;  3BFD A;  3T1R A;  4BL3 A;  5FSR A;  1E25 A;  3QP8 A;  4R3A A;  4BWI A;  3PBT A;  2DRW A;  3FG8 A;  1FQG A;  2D02 A;  4L0L A;  4BD0 A;  4LV0 A;  4Q0H A;  1ESU A;  2C5W B;  3HUM A;  3RH8 B;  2JCH A;  3TRC A;  5TBM B;  3D72 A;  4S2K A;  2C6W B;  1JWP A;  3BEB A;  4NKP A;  2HZ5 A;  5GLA A;  4BQM A;  4Y0O A;  1GHI A;  2K7S A;  2WZX A;  3BM6 A;  5HWW A;  3G6O A;  4JGO A;  4DXC A;  5FEF A;  1CEG A;  3HBR A;  3QP2 A;  4X1L A;  2XFT A;  2ZQD A;  2XK1 A;  2BAS A;  3L9K A;  1CJF A;  4FH2 A;  2INW A;  2PU4 A;  3T4T A;  2VV6 A;  1I5Q A;  1FCN A;  3LFV A;  3CIT A;  4X69 A;  2J80 A;  3PYP A;  3IF6 B;  5FQ9 A;  4LV1 A;  1F9I A;  4AFI A;  3W4Q A;  4S2N A;  5CXW A;  3OC2 A;  4NET A;  3UY6 A;  4UA9 A;  4IUH A;  2ZMV A;  3LIF A;  4LPZ A;  3DTK A;  5F83 A;  1FR1 A;  4CQH A;  1VM1 A;  5GLB A;  2R9X A;  5CHU A;  3RJU A;  4P87 A;  2V1A A;  1ES4 A;  4WZ5 A;  3VSL A;  3IF5 A;  1TS0 A;  4UA6 A;  3S7N A;  4MDZ A;  3JVU A;  3OZH A;  4X53 A;  5G4Y A;  4DF6 A;  3SW1 A;  3K3C A;  3Q81 A;  2WKI A;  1RGY A;  4B4Z A;  5L8M A;  4HHD A;  5FDS A;  3CLO A;  3MR0 A;  4R6L A;  3WRT A;  2M7U A;  5L2F A;  4M4X A;  2PYP A;  3Q07 A;  5FQM A;  4GNU A;  4U0X A;  1L0G A;  2EXA A;  1K54 A;  4XUX A;  5J8X A;  3UE1 A;  5M18 A;  3N4I A;  4NXE A;  3SZT A;  2XSS A;  4FTX A;  2X02 A;  4E3K A;  3A3E A;  1EW0 A;  3HLE A;  2K2N A;  2WKQ A;  1NLY A;  5DJT A;  1TS8 A;  3SH7 A;  5J4E A;  4S2M A;  5E2E A;  1W63 Q;  2W3G A;  2HV1 A;  1T1C A;  3T4J A;  4EET B;  4CLC A;  1K38 A;  3T1X A;  3V3R A;  2EFU A;  3E98 A;  4D60 A;  4QHC A;  4RYE A;  1W79 A;  4ZDX A;  2OLV A;  2Z2M B;  4WBG A;  1N4O A;  1LT0 A;  3CHW P;  2QKP A;  5IS1 A;  3T50 A;  2QHK A;  3G35 A;  1LLB A;  3ITB A;  3S4X A;  1J9M A;  1RCJ A;  4X68 A;  4EQI A;  3GVB A;  5HFO A;  1NZU A;  1SKF A;  5J7E A;  2VGJ A;  1OTA A;  4IED A;  4LLO B;  4EUZ A;  3D3O A;  2B18 A;  2J7V A;  3ZG7 B;  1KVL A;  1JWV A;  3ZG9 B;  3FZC A;  4BLM A;  1JNU A;  4HOI A;  1MWR A;  4EER A;  3UDX A;  2ZD8 A;  3EQV A;  3O3V A;  1U60 A;  4F3L B;  5CGS A;  5CED A;  1LL5 A;  5FQJ A;  3VV4 A;  5DTT A;  1S1Y A;  2QJ7 A;  4CPK A;  4XT2 A;  1ES2 A;  2ZL1 A;  5CGW A;  5F69 A;  5AVF A;  1NY0 A;  3L7H A;  3IF6 A;  1OME A;  2Y59 A;  3WRZ A;  4X6T A;  3WS2 A;  1PFL A;  3BWL A;  3CZD A;  4HNB A;  4E04 A;  2V0W A;  2B95 A;  5GLD A;  3CMZ A;  1L0E A;  3QP4 A;  1K55 C;  1FSY A;  3C5A A;  2GDN A;  2Y55 A;  3BJN A;  1K6R A;  3QP5 A;  2O9A A;  2EWV A;  2RL3 A;  1YLP A;  2Y2Q A;  1LL8 A;  3MJQ A;  2JHE A;  4GDB A;  1DRM A;  4MEZ A;  2OLU A;  4JF5 A;  2VA0 A;  3B33 A;  4DE2 A;  1DY6 A;  4HJ4 A;  3OPP A;  3VP0 A;  3MF0 A;  2KDK A;  2JKT I;  3F1O A;  4G3W A;  5HAP A;  3PBQ A;  3MKF A;  3ISG A;  4G3V A;  4KQR A;  3H7W B;  5F1F A;  4DE0 A;  3WS1 A;  2XF3 A;  2ZM8 A;  4HP9 A;  1QME A;  4PM8 A;  4KZ9 A;  4DN0 A;  1TS6 A;  3HUO A;  3O88 A;  3Q7V B;  3EOI A;  4I3A A;  4C3Q A;  5AQ7 A;  5F5Y A;  1BT5 A;  4U0T A;  3M6H A;  5D3O A;  3HLW A;  2EFX A;  2PT7 A;  3A3J A;  1ERO A;  1G68 A;  3DW0 A;  4S2J A;  5C5K A;  2XRO A;  1YQS A;  2XD5 A;  1CF0 A;  2XFS A;  3E2K A;  4JKT A;  2FH5 A;  4B93 A;  1XGJ A;  2WKE A;  1W63 M;  4E3I A;  1SCW A;  4BMW A;  3CUE A;  4QY5 A;  3WWX A;  4KQD A;  4KEN B;  4JXG A;  4KZB A;  2Y8H A;  5EE8 A;  5HDS A;  3ITA A;  3LEZ A;  2CMN A;  1N9B A;  1MPL A;  1MKM A;  3IS2 B;  1ES5 A;  4QY6 A;  4R23 A;  2EA9 A;  1OT6 A;  3ZG0 A;  5DTS A;  3ZFZ A;  1HLU P;  2WYX A;  3N8R A;  3BYD A;  2Y2G A;  3G2Z A;  2OOL A;  1N9L A;  2A3U A;  3GEC A;  1KGE A;  1PI5 A;  2ZM0 A;  2Y2M A;  2W3D A;  5HDC A;  2ZQC A;  3M2K A;  3R4K A;  4QPR A;  2PD7 A;  3NDE A;  4Y5F A;  3S1Y A;  3KYQ A;  4OQ0 A;  5FI2 A;  3A3I A;  4F3L A;  1S0W A;  3LIC A;  4C6Y A;  3GSG A;  4ZAM A;  4JGQ A;  3LYX A;  3KSI A;  1XX2 A;  2YKF A;  1VQQ A;  1BTL A;  2XA7 M;  3AGF A;  3MSH A;  3C7U A;  4X56 A;  1IYS A;  1DJA A;  2WAE A;  2HGV A;  3UE3 A;  3SS3 A;  4QU3 A;  1F5M A;  1UWN X;  4P6Z M;  1BSG A;  5IHV A;  3C4P A;  1F2K A;  1HVB A;  2ZQA A;  4HES A;  3HLC A;  3N8S A;  3UPO A;  1IYQ A;  2W3E A;  3A3D A;  3N7W A;  4OLD A;  4DJ2 A;  1MWS A;  4PKY A;  1Y4O A;  2HJ9 C;  3NUL A;  4B9O A;  2Z6C A;  1ES3 A;  3IBR A;  1PZP A;  1ZG6 A;  4MN5 A;  2Y4A A;  3T4L A;  1SDN A;  3V67 A;  4YWZ A;  1GHP A;  4RQ9 A;  3G30 A;  5HL6 A;  4UEY A;  2V20 A;  3H7W A;  4XUZ A;  3PBR A;  2PRF A;  4PMA A;  5EM1 A;  3LY3 A;  4D2O A;  2ZC6 B;  2OAP 1;  5HPF A;  2UV0 E;  3R7W B;  5FAS A;  3K2N A;  3QNB A;  4WYY A;  3GR2 A;  3LO7 A;  3TOI A;  1F98 A;  4GN2 A;  4Y7P A;  1KGG A;  3Q82 A;  2XR0 A;  1W8Y A;  1ZC2 A;  3F1P A;  4EBP A;  5AQB A;  4UAA A;  5GHX A;  2ZJ9 A;  1ZTU A;  2KLI A;  3LI9 A;  3NOT C;  5G18 A;  1FSW A;  4ZJ2 A;  5FEG A;  1Y28 A;  5K5B A;  4WZ4 A;  2J3T C;  4HJ3 A;  2HJE A;  3LCE A;  5CER A;  1CQA A;  1OPX A;  3UE0 A;  2PAV P;  1Y54 A;  5CTN A;  1K25 A;  4MN7 A;  3BQA A;  4L9G A;  2WKP A;  4I39 A;  4WM9 A;  4Y17 A;  5F68 A;  3LID A;  3IS2 A;  3VE3 A;  1PWG A;  2G7U A;  2XD1 A;  3LIE A;  2VV8 A;  5TJJ A;  2VJW A;  4LFU A;  4MCW A;  3DWZ A;  1Q2P A;  3LR3 A;  3LR5 A;  1OT9 A;  1W8Q A;  4JXS A;  2Q9N A;  3V5M A;  3ZNY A;  3MQQ A;  2G2W A;  4Q0I A;  4ZRR A;  4KZ8 A;  1NRJ A;  4OPZ A;  3UB9 A;  2LB5 A;  1H5X A;  3NCK A;  4IBR A;  4P6B A;  5EVE A;  3A0S A;  2JBF A;  4DE1 A;  4GD8 A;  3IH9 A;  2VGK A;  4OP8 A;  5DKL A;  3CAX A;  5HZH A;  3QP1 A;  3ICY A;  4LGW A;  4K0X A;  4OVD A;  2HF6 A;  3GQZ A;  3M2J A;  3ZVT A;  5HAI A;  1GSW A;  3SH8 A;  4E3M A;  3GMW A;  5EFW A;  2HDQ A;  2VZW A;  3PBO A;  2H5S A;  1KE0 A;  4EWF A;  2Y2I A;  3ZCZ A;  5GLC A;  3VP3 A;  4DDS A;  2VGL M;  3NIA A;  1UWP X;  1STZ A;  3BLS A;  1IEL A;  5GHY A;  5G4Z A;  5DFX A;  3LR0 A;  1Z6F A;  3LEQ A;  2P7J A;  4GHI A;  2VX8 A;  5EVI C;  3IHB A;  4S2L A;  2V0U A;  4FSF A;  3MZE A;  4XT2 B;  1JTD A;  2ZL1 B;  3QHY A;  2H28 A;  1SHV A;  2P9V A;  2Z2L B;  4PM5 A;  3B3X A;  4KZ7 A;  2OAQ 1;  4G3K A;  2PU2 A;  3KO6 A;  5FQK A;  1PWD A;  4LRX C;  5FI6 A;  1D1J A;  3JPU A;  2JE5 A;  3GRJ A;  1G6A A;  5AJG A;  1MZU A;  2VV7 A;  3TG9 A;  3W2Z A;  5HD5 A;  5AQ9 A;  2QJ5 A;  1PZO A;  3R7W A;  1MKI A;  1D06 A;  1GHM A;  3P01 A;  4HY8 A;  2PR6 A;  3IX4 A;  4HH2 A;  5GL9 A;  1PIO A;  1V9Y A;  3ZVW A;  1XJ2 A;  3BRM A;  4II7 A;  4HH3 A;  1P9R A;  1MC0 A;  2EX8 A;  3LUQ A;  4WF0 A;  1ERQ A;  3N6I A;  4OOY A;  3F1O B;  3G32 A;  1OTE A;  3ZG5 A;  1XA1 A;  4N92 A;  1K55 A;  3HCY A;  2GNX A;  1OTI A;  4GW9 A;  1YLJ A;  4R4R A;  1I2W A;  1S1Z A;  2ZMA A;  3P7N A;  2P08 A;  4LRZ E;  4S2P A;  4HBT A;  4YOF A;  1TDG A;  4QB8 A;  1HZO A;  1IYP A;  3OLO A;  1KGF A;  5CX7 A;  1JTG A;  4BJP A;  1QMF A;  3FYZ A;  2W1R A;  4OQG A;  1X0O A;  4GKU A;  4KG5 A;  4BD1 A;  1H8M A;  5KZH A;  4HJ6 A;  4WEL A;  1XPB A;  2R9W A;  4RX2 A;  2Y2J A;  2VEA A;  3HLD A;  1FIL A;  3C8C A;  5U47 A;  1P0Z A;  1TVF A;  5KMW A;  3F1N B;  3VOL A;  2GZA A;  5DF8 A;  4X1M A;  5L09 A;  1XFQ A;  1DJB A;  4IUK A;  2E8J A;  2O0Y A;  3MXR A;  2D01 A;  1AWI A;  2QZ6 A;  3DAV A;  3ZHH A;  3EGX C;  2VK3 A;  5FL3 A;  5KSH A;  1LSW A;  2DMW A;  3KSH A;  2UWX A;  2PD8 A;  4Y2F A;  3VP1 A;  4GDN A;  3ZYT A;  1HTZ A;  3CWF A;  2Y2P A;  3HLF A;  4OPY A;  3LR4 A;  4FH4 A;  4ETZ A;  3PHY A;  4RX3 A;  4MBF A;  1LI0 A;  3W4P A;  1YAX A;  1K56 D;  3HJK A;  4GJ4 A;  1NLZ A;  4E6X A;  1PWC A;  4Z9Q A;  2P74 A;  2V2F F;  4IVI A;  1ZG4 A;  2KOI A;  2A49 A;  3HUN A;  4X55 A;  2ZQ8 A;  2EWW A;  3PXP A;  4GCZ A;  3MBZ A;  5MC7 A;  5AVE A;  1T1B A;  3KYE A;  4BBU A;  2XDM A;  2FFY A;  2L4R A;  1IKG A;  5HAQ A;  4Y0T A;  1PNE A;  4FCF A;  4P85 A;  4NG2 A;  5DF7 A;  2J3T D;  2V1Z A;  3SH9 A;  2Y2K A;  3C4O A;  4JF4 A;  4EV4 A;  3C30 A;  3UDF A;  4DRT A;  4WL9 A;  4KZ6 A;  3S7Q A;  2M7V A;  1GCE A;  5IT5 A;  4ARZ A;  3CG5 A;  2DCF A;  1IYO A;  4FOF A;  4L9E A;  5A8B A;  4Z1W A;  3Q7Z A;  4JXW A;  4JF6 A;  1DP6 A;  3U2A A;  3MFX A;  5FAO A;  1PYY A;  2ZC4 B;  2P04 A;  3BY9 A;  1ZHH B;  1MXO A;  3VFF A;  3UN7 A;  1IFQ A;  1HD8 A;  2MJ6 A;  2RCX A;  5A90 A;  1KOU A;  4FUW A;  1Z09 A;  5AQA A;  3EQU A;  2WGW A;  5HW3 A;  3BFC A;  3UPP A;  4M3K A;  5EUA A;  3GDI A;  5LBR A;  4R38 A;  3F1P B;  2BG1 A;  3K3D A;  4GS9 A;  1H8Z A;  2B02 A;  1TDL A;  4O0P A;  5I94 A;  1GSV A;  3TW8 A;  4GB7 A;  2QPN A;  2WKR A;  1S4S A;  4OH0 A;  1L2S A;  3VP2 A;  1SDE A;  1EWZ A;  4ZBE A;  1K56 A;  5CHJ A;  2L0W A;  4ZJ3 A;  5EVI D;  3OPR A;  2H0T A;  3F1N A;  1CK3 A;  3MFD A;  4IVK A;  2Q9M A;  4EEU A;  1NZO A;  4Y15 A;  1O7E A;  2FFF B;  3OPH A;  3H82 A;  4OOL A;  1NXY A;  1NJ4 A;  4BL2 A;  4E3L A;  1GA0 A; 
#chains in the Genus database with same CATH homology
 3DBA A;  3E4Q A;  3JVV A;  1ZTU A;  1XJ3 A;  2KLI A;  3LI9 A;  3NOT C;  4UQI S;  4IUH A;  2ZMV A;  3LIF A;  4LPZ A;  1Y28 A;  3TE8 A;  4PKY G;  4CQH A;  2W3F A;  5K5B A;  3OBF A;  3EWK A;  4MN6 A;  2J3T C;  4O8G A;  5F6A A;  4HJ3 A;  2HJE A;  1OPX A;  1P9W A;  4HI4 A;  3RFB A;  2V1A A;  4HQA A;  4BBV A;  4MN7 A;  1DP8 A;  2GX5 A;  3BQA A;  4L9G A;  1TS0 A;  3ULF A;  4KUK A;  1WA9 A;  2WKP A;  4I39 A;  5F68 A;  5HWT A;  3LID A;  3IS2 A;  3T4S A;  3VE3 A;  3S7N A;  2G7U A;  4MDZ A;  3LIE A;  1T1A A;  2VV8 A;  3JVU A;  5TJJ A;  2VJW A;  5G4Y A;  1XJ6 A;  3SW1 A;  3K3C A;  4MCW A;  2Z6D A;  3LR3 A;  5KIZ A;  5L8M A;  3LR5 A;  1OT9 A;  4HHD A;  3CLO A;  3MR0 A;  4R6L A;  2M7U A;  3MQQ A;  4UQI M;  4KQO A;  1P97 A;  4Q0I A;  4M4X A;  2PYP A;  4ZRR A;  1NRJ A;  3UB9 A;  4GLQ A;  3UB6 A;  4NXG A;  2LB5 A;  3A0S A;  3FC7 A;  2K31 A;  4NXE A;  3KYZ A;  2XSS A;  4GHI B;  3MQO A;  1EW0 A;  5DKL A;  2K2N A;  3CAX A;  2WKQ A;  1NLY A;  5DJT A;  5HZH A;  2W1T A;  1D7E A;  3VE4 A;  3ICY A;  1TS8 A;  5J4E A;  4BBT A;  1LSX A;  5HWV A;  2YKH A;  2ZOH A;  2HF6 A;  2W3H A;  1W63 Q;  2W3G A;  2HV1 A;  1T1C A;  3T4J A;  1V9Z A;  1S66 L;  4CLC C;  1GSW A;  4CLC A;  4EET B;  5I5L A;  5EFW A;  2VZW A;  2JKR M;  3PBO A;  3E98 A;  2Y79 A;  1OJG A;  2GJ3 A;  5DKK A;  2VGL M;  3B47 A;  4LRY C;  1UWP X;  1STZ A;  1LT0 A;  2QKP A;  5G4Z A;  5IS1 A;  2NUT C;  5DFX A;  3T50 A;  3LR0 A;  4EUV A;  2QHK A;  3UMD A;  1T19 A;  2P7J A;  4GHI A;  1UGU A;  2VX8 A;  3TJZ C;  5HDD A;  2V0U A;  3MMH A;  4FSF A;  4EES A;  4XT2 B;  3UME A;  1XFN A;  1BYW A;  2O9B A;  3C38 A;  5J7E A;  2H28 A;  1OTA A;  4LLO B;  4IJG A;  3D3O A;  2B18 A;  2OAQ 1;  4G3K A;  4WEJ A;  2JKT M;  5HD3 A;  4I3J A;  4JGR A;  3EGD C;  3KO6 A;  3MXQ A;  2A2L A;  1T18 A;  4LRX C;  1JNU A;  2J3W A;  4HOI A;  4EER A;  2W0N A;  3EQV A;  3IBJ A;  5AJG A;  4F3L B;  2A24 B;  1MZU A;  2LB9 A;  2VV7 A;  4HP4 A;  3T4O A;  3W2Z A;  4EQ1 A;  5HD5 A;  2ZMF A;  2QJ5 A;  3VV4 A;  3R7W A;  1S1Y A;  4CLC E;  1D06 A;  2QJ7 A;  3LI8 A;  3P01 A;  4HY8 A;  4XT2 A;  2PR6 A;  4HH2 A;  2JN7 A;  5F69 A;  2XA7 S;  5AVF A;  3OCN A;  1V9Y A;  4ME4 A;  4NEE D;  1XJ2 A;  4II7 A;  4HH3 A;  1P9R A;  1MC0 A;  3LUQ A;  4WF0 A;  4E04 A;  3BWL A;  4HNB A;  3F1O B;  3E4P A;  4EXO A;  2V0W A;  2JKR I;  1OTE A;  4R70 A;  3BY8 A;  3E4O A;  1OJ5 A;  3HCY A;  3PR6 A;  2PDR A;  2GNX A;  3BJN A;  1OTI A;  4GW9 A;  4I38 A;  3UE6 A;  2R78 A;  2O9A A;  2EWV A;  1OTB A;  1S1Z A;  3P7N A;  2P08 A;  1LL8 A;  1S4R A;  3MJQ A;  2JHE A;  4LRZ E;  1DRM A;  4YOF A;  4L9F A;  2VA0 A;  3B33 A;  3CI6 A;  3A0R A;  1TD5 A;  4HJ4 A;  3OLO A;  4JGP A;  2PR5 A;  5CX7 A;  4BJP A;  2W1R A;  1TF1 A;  3MF0 A;  2KDK A;  1X0O A;  4KUO A;  3F1O A;  2JKT I;  3PBN A;  4G3W A;  5DJU A;  3PBQ A;  4G3V A;  3H7W B;  1H8M A;  4PAU A;  4HJ6 A;  1VB6 A;  4WEL A;  3S7P A;  4HP9 A;  4Q0J A;  2VEA A;  4EEP A;  3C8C A;  4DN0 A;  1TS6 A;  1P0Z A;  1GSX A;  3EOI A;  3F1N B;  3RTY A;  2GZA A;  3VOL A;  2OWH A;  4I3A A;  1TS7 A;  4OOM A;  5F5Y A;  1XFQ A;  4IUK A;  2O99 A;  2PT7 A;  2O0Y A;  2FZ0 A;  2D01 A;  4CLC D;  5C5K A;  2XRO A;  3NHQ A;  4I3I A;  5J3W A;  3EGX C;  4WEK A;  5FL3 A;  5KSH A;  1LSW A;  2DMW A;  2FH5 A;  3KSH A;  4PHT A;  4B93 A;  2PD8 A;  4WN5 A;  4Y2F A;  4EW7 A;  3ZYT A;  1IOU A;  1W63 M;  3MQ0 A;  3CWF A;  1NWZ A;  3LR4 A;  4ETZ A;  4BMW A;  3PHY A;  1S67 L;  3CUE C;  2VKS A;  2KX6 A;  3CUE A;  3C2W A;  1YAX A;  3BQ8 A;  2QWS A;  3HJK A;  4GJ4 A;  3HJI A;  1YSQ A;  1G6O A;  1NLZ A;  4KQD A;  2ZBB A;  2Y8H A;  5HDS A;  1ODV A;  2XRN A;  4HIA A;  4IHQ A;  5IU1 A;  2CMN A;  3OCL A;  4O01 A;  1MKM A;  3IS2 B;  3B42 A;  2KOI A;  4DMZ A;  2EWW A;  3PXP A;  4GCZ A;  1N9O A;  2EA9 A;  1OT6 A;  5MC7 A;  2V9A A;  3OOV A;  2QYB A;  5HPI A;  4ARZ B;  5AVE A;  3O5Y A;  1T1B A;  3KX0 X;  3NJA A;  2O9C A;  2PHY A;  2W27 A;  4BBU A;  3NOU C;  2L4R A;  2OOL A;  1N9L A;  3GEC A;  4WLA A;  4H6J B;  4P6Z S;  2VLG A;  2W3D A;  3KSF A;  4Y3I A;  5HDC A;  2J3T D;  1DP9 A;  3EEA A;  4ETX A;  3R4K A;  4QPR A;  2PD7 A;  4WUJ A;  4Y5F A;  3KYQ A;  3T4Q A;  4F3L A;  3C30 A;  2A24 A;  3LIC A;  1YSP A;  4I5S A;  2W1T B;  4WL9 A;  2ZOI A;  3UB7 A;  3S7Q A;  2L1M A;  3LYX A;  4JGQ A;  3KSI A;  4NXF A;  3EEH A;  2YKF A;  2M7V A;  1N9N A;  5DFY A;  4CLC B;  1VHM A;  4MMN A;  5IT5 A;  2I9V A;  2M1C A;  4ARZ A;  2XA7 M;  5DF9 A;  1G28 A;  1LSV A;  4GS9 B;  4YNR A;  1OTD A;  2VGL S;  4FOF A;  4L9E A;  5A8B A;  4Z1W A;  3FPV A;  2HGV A;  3U2A A;  1DP6 A;  4H6J A;  3MFX A;  3UE3 A;  1F5M A;  2PYR A;  1UWN X;  2P04 A;  3BY9 A;  4P6Z M;  1ZHH B;  3ZQ5 A;  3H9W A;  4NXB A;  1IFQ A;  1XJ4 A;  4R3A A;  4BWI A;  2MJ6 A;  3PBS A;  3PBT A;  1KOU A;  3FG8 A;  2D02 A;  3EQU A;  4L0L A;  2NUP C;  4Q0H A;  5HSQ A;  2W3E A;  4DJ2 A;  3KSG A;  4PKY A;  3RH8 B;  2IA2 A;  3A0V A;  3GDI A;  3TRC A;  5TBM B;  3D72 A;  3E0Y A;  2HJ9 C;  1H3Q A;  4B9O A;  5LBR A;  4R38 A;  2Z6C A;  3H82 B;  3F1P B;  4NKP A;  3K3D A;  3IBR A;  4GS9 A;  3LIB A;  2B02 A;  4DJ3 A;  4MN5 A;  3T4L A;  4O0P A;  3V67 A;  2K7S A;  1GSV A;  4YWZ A;  2V1B A;  3TW8 A;  4RQ9 A;  3G6O A;  5HWW A;  4JGO A;  5HL6 A;  4UEY A;  2WKR A;  3H7W A;  3S7O A;  1S4S A;  4K08 A;  3LIA A;  2BAS A;  3PBR A;  2INW A;  3T4K A;  3BW6 A;  2OAP 1;  5HPF A;  3T4T A;  2L0W A;  3R7W B;  2VV6 A;  3UB8 A;  3LFV A;  3K2N A;  3CIT A;  3NOP C;  4EU0 A;  3F1N A;  2J80 A;  2OWJ A;  1F98 A;  4EEU A;  5TBM A;  3PYP A;  3FPW A;  1F9I A;  3H82 A;  4AFI A;  3F1P A;  1YKD A;  4OOL A;  3OC2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...