5KMWA

Toho1 beta lactamase mutant e166a/r274n/r276n -benzyl penicillin complex
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
256
structure length
256
Chain Sequence
VQQQLEALEKSSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTAPTLNTAIPGDPRDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQPEQKAENRNDILAAAAKIVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase Toho-1
publication title TOHO1 Beta lactamase mutant E166A/R274N/R276N -benzyl penicillin complex
rcsb
source organism Escherichia coli
total genus 91
structure length 256
sequence length 256
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2016-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5kmwA00
2EX8A 1DJAA 4OH0A 4OQ0A 3HBRA 3SS3A 3TG9A 4E6WA 4S2OA 1W7FA 4JLFA 4KZ4A 1CI9A 3PBRA 4BL2A 3MZEA 3GTCA 1FR6A 3NBLA 4JXSA 4BLMA 2BG1A 4X68A 1SCWA 5EE8A 1IYOA 2ZM0A 4FSFA 4R3JA 4GKUA 3SS5A 4HESA 3CMZA 4QU3A 3WS1A 4S2LA 4KZAA 2WKIA 2Y4AA 3ZHHA 3WWXA 1PW1A 2FFFB 2ZM8A 2V2FF 2QZ6A 4HBUA 4LENA 4X56A 3Q7VA 2J9PA 5FQKA 3E2KA 3UE0A 4IVKA 4X53A 1SKFA 3GVBA 1KVMA 1W79A 4OP8A 5HARA 4GD6A 3N8SA 1MXOA 4BL3A 1KE4A 2Y2NA 1K56D 1KDWA 5L2FA 2XH9A 4WELA 3NCKA 4WZ4A 1K57A 1SDNA 2WK0A 2Y2PA 3UPPA 5F1FA 3O86A 3ZVTA 3OC2A 4IVIA 2ZQAA 2ZD8A 5EVLA 3SH9A 2WZXA 4F94A 1HD8A 2C6WB 3Q7VB 3PAGA 4S2NC 5HL1A 3EQVA 5KMWA 4E6XA 2I72A 1W8YA 4X69A 3ZGAB 3OPHA 2OSUA 2JE5A 2PU2A 5DTTA 1GHIA 3BLMA 1IKIA 2IWDA 3IXGA 3ZVWA 4U0XA 1H5XA 1PIOA 1NYMA 2EX2A 2XQZA 1LL5A 4U0TA 5DTKA 4P85A 4CPKA 5HAQA 3HLWA 5CTMA 1K4FA 1Z6FA 5CHJA 5FAQA 3VOYA 5FQQA 4E3IA 4OPZA 5TFQA 4XUZA 5EOOA 3D4FA 2G2UA 3IH8A 3M2KA 4OOYA 2OV5A 3M2JA 3IF6A 3O87A 4KQQA 2A3UA 3BEBA 4DRTA 1BLPA 1PI5A 4GDNA 1G68A 3GRJA 3GV9A 3LCEA 3N8LA 1K25A 2DCFA 5DF9A 3SH8A 3N4IA 3WS5A 2WZZA 2ZLYA 2UWXA 5DVAA 3G4PA 1KGGA 3DWZA 1ZC2A 4EBPA 1N4OA 2HPBA 4RX3A 1L2SA 3HLEA 2ZC4B 1XA7A 4WZ5A 2OLUA 3BRMA 4A5RA 1MY8A 3UDXA 5CGSA 1JWZA 1YLYA 4MEZA 5KZHA 3IF6B 1ZG6A 4OQHA 2Y2QA 4D2OA 4C3QA 5DTSA 4JXGA 5IHVA 2B5RA 2Y2OA 4Y0UA 2WADA 3RJUA 3ZG8B 4BQMA 3GMWA 4JF5A 3V3SA 3W4OA 1G6AA 1XA1A 2ZQCA 4LV3A 4H8RA 4UHUA 2C5WB 1MWSA 4ZTKA 5GLDA 2Y2GA 5M18A 4GNUA 4ZDXA 3SS4A 4FH4A 3VP0A 2QMIA 2P9VA 3VFHA 2Y55A 4E3KA 4B4ZA 5CHUA 3BLSA 4QD4A 4DF6A 2VGKA 4FCFA 4QB8A 4S2KA 3WS2A 1CEGA 3G31A 1JWVA 3M6HA 1E3UA 1LI9A 3HLCA 4WEKA 5A93A 1Q2PA 2Y2LA 5AQBA 2P74A 1U60A 1GHPA 1ONGA 1XGIA 3HLGA 2HDUA 4L0LA 4LV0A 3UE3A 1KVLA 2WGVA 4PPRA 4LV1A 2P9VB 1GHMA 3VFFA 2J8YA 3I7JA 1PZOA 1N9BA 3HUOA 2XF3A 2WAEA 1XGJA 3WRZA 5FAPA 3MKFA 1TVFA 1LI0A 5KSHA 4PM9A 3FWLA 2EX9A 1K55C 2X02A 3IWOA 1ERQA 1W5DA 2WKEA 5EVIB 5CERA 3ITBA 3ZG5A 4DDSA 5FI2A 5E2GA 1K54C 3A3DA 4MNRA 4QY5A 1YT4A 1ESIA 1NYYA 3GSGA 1MWUA 5BOHA 1L0FA 1I2SA 5EPHA 2XFTA 3ISGA 5FQMA 4UA7A 1YMSA 4IBRA 5CHMA 3MBZA 4MBKA 1RCJA 2HP5A 5FDHA 1YMXA 4P87A 5HFOA 1IYQA 4C6YA 5F83A 2EXBA 5E2HA 3GR2A 3G35A 3HL9A 4GB7A 3P09A 3Q7ZA 1PZPA 3IHBA 1BSGA 5CGXA 2H10A 3FKWA 5DF8A 2XLNA 4DE1A 4LCMA 1FR1A 3IWQA 1XPBA 3BM6A 4IEDA 4EBNA 1CK3A 4M3KA 5AQAA 5U47A 5FA7A 1J9MA 4JXWA 3OZHA 1L0EA 2RL3A 2QPNA 2WGWA 5F1GA 1LLBA 1L0GA 1LHYA 3ITAA 3UDIA 2PU4A 4EV4A 1RGYA 4NETA 3N7WA 4FH2A 3BFCA 4OPQA 5EOEA 4YFMA 3ZG9B 3OCLA 1IEMA 5CRFA 2XFSA 3G2ZA 1MWTA 1LL9A 1KGEA 4LV2A 4O7DA 4S2IA 4KG2A 4DDYA 4E3LA 2WGIA 4Q8IA 3V50A 3MXSA 1ES5A 2R9WA 3C4OA 1E25A 3W4QA 2HDSA 2WGWB 3HUNA 2Y2HA 1YLJA 2ZQ7A 3MFDA 1ES3A 1DJBA 1YLZA 2Y2IA 2BLSA 3IT9A 4WBGA 4UA9A 3IWIA 4KQOA 3UN7A 1NJ4A 2J9OA 1RGZA 3FZCA 3VP2A 3IXDA 2EFXA 4MBFA 3VSLA 4ID4A 4DKIA 2EXAA 4CJNA 1PWCA 3SH7A 3DWKA 5FQIA 4RVAA 3VOZA 3BYDA 4KZ8A 1JTDA 4GOGA 5FQ9A 3G2YA 3RXWA 3UPNA 3ZNTA 3FYZA 4EQIA 4R4RA 5FI6A 4QHCA 4Y0OA 3UNWA 3G34A 5F82A 1FCNA 3O88A 4R23A 3OCNA 5CXWA 2X71A 5CGWA 4PM8A 3W8KA 1BUEA 1HTZA 4LCLA 3LO7A 3RXXA 2GDNA 3V5MA 4QY6A 1BLSA 1YM1A 2G2WA 1KGFA 3FV7A 3QNBA 1YLWA 2Y2KA 1YLPA 4PM5A 1VM1A 1BLCA 3O3VA 4S2NA 5EVIC 1XP4A 5AQ7A 3C7VA 3NDEA 2ZMAA 4JF4A 2RCXA 4N92A 4S2MA 5J8XA 4PM7A 2Y2JA 4Y0TA 3V3RA 4OOLA 3HUMA 5E43A 5CEDA 1JVJA 1K4EA 4K0WA 2R9XA 3VP3A 5A91A 3M6BA 1NRFA 4BD1A 1KE0A 3TSGA 4PMAA 1SHVA 2FFYA 4U3TA 5EUAA 1O7EA 4WM9A 3DW0A 2X01A 1TDLA 1MWRA 4X6TA 5D3OA 5FI7A 5HAIA 4N9KA 1CI8A 4IBXA 4JPMA 2OLVA 4OQIA 1FCMA 1EROA 4S2PA 4ZJ1A 2VGJA 1BZAA 1SDEA 5GHYA 1ALQA 4ZJ2A 1O07A 4KZ5A 1AXBA 2ZC6B 3VP1A 5HW3A 1BLHA 1ESUA 4JF6A 2XD5A 4C75A 2V1ZA 1MBLA 2XDMA 1I2WA 5M19A 2E8IA 4OP5A 4OONA 3G32A 4JBFA 1PI4A 4QJGA 4ZBEA 3ZFZA 4PM6A 3EQUA 2ZC7A 5A92A 1KDSA 3MXRA 4RYEA 5FAOA 3NI9A 4E3MA 1TDGA 1M40A 1E3UD 3IXHA 3Q82A 5EVID 5E2FA 4WMCD 1IYPA 2JC7A 4P6BA 1S6RA 1K57C 4MLLA 3N8RA 1QMFA 3UE1A 3LY4A 4KQRA 2WUQA 4OKPA 5FQJA 4B4XA 1KE3A 3C7UA 3Q07A 3IXBA 2H5SA 2H0YA 3C4PA 4N9LA 4OVDA 1FQGA 4DXBA 4RX2A 1C3BA 1NZOA 1EWZA 3B3XA 3VSKA 4B88A 4Z9QA 4K0XA 2CC1A 3BFDA 3S1YA 3PTEA 3BFEA 2JBFA 4ZJ3A 2H0TA 3FKVA 5G18A 3NY4A 4BENA 1BTLA 3C5AA 5GL9A 3PBTA 3W4PA 3A3FA 3IHAA 4ZAMA 1MKIA 2ZQ8A 3NC8A 1I5QA 3SOIA 2HP9A 1DY6A 2Q9NA 1BT5A 3AGDA 3HVFA 1K56A 1IKGA 2HP6A 3UO9A 3UDFA 3ZCZA 4GZBA 4KG6A 1ZKJA 5HX9A 2ZJ9A 3NDGA 1M6KA 1CEFA 1ONHA 3IF6C 3IQAA 4X55A 1W8QA 5CTNA 5TGFA 3V39A 4E3JA 4EWFA 1JWPA 2JCHA 4GN2A 1DJCA 1S0WA 2HDQA 3GQZA 3QNCA 3WS0A 4R1GA 5CECA 1FCOA 1K55A 2J7VA 4OPYA 3A3JA 5GHZA 4WEJA 1YQSA 4UAAA 3VP4A 4S2JA 3S4XA 1FOFA 2PBYA 3Q81A 2ZC5B 1K54A 2Y59A 3PBNA 3WRTA 4EBLA 3HLDA 4OLDA 1FSWA 4WZ5C 5KSCA 3NIAA 3IH9A 5A90A 4XUXA 3N6IA 4YINA 3E2LA 2Q9MA 4GD8A 3OPLA 4OPRA 1K38A 3CZDA 3Q1FA 4R3BA 1JTGA 4UA6A 3CG5A 1GA9A 1GA0A 4KZ3A 1ERMA 4R0QA 2IWCA 3P98A 3UY6A 4HBTA 5GHXA 3HREA 5GLBA 2HDRA 3OPPA 5FSRA 2WKHA 4N1HA 5E2EA 1NZUA 3IF5A 4BD0A 4E3NA 4E3OA 2Z2MB 2EFUA 4MBHA 5EECA 1HZOA 1EI5A 1GCEA 3ZNYA 4DE3A 4K91A 4KENB 2XD1A 4HEFA 4GDBA 3VMAA 3BFGA 4RA7A 4Y7PA 3ZG7B 3JYIA 1WYCA 5M1AA 3QHYA 1H8YA 1L0DA 5FATA 1XX2A 1PWDA 3ZDJA 5AQ9A 3HLFA 4XXRA 3A3EA 2XR0A 5JYOA 5FASA 3LEZA 2V20A 4DXCA 4NK3A 4OOMA 1XXMA 2EX6A 3PBSA 1E4DA 5HAPA 1HVBA 2A49A 2Y91A 4FD8A 1Y54A 3AGFA 1BULA 3MZDA 1PWGA 3HLBA 3AGEA 1IELA 1WYBA 4KG5A 4DE0A 4EUZA 1Q2QA 3S22A 3BECA 1VQQA 1PYYA 4JKTA 5GLAA 3PBOA 2ZM2A 4KZ9A 2ZQDA 2XK1A 1OMEA 1TEMA 4N1XA 4OLGA 1IYSA 1YLTA 1K6SA 3PAEA 1MPLA 4P0MA 2IWBA 3CJMA 3WS4A 5CEBA 3ZG0A 4DE2A 1WE4A 2WYXA 1H8ZA 3MKEA 5TR7A 3TOIA 3MZFA 3A3IA 4BJPA 1RP5A 3BFFA 1QMEA 1ZG4A 1ES2A 4R4SA 4WMCA 4JXVA 5EVIA 2WAFA 1ES4A 5I94A 2DRWA 4WYYA 1NXYA 2DNSA 3LY3A 4OQGA 1XKZA 5GLCA 4KZ7A 4KZ6A 2XGNA 5JYPA 3UPOA 1NY0A 1FSYA 1K6RA 2XEPA 2ZC3B 5DF7A 3OPRA 2Y2MA 3DTMA 1PW8A 2Z2LB 4KZBA 3PBQA 3G30A 2ZQ9A
chains in the Genus database with same CATH superfamily
2EX8A 4OH0A 3TG9A 1W7FA 1DP6A 2W3DA 1CI9A 4BL2A 1FR6A 4JXSA 4BLMA 2VX8A 4FSFA 3T1XA 3WS1A 2EWVA 2WKIA 2VJWA 2Y4AA 3ZHHA 4LENA 5FQKA 1N9OA 3DTEA 4X53A 1KVMA 1W79A 1TS8A 2Y2NA 3IS2B 1W63M 4L9EA 1LT0A 1K57A 3UPPA 3O86A 3ZVTA 3OC2A 4IVIA 4G3VA 2ZD8A 2WZXA 4F94A 1HD8A 5KMWA 4E6XA 4EERA 3CUEC 1L3LA 2PU2A 4GLQA 3IXGA 1MZUA 3JPUA 5F69A 4CPKA 2GX5A 4EU0A 4ETXA 5AVEA 4PHTA 1F98A 4DN0A 4OOYA 2OV5A 4KQQA 1CQAA 2A3UA 3EGDC 3GRJA 2BASA 3N4IA 3RFBA 5FEGA 3LIBA 1ZC2A 3HLEA 1A0KA 5G4ZA 4Y5FA 4BMWA 4A5RA 5KZHA 4C3QA 4YNRA 5HD5A 3DTIA 4BQMA 3W4OA 2ZQCA 1XA1A 3UB5P 1VETA 2PRFA 2WKRA 2XA7S 3IX3A 4ZDXA 3SS4A 4FH4A 3NULA 2Y55A 4B4ZA 5CHUA 4DF6A 2QHKA 3PXPA 4MN5A 1JWVA 1LI9A 3HLCA 1ODVA 4WEKA 2P74A 1ONGA 1KVLA 2W3EA 1GHMA 3VFFA 3WRZA 2EX9A 1K55C 3LGOA 4JGPA 3ZG5A 4DDSA 5E2GA 3A3DA 4HJ4A 1NYYA 3V67A 5BOHA 4HJ3A 1YMSA 2LB9A 4P87A 5EM0A 1IYQA 1LL8A 1OT9A 2J3TC 3Q7ZA 4HH2A 4MN7A 5CGXA 5DF8A 3LFVA 3IWQA 1T19A 4IEDA 4RQ9A 5FA7A 1J9MA 2QPNA 1LLBA 1L0GA 3ITAA 4JGOA 1P97A 2P7JA 1D1JA 1RGYA 5EOEA 3OCLA 3F1PA 2XFSA 3G2ZA 3EEHA 4KG2A 4Q8IA 2WGIA 3V50A 1J3WA 3MXSA 4EESA 2ZQ7A 1YLZA 3IT9A 2BLSA 3UN7A 1NJ4A 3FZCA 4L9GA 4NXBA 4ID4A 4DKIA 3DWKA 2J3TD 4KZ8A 3G2YA 3ZNTA 4R4RA 4Y0OA 2V0UA 3UNWA 1FCNA 2M1CA 4R23A 3FPVA 5CXWA 5CGWA 4YOFA 3S7QA 4QY6A 1KGFA 2ZMVA 2J3WA 3FV7A 2Y2KA 2D01A 4O8GA 5EVIC 5AQ7A 3C7VA 4N92A 3CUEA 3T4OA 4WN5A 3HUMA 5E43A 1JVJA 4K0WA 5F6AA 4HQAA 4X1MA 3C38A 5A91A 2L4RA 3DW0A 1TDLA 3LR3A 5D3OA 4N9KA 4HIAA 1BZAA 1SDEA 5FEFA 4CLCE 2XD5A 2E8IA 4OONA 4JBFA 1SZVA 2WKPA 3EQUA 3QP4A 2P08A 3C8CA 3NI9A 1ZTUA 5EVID 2HJ9C 2VZWA 3UE1A 2WUQA 4OKPA 5FQJA 4B4XA 3Q07A 4OVDA 4RX2A 1Y28A 3CAXA 1C3BA 1NZOA 3B3XA 3VSKA 1OTAA 2VGLS 3BFDA 3UB7A 4ZJ3A 2H0TA 1BTLA 3C5AA 5J3WA 3A3FA 3IHAA 4ZAMA 2HP9A 3T1RA 2WKQA 3S7PA 3ICYA 2HP6A 3UO9A 3UDFA 3LIAA 2HGVA 2PD7A 5TGFA 2JCHA 1DJCA 3R7WB 1K55A 2J7VA 4OPYA 5AJGA 1YQSA 3S4XA 1FOFA 3LYXA 4X1LA 3PBNA 5KSCA 4OLDA 1FSWA 5HWWA 4XUXA 3QP5A 4YINA 1VEUA 3CG5A 3FG8A 4WL9A 1GA0A 3JVVA 4KZ3A 2IWCA 5GHXA 3HREA 2HDRA 5FSRA 1NZUA 3IF5A 5DJTA 4E3NA 3T50A 4E3OA 1FIKA 2Z2MB 1HZOA 1GCEA 2QWSA 3VMAA 2HZ5A 4RA7A 4Y7PA 5C5KA 3JYIA 5M1AA 4UQIS 3T4SA 2Y79A 1XX2A 5AQ9A 4XXRA 5JYOA 2JKRI 3MQOA 1XXMA 2W1TA 2EX6A 5HAPA 3B42A 4FD8A 2GNXA 3HLBA 3E4PA 4NKPA 5HPIA 2A24A 4Y15A 3PBOA 4MN6A 2NUPC 4PKYG 3T4JA 4OLGA 3LIFA 4Q0IA 1K6SA 3MS6A 3HJKA 3ZG0A 4EUVA 2WYXA 3MKEA 2PDRA 5EVIA 4JXVA 3T4TA 1F5MA 4KZ7A 1NY0A 1FSYA 3OPRA 4X25A 3DTMA 3G30A 1VB6A 3BQ8A 4E6WA 3SS3A 3E0YA 4JLFA 3GTCA 3NBLA 2BG1A 4X68A 1SCWA 1KOUA 2ZM0A 3IS2A 3SS5A 4WF0A 1PW1A 1XJ3A 2ZM8A 2V2FF 3QP2A 2J9PA 4IVKA 3GVBA 4LFUA 3SW1A 4BL3A 1KE4A 1KDWA 2WK0A 2VK3A 2H28A 1PFLA 2G7UA 2C6WB 3PAGA 1P0ZA 3A0SA 1W8YA 4X69A 3OPHA 2OSUA 2JE5A 1GHIA 1IKIA 4K08A 2IWDA 3ZVWA 4U0XA 1H5XA 5HDCA 2XQZA 4GHIB 4U0TA 5DTKA 3HLWA 4XT2A 5FQQA 5EOOA 1OTIA 3D4FA 4G3WA 1VEUB 3IH8A 2A2LA 3M2JA 2YKFA 4DRTA 4GDNA 3LCEA 3SH8A 5DF9A 3WS5A 3MMHA 3LI8A 3DWZA 4EBPA 5KIZA 2HPBA 1LSXA 2OWHA 4RX3A 1XA7A 4HJ6A 2HF6A 2K31A 5CGSA 2L0WA 1D06A 4D2OA 5DTSA 4IHQA 4LRYC 2VV6A 3U4LP 4AFIA 3B47A 3A0RA 2W1TB 2VKSA 4ZTKA 4ME4A 5M18A 3VP0A 3MJQA 1P9RA 3P7NA 2VGKA 4QB8A 1CEGA 3G31A 2A24B 3M6HA 1E3UA 3IBJA 5AQBA 1U60A 1GHPA 3HLGA 2P9VB 2J8YA 1PZOA 5IU1A 2WAEA 1XGJA 3MKFA 5KSHA 4PM9A 4PKYA 2VV8A 3BQAA 1W5DA 1IFQA 5EVIB 3ITBA 1V9YA 1ESIA 1L0FA 4DJ3A 4MBKA 3CHWP 2O99A 3NHQA 5J7EA 4C6YA 2EXBA 4WLAA 4UEYA 3IHBA 3F1OB 2FZ0A 4DE1A 4QWOA 4LCMA 1FR1A 3VE3A 1XPBA 1CK3A 4M3KA 5AQAA 1L0EA 3UDIA 4LRZE 4EV4A 3TRCA 4NETA 4OPQA 3ZG9B 1IEMA 1P9WA 1LL9A 4LRXC 5L8MA 3W4QA 1ES5A 3C4OA 3HUNA 2Y2IA 4WBGA 3RTYA 3IWIA 2J9OA 3IXDA 5IS1A 4CJNA 5EM1A 3KYZA 2KLIA 4RVAA 1F2KA 4LGWA 1JTDA 5IT5A 4HOIA 2FH5A 5FI6A 3G34A 4XT2B 3OCNA 3QP1A 3V5MA 4FUWA 1YM1A 1DRMA 1YLWA 1YLPA 4PM5A 3LI9A 3O3VA 2EA9A 4KQDA 3PHYA 1NWZA 3S7OA 2Y2JA 3CLOA 4NXFA 3VE4A 4OOLA 5CEDA 4EETB 3NOPC 3M6BA 2QKPA 3TSGA 4Z1WA 1SHVA 4Q0HA 1TS6A 2X01A 5HAIA 1CI8A 4IBXA 4OQIA 2O9AA 4S2PA 4ZJ1A 4HHDA 3E98A 1ALQA 3F1NB 2KDKA 1AXBA 5HW3A 4JF6A 4I5SA 2KOIA 3W2ZA 3MQQA 4C75A 1MBLA 2XDMA 1I2WA 5M19A 3EOIA 3G32A 4QJGA 1PI4A 4Y3IA 2HV1A 4PM6A 4P6ZM 1MC0A 2ZC7A 1KDSA 3MXRA 2PBDP 4RYEA 1TDGA 1M40A 3IXHA 1VHMA 1S6RA 1STZA 1QMFA 3LY4A 4KQRA 1N9NA 1KE3A 3C7UA 1HLUP 1EWZA 4B88A 4K0XA 3S1YA 3BFEA 3W4PA 2OOLA 2D02A 3R7WA 3LEQA 1MKIA 2B18A 2ZQ8A 5HWVA 3AGDA 1MKMA 1G6OA 2V1BA 2Y8HA 1ZKJA 5DFXA 1ONHA 2O9BA 1YSPA 3QNCA 3LICA 3A3JA 5GHZA 4UAAA 4S2JA 3L7HA 2Y59A 5EV0A 3HLDA 2NUTC 5A90A 3OBFA 3N6IA 3E2LA 3CZDA 3Q1FA 3H7WB 1JTGA 1OTDA 3UY6A 4L9FA 5A8BA 1YAXA 4GCZA 4M4XA 2YKHA 2JKTM 3TE8A 3KYQA 3C30A 3ZNYA 2OAP1 2PYRA 4KENB 3ZG7B 3QP6A 1WYCA 3QHYA 1H8YA 3B33A 5FATA 1PWDA 5EVEA 3ZDJA 3HLFA 5FASA 2V20A 4G3KA 4DXCA 4NK3A 4OOMA 1E4DA 1SKOA 3MZDA 3AGFA 4WUJA 4H6JA 4FOFA 4KG5A 3S22A 1VQQA 1PYYA 1NLYA 4JKTA 2Q0OA 3H82A 2XK1A 4BBTA 1OTEA 3PAEA 1V9ZA 1MPLA 4P0MA 2IWBA 2KX6A 2V1AA 1WE4A 3TOIA 3BY9A 3KO6A 1RP5A 3BFFA 4HP4A 2WAFA 4QPRA 2DRWA 1NXYA 5TBMB 3MXQA 2DNSA 3LY3A 4MCWA 5FDSA 4KZ6A 2Y2MA 4R6LA 2Z2LB 1BYWA 1DJAA 4OQ0A 3ZQ5A 3HBRA 3UMEA 2V0WA 4IUKA 5EE8A 4R3JA 5HPFA 3C2WA 3CMZA 4QU3A 4ESPA 2FFFB 2QZ6A 3T1QB 4HBUA 4X56A 3UE0A 1T1AA 3BJNA 4GD6A 1Z09A 1K56D 5L2FA 4GHIA 1D7EA 5F1FA 2LB5A 4KUOA 3R4KA 3OLOA 3SH9A 1G28A 3Q7VB 4S2NC 4EXOA 3VOLA 3K3CA 2W3GA 3DTKA 4EQ1A 5HSQA 1UWPX 2EX2A 1LL5A 4P85A 5HAQA 5CTMA 5FAQA 3VOYA 4OPZA 5TFQA 4XUZA 2JKRM 2R78A 1YSQA 4ARZB 4EEPA 2QJ7A 3UB9A 1BLPA 1PI5A 1H3QA 1AWIA 1K25A 2DCFA 4FTXA 2WZZA 5DVAA 2M7VA 1N4OA 4II7A 1L2SA 2ZC4B 4DJ2A 2OLUA 1JWZA 1YLYA 4MEZA 3HCYA 2GJ3A 3IF6B 1ZG6A 5HDSA 4JXGA 5IHVA 2Y2OA 1LSWA 4Y0UA 3RJUA 3GMWA 4JF5A 1G6AA 4LV3A 4UHUA 2C5WB 1MWSA 2ZL1B 4GNUA 3FC7A 1SKOB 3OOVA 2QMIA 2P9VA 4H6JB 3BLSA 1GSWA 3D9YA 4QD4A 4HI4A 1G5UA 5A93A 3H82B 4LV0A 3UE3A 3UB8A 2WGVA 4PPRA 3CITA 4GS9B 3HUOA 1LI0A 2WKEA 4ETZA 2W3HA 3DAVA 3RH8B 3F1OA 1YT4A 2HJEA 3GSGA 4F3LB 5EPHA 2XFTA 3ISGA 3QP8A 4UA7A 5FQMA 5CHMA 4JGQA 4D60A 5FDHA 3U2AA 5MC7A 5E2HA 3GR2A 3G35A 3HL9A 1F9IA 3P09A 4GB7A 1PZPA 1BSGA 4CLCC 2H10A 2XLNA 5HL6A 4EBNA 5U47A 1EW0A 5F1GA 5G4YA 2VA0A 2JKFA 1LHYA 3BFCA 3H9WA 4YFMA 5CRFA 3T4QA 1MWTA 4S2IA 4DDYA 4E3LA 2WGWB 3MF0A 2Y2HA 1S66L 1JNUA 4KQOA 2VLGA 4MBFA 3VSLA 5FQIA 3VOZA 3A0VA 2K7SA 3RXWA 3UPNA 3FYZA 4CLCD 4EQIA 5F82A 2VV7A 3O88A 5AVFA 2INWA 1HTZA 4LCLA 3LO7A 3RXXA 2GDNA 2G2WA 3GDIA 3LR5A 3QNBA 4MDZA 1VM1A 4S2NA 4JF4A 2RCXA 5FL3A 3F1NA 1K4EA 2CMNA 3VP3A 4BD1A 1NRFA 1FILA 2FFYA 1S67L 1O7EA 4X6TA 1MWRA 3IX8A 4JPMA 2OLVA 3VV4A 1FCMA 5GHYA 4ZJ2A 4R70A 2ZC6B 3VP1A 1ESUA 2V1ZA 3K2NA 4I3JA 4NXGA 3NJAA 5A92A 2XROA 5FAOA 4E3MA 3T1SA 3L9KA 3Q82A 5E2FA 4WMCD 2JC7A 4P6BA 4MLLA 3N8RA 4R3AA 3IXBA 3ULFA 3C4PA 1FQGA 1WA9A 4Z9QA 2CC1A 3TJZC 1S4SA 3PTEA 2JBFA 3NY4A 4BENA 5GL9A 3PBTA 3NC8A 3SOIA 3LR0A 2Q9NA 1IKGA 4GZBA 4KG6A 2ZJ9A 2XA7M 1M6KA 3IF6C 3IQAA 3JVUA 4E3JA 3UE6A 2IA2A 1JWPA 4GN2A 2HDQA 3H7WA 1FCOA 4WEJA 5DKLA 2GZAA 3KSHA 4EBLA 3WRTA 3CWFA 2W3FA 4WZ5C 2ZMFA 1IOUA 2Q9MA 4GD8A 1K38A 2PD8A 3MSHA 2QYBA 4UA6A 2UV0E 1ERMA 2OAQ1 3MR0A 5GLBA 4EW7A 4CLCA 2WKHA 4N1HA 4BD0A 4MBHA 5EECA 1EI5A 1XFQA 2XSSA 4DE3A 4K91A 3BW6A 2XD1A 1K0KA 4HEFA 4GDBA 3BFGA 1L0DA 2W1RA 1TF1A 3NOUC 4MMNA 2Z6DA 3PR6A 3A3EA 5HD3A 4Q0JA 1BULA 1PWGA 1WYBA 2M7UA 4KUKA 1T1CA 5HZHA 4DE0A 4EUZA 1S1YA 4BBVA 5GLAA 4IUHA 3EEAA 4KZ9A 5TBMA 2ZQDA 1OMEA 1TEMA 1IYSA 1YLTA 2PHYA 1YKDA 5CEBA 1H8ZA 3NOTC 3CI6A 2W0NA 3MZFA 4BJPA 3BY8A 1QMEA 1ZG4A 4WMCA 4R4SA 4NEED 1ES4A 2V8CA 2PAVP 1XKZA 5JYPA 3UPOA 4HY8A 1K6RA 2XEPA 2ZC3B 5DF7A 2ACGA 3PBQA 2ZQ9A 2L1MA 2V9AA 4S2OA 4KZ4A 3PBRA 5EFWA 3MZEA 1IYOA 4GKUA 4HESA 1H0MA 4S2LA 4KZAA 5DKKA 2O9CA 3WWXA 1LSVA 3Q7VA 3LUQA 4Y2FA 3E2KA 3PYPA 4I3IA 1SKFA 5HARA 4OP8A 2PR5A 3N8SA 1MXOA 4B9OA 2EWWA 2XH9A 4WELA 3NCKA 4WZ4A 1SDNA 2Y2PA 2QJ5A 4I3AA 1NLZA 2ZOHA 2ZQAA 5EVLA 5HL1A 3EQVA 4ARZA 1N9LA 2I72A 3ZGAB 5DTTA 4CQHA 3BLMA 3IBRA 5DJUA 1PIOA 1NYMA 1S1ZA 1K4FA 1Z6FA 5CHJA 4P6ZS 4E3IA 2G2UA 3M2KA 3O87A 3IF6A 3BEBA 2VGLM 1G68A 3GV9A 4CLCB 3N8LA 2ZLYA 2MJ6A 2UWXA 3G4PA 1KGGA 3EWKA 5LBRA 1ACFA 1XJ4A 2ZL1A 4WZ5A 3BRMA 3BWLA 1MY8A 3UDXA 4OQHA 4I39A 2Y2QA 1S4RA 2B5RA 3LIDA 2WADA 2JKTI 4NG2A 3UMDA 3ZG8B 3V3SA 3S7NA 2PYPA 2PR6A 4H8RA 5GLDA 3T4LA 2Y2GA 4GS9A 3VFHA 4E3KA 3E4QA 4HNBA 4FCFA 4S2KA 3WS2A 1Q2PA 2Y2LA 5HWTA 1VETB 1XGIA 4L0LA 2HDUA 3HJIA 4R38A 1CJFA 4F3LA 4HH3A 4LV1A 3I7JA 1N9BA 2XF3A 4B93A 5FAPA 1TVFA 2J80A 3FWLA 2X02A 3IWOA 3K3DA 1ERQA 4E04A 5CERA 5I5LA 5FI2A 2DMWA 1K54C 4MNRA 4QY5A 3SZTA 1MWUA 4UQIM 3MQ0A 1I2SA 2JN7A 3D3OA 1GSXA 4IBRA 3T4KA 3MBZA 1RCJA 2HP5A 1YMXA 2P04A 5HFOA 3KSGA 5F83A 4BBUA 3ZYTA 3FKWA 4Y13A 4GW9A 3BM6A 3CPTA 1PRQA 4JXWA 2XRNA 3OZHA 4DMZA 2RL3A 2WGWA 2PU4A 3D72A 3N7WA 4FH2A 1KGEA 4LV2A 4O7DA 2R9WA 1E25A 2HDSA 4EEUA 1YLJA 3MFDA 1ES3A 1DJBA 4UA9A 3KYEA 4NXEA 1RGZA 3VP2A 2EFXA 2EXAA 3F1PB 1PWCA 2JKGA 3SH7A 3IX4A 1NRJA 3BYDA 1GSVA 4GOGA 4I38A 5FQ9A 4PAUA 4QHCA 2X71A 4PM8A 3W8KA 1BUEA 2VEAA 1OPXA 4O0PA 2E8JA 1BLSA 2K2NA 1BLCA 1XP4A 3NDEA 2ZMAA 2B02A 4S2MA 5J8XA 4PM7A 4Y0TA 3V3RA 4ZRRA 4O01A 2R9XA 1UWNX 1H8MA 1KE0A 4PMAA 4U3TA 5EUAA 5J4EA 5L09A 4WM9A 5FI7A 5F5YA 5CX7A 1T1BA 3KX0X 2V8FA 4LLOB 1EROA 2VGJA 4BWIA 1CF0A 2BTFP 1O07A 4KZ5A 1BLHA 4OP5A 4ZBEA 3ZFZA 3LR4A 3G6OA 2I9VA 1OTBA 1E3UD 1IYPA 1K57C 4Y17A 4GJ4A 2H5SA 2H0YA 4N9LA 4DXBA 1PNEA 1OJGA 3LIEA 2PT7A 3FKVA 5G18A 5K5BA 1TD5A 1OJ5A 1I5QA 1DY6A 1BT5A 3HVFA 5F68A 1K56A 1XJ2A 3ZCZA 5HX9A 4JGRA 3NDGA 1CEFA 4X55A 3V39A 1W8QA 5CTNA 4YWZA 1T18A 4EWFA 1S0WA 5CECA 3GQZA 3WS0A 4R1GA 5HDDA 3O5YA 1XFNA 3VP4A 2PBYA 3Q81A 2ZC5B 3CPTB 1K54A 1TS0A 3T12B 3DBAA 1DP8A 3EGXC 3IH9A 3NIAA 3MFXA 3FPWA 4OPRA 3OPLA 5L07A 3TW8A 4R3BA 1GA9A 4R0QA 3P98A 2JHEA 1X0OA 4HBTA 3OPPA 5E2EA 2B95A 2EFUA 2W27A 1UGUA 1DP9A 3KSFA 4IJGA 2XR0A 3LEZA 1OT6A 2AVXA 3PBSA 1HVBA 2A49A 2Y91A 1Y54A 5DFYA 1ZHHB 2ZBBA 3AGEA 1IELA 3E4OA 1Q2QA 4HP9A 3BECA 3P01A 2Z6CA 1XJ6A 2ZM2A 4N1XA 1TS7A 3NECA 1YPRA 3CJMA 3KSIA 3WS4A 4DE2A 5TR7A 1Y4OA 3A3IA 1ES2A 2OWJA 2ZOIA 5I94A 4WYYA 2O0YA 5L10A 4OQGA 3GECA 5GLCA 5TJJA 2XGNA 4LPZA 3UB6A 1W63Q 1PW8A 4KZBA
chains in the Genus database with same CATH topology
2EX8A 1DJAA 4OH0A 4OQ0A 3HBRA 3SS3A 3TG9A 4E6WA 4S2OA 1W7FA 4JLFA 4KZ4A 1CI9A 3PBRA 4BL2A 3MZEA 3GTCA 1FR6A 3NBLA 4JXSA 4BLMA 2BG1A 4X68A 1SCWA 5EE8A 1IYOA 2ZM0A 4FSFA 4R3JA 4GKUA 3SS5A 4HESA 3CMZA 4QU3A 3WS1A 4S2LA 4KZAA 2WKIA 2Y4AA 3ZHHA 3WWXA 1PW1A 2FFFB 2ZM8A 2V2FF 2QZ6A 4HBUA 4LENA 4X56A 3Q7VA 2J9PA 5FQKA 3E2KA 3UE0A 4IVKA 4X53A 1SKFA 3GVBA 1KVMA 1W79A 4OP8A 5HARA 4GD6A 3N8SA 1MXOA 4BL3A 1KE4A 2Y2NA 1K56D 1KDWA 5L2FA 2XH9A 4WELA 3NCKA 4WZ4A 1K57A 1SDNA 2WK0A 2Y2PA 3UPPA 5F1FA 3O86A 3ZVTA 3OC2A 4IVIA 2ZQAA 2ZD8A 5EVLA 3SH9A 2WZXA 4F94A 1HD8A 2C6WB 3Q7VB 3PAGA 4S2NC 5HL1A 3EQVA 5KMWA 4E6XA 2I72A 1W8YA 4X69A 3ZGAB 3OPHA 2OSUA 2JE5A 2PU2A 5DTTA 1GHIA 3BLMA 1IKIA 2IWDA 3IXGA 3ZVWA 4U0XA 1H5XA 1PIOA 1NYMA 2EX2A 2XQZA 1LL5A 4U0TA 5DTKA 4P85A 4CPKA 5HAQA 3HLWA 5CTMA 1K4FA 1Z6FA 5CHJA 5FAQA 3VOYA 5FQQA 4E3IA 4OPZA 5TFQA 4XUZA 5EOOA 3D4FA 2G2UA 3IH8A 3M2KA 4OOYA 2OV5A 3M2JA 3IF6A 3O87A 4KQQA 2A3UA 3BEBA 4DRTA 1BLPA 1PI5A 4GDNA 1G68A 3GRJA 3GV9A 3LCEA 3N8LA 1K25A 2DCFA 5DF9A 3SH8A 3N4IA 3WS5A 2WZZA 2ZLYA 2UWXA 5DVAA 3G4PA 1KGGA 3DWZA 1ZC2A 4EBPA 1N4OA 2HPBA 4RX3A 1L2SA 3HLEA 2ZC4B 1XA7A 4WZ5A 2OLUA 3BRMA 4A5RA 1MY8A 3UDXA 5CGSA 1JWZA 1YLYA 4MEZA 5KZHA 3IF6B 1ZG6A 4OQHA 2Y2QA 4D2OA 4C3QA 5DTSA 4JXGA 5IHVA 2B5RA 2Y2OA 4Y0UA 2WADA 3RJUA 3ZG8B 4BQMA 3GMWA 4JF5A 3V3SA 3W4OA 1G6AA 1XA1A 2ZQCA 4LV3A 4H8RA 4UHUA 2C5WB 1MWSA 4ZTKA 5GLDA 2Y2GA 5M18A 4GNUA 4ZDXA 3SS4A 4FH4A 3VP0A 2QMIA 2P9VA 3VFHA 2Y55A 4E3KA 4B4ZA 5CHUA 3BLSA 4QD4A 4DF6A 2VGKA 4FCFA 4QB8A 4S2KA 3WS2A 1CEGA 3G31A 1JWVA 3M6HA 1E3UA 1LI9A 3HLCA 4WEKA 5A93A 1Q2PA 2Y2LA 5AQBA 2P74A 1U60A 1GHPA 1ONGA 1XGIA 3HLGA 2HDUA 4L0LA 4LV0A 3UE3A 1KVLA 2WGVA 4PPRA 4LV1A 2P9VB 1GHMA 3VFFA 2J8YA 3I7JA 1PZOA 1N9BA 3HUOA 2XF3A 2WAEA 1XGJA 3WRZA 5FAPA 3MKFA 1TVFA 1LI0A 5KSHA 4PM9A 3FWLA 2EX9A 1K55C 2X02A 3IWOA 1ERQA 1W5DA 2WKEA 5EVIB 5CERA 3ITBA 3ZG5A 4DDSA 5FI2A 5E2GA 1K54C 3A3DA 4MNRA 4QY5A 1YT4A 1ESIA 1NYYA 3GSGA 1MWUA 5BOHA 1L0FA 1I2SA 5EPHA 2XFTA 3ISGA 5FQMA 4UA7A 1YMSA 4IBRA 5CHMA 3MBZA 4MBKA 1RCJA 2HP5A 5FDHA 1YMXA 4P87A 5HFOA 1IYQA 4C6YA 5F83A 2EXBA 5E2HA 3GR2A 3G35A 3HL9A 4GB7A 3P09A 3Q7ZA 1PZPA 3IHBA 1BSGA 5CGXA 2H10A 3FKWA 5DF8A 2XLNA 4DE1A 4LCMA 1FR1A 3IWQA 1XPBA 3BM6A 4IEDA 4EBNA 1CK3A 4M3KA 5AQAA 5U47A 5FA7A 1J9MA 4JXWA 3OZHA 1L0EA 2RL3A 2QPNA 2WGWA 5F1GA 1LLBA 1L0GA 1LHYA 3ITAA 3UDIA 2PU4A 4EV4A 1RGYA 4NETA 3N7WA 4FH2A 3BFCA 4OPQA 5EOEA 4YFMA 3ZG9B 3OCLA 1IEMA 5CRFA 2XFSA 3G2ZA 1MWTA 1LL9A 1KGEA 4LV2A 4O7DA 4S2IA 4KG2A 4DDYA 4E3LA 2WGIA 4Q8IA 3V50A 3MXSA 1ES5A 2R9WA 3C4OA 1E25A 3W4QA 2HDSA 2WGWB 3HUNA 2Y2HA 1YLJA 2ZQ7A 3MFDA 1ES3A 1DJBA 1YLZA 2Y2IA 2BLSA 3IT9A 4WBGA 4UA9A 3IWIA 4KQOA 3UN7A 1NJ4A 2J9OA 1RGZA 3FZCA 3VP2A 3IXDA 2EFXA 4MBFA 3VSLA 4ID4A 4DKIA 2EXAA 4CJNA 1PWCA 3SH7A 3DWKA 5FQIA 4RVAA 3VOZA 3BYDA 4KZ8A 1JTDA 4GOGA 5FQ9A 3G2YA 3RXWA 3UPNA 3ZNTA 3FYZA 4EQIA 4R4RA 5FI6A 4QHCA 4Y0OA 3UNWA 3G34A 5F82A 1FCNA 3O88A 4R23A 3OCNA 5CXWA 2X71A 5CGWA 4PM8A 3W8KA 1BUEA 1HTZA 4LCLA 3LO7A 3RXXA 2GDNA 3V5MA 4QY6A 1BLSA 1YM1A 2G2WA 1KGFA 3FV7A 3QNBA 1YLWA 2Y2KA 1YLPA 4PM5A 1VM1A 1BLCA 3O3VA 4S2NA 5EVIC 1XP4A 5AQ7A 3C7VA 3NDEA 2ZMAA 4JF4A 2RCXA 4N92A 4S2MA 5J8XA 4PM7A 2Y2JA 4Y0TA 3V3RA 4OOLA 3HUMA 5E43A 5CEDA 1JVJA 1K4EA 4K0WA 2R9XA 3VP3A 5A91A 3M6BA 1NRFA 4BD1A 1KE0A 3TSGA 4PMAA 1SHVA 2FFYA 4U3TA 5EUAA 1O7EA 4WM9A 3DW0A 2X01A 1TDLA 1MWRA 4X6TA 5D3OA 5FI7A 5HAIA 4N9KA 1CI8A 4IBXA 4JPMA 2OLVA 4OQIA 1FCMA 1EROA 4S2PA 4ZJ1A 2VGJA 1BZAA 1SDEA 5GHYA 1ALQA 4ZJ2A 1O07A 4KZ5A 1AXBA 2ZC6B 3VP1A 5HW3A 1BLHA 1ESUA 4JF6A 2XD5A 4C75A 2V1ZA 1MBLA 2XDMA 1I2WA 5M19A 2E8IA 4OP5A 4OONA 3G32A 4JBFA 1PI4A 4QJGA 4ZBEA 3ZFZA 4PM6A 3EQUA 2ZC7A 5A92A 1KDSA 3MXRA 4RYEA 5FAOA 3NI9A 4E3MA 1TDGA 1M40A 1E3UD 3IXHA 3Q82A 5EVID 5E2FA 4WMCD 1IYPA 2JC7A 4P6BA 1S6RA 1K57C 4MLLA 3N8RA 1QMFA 3UE1A 3LY4A 4KQRA 2WUQA 4OKPA 5FQJA 4B4XA 1KE3A 3C7UA 3Q07A 3IXBA 2H5SA 2H0YA 3C4PA 4N9LA 4OVDA 1FQGA 4DXBA 4RX2A 1C3BA 1NZOA 1EWZA 3B3XA 3VSKA 4B88A 4Z9QA 4K0XA 2CC1A 3BFDA 3S1YA 3PTEA 3BFEA 2JBFA 4ZJ3A 2H0TA 3FKVA 5G18A 3NY4A 4BENA 1BTLA 3C5AA 5GL9A 3PBTA 3W4PA 3A3FA 3IHAA 4ZAMA 1MKIA 2ZQ8A 3NC8A 1I5QA 3SOIA 2HP9A 1DY6A 2Q9NA 1BT5A 3AGDA 3HVFA 1K56A 1IKGA 2HP6A 3UO9A 3UDFA 3ZCZA 4GZBA 4KG6A 1ZKJA 5HX9A 2ZJ9A 3NDGA 1M6KA 1CEFA 1ONHA 3IF6C 3IQAA 4X55A 1W8QA 5CTNA 5TGFA 3V39A 4E3JA 4EWFA 1JWPA 2JCHA 4GN2A 1DJCA 1S0WA 2HDQA 3GQZA 3QNCA 3WS0A 4R1GA 5CECA 1FCOA 1K55A 2J7VA 4OPYA 3A3JA 5GHZA 4WEJA 1YQSA 4UAAA 3VP4A 4S2JA 3S4XA 1FOFA 2PBYA 3Q81A 2ZC5B 1K54A 2Y59A 3PBNA 3WRTA 4EBLA 3HLDA 4OLDA 1FSWA 4WZ5C 5KSCA 3NIAA 3IH9A 5A90A 4XUXA 3N6IA 4YINA 3E2LA 2Q9MA 4GD8A 3OPLA 4OPRA 1K38A 3CZDA 3Q1FA 4R3BA 1JTGA 4UA6A 3CG5A 1GA9A 1GA0A 4KZ3A 1ERMA 4R0QA 2IWCA 3P98A 3UY6A 4HBTA 5GHXA 3HREA 5GLBA 2HDRA 3OPPA 5FSRA 2WKHA 4N1HA 5E2EA 1NZUA 3IF5A 4BD0A 4E3NA 4E3OA 2Z2MB 2EFUA 4MBHA 5EECA 1HZOA 1EI5A 1GCEA 3ZNYA 4DE3A 4K91A 4KENB 2XD1A 4HEFA 4GDBA 3VMAA 3BFGA 4RA7A 4Y7PA 3ZG7B 3JYIA 1WYCA 5M1AA 3QHYA 1H8YA 1L0DA 5FATA 1XX2A 1PWDA 3ZDJA 5AQ9A 3HLFA 4XXRA 3A3EA 2XR0A 5JYOA 5FASA 3LEZA 2V20A 4DXCA 4NK3A 4OOMA 1XXMA 2EX6A 3PBSA 1E4DA 5HAPA 1HVBA 2A49A 2Y91A 4FD8A 1Y54A 3AGFA 1BULA 3MZDA 1PWGA 3HLBA 3AGEA 1IELA 1WYBA 4KG5A 4DE0A 4EUZA 1Q2QA 3S22A 3BECA 1VQQA 1PYYA 4JKTA 5GLAA 3PBOA 2ZM2A 4KZ9A 2ZQDA 2XK1A 1OMEA 1TEMA 4N1XA 4OLGA 1IYSA 1YLTA 1K6SA 3PAEA 1MPLA 4P0MA 2IWBA 3CJMA 3WS4A 5CEBA 3ZG0A 4DE2A 1WE4A 2WYXA 1H8ZA 3MKEA 5TR7A 3TOIA 3MZFA 3A3IA 4BJPA 1RP5A 3BFFA 1QMEA 1ZG4A 1ES2A 4R4SA 4WMCA 4JXVA 5EVIA 2WAFA 1ES4A 5I94A 2DRWA 4WYYA 1NXYA 2DNSA 3LY3A 4OQGA 1XKZA 5GLCA 4KZ7A 4KZ6A 2XGNA 5JYPA 3UPOA 1NY0A 1FSYA 1K6RA 2XEPA 2ZC3B 5DF7A 3OPRA 2Y2MA 3DTMA 1PW8A 2Z2LB 4KZBA 3PBQA 3G30A 2ZQ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EX8 A;  1DJA A;  4OH0 A;  4OQ0 A;  3HBR A;  3SS3 A;  3TG9 A;  4E6W A;  4S2O A;  1W7F A;  4JLF A;  4KZ4 A;  1CI9 A;  3PBR A;  4BL2 A;  3MZE A;  3GTC A;  1FR6 A;  3NBL A;  4JXS A;  4BLM A;  2BG1 A;  4X68 A;  1SCW A;  5EE8 A;  1IYO A;  2ZM0 A;  4FSF A;  4R3J A;  4GKU A;  3SS5 A;  4HES A;  3CMZ A;  4QU3 A;  3WS1 A;  4S2L A;  4KZA A;  2WKI A;  2Y4A A;  3ZHH A;  3WWX A;  1PW1 A;  2FFF B;  2ZM8 A;  2V2F F;  2QZ6 A;  4HBU A;  4LEN A;  4X56 A;  3Q7V A;  2J9P A;  5FQK A;  3E2K A;  3UE0 A;  4IVK A;  4X53 A;  1SKF A;  3GVB A;  1KVM A;  1W79 A;  4OP8 A;  5HAR A;  4GD6 A;  3N8S A;  1MXO A;  4BL3 A;  1KE4 A;  2Y2N A;  1K56 D;  1KDW A;  5L2F A;  2XH9 A;  4WEL A;  3NCK A;  4WZ4 A;  1K57 A;  1SDN A;  2WK0 A;  2Y2P A;  3UPP A;  5F1F A;  3O86 A;  3ZVT A;  3OC2 A;  4IVI A;  2ZQA A;  2ZD8 A;  5EVL A;  3SH9 A;  2WZX A;  4F94 A;  1HD8 A;  2C6W B;  3Q7V B;  3PAG A;  4S2N C;  5HL1 A;  3EQV A;  5KMW A;  4E6X A;  2I72 A;  1W8Y A;  4X69 A;  3ZGA B;  3OPH A;  2OSU A;  2JE5 A;  2PU2 A;  5DTT A;  1GHI A;  3BLM A;  1IKI A;  2IWD A;  3IXG A;  3ZVW A;  4U0X A;  1H5X A;  1PIO A;  1NYM A;  2EX2 A;  2XQZ A;  1LL5 A;  4U0T A;  5DTK A;  4P85 A;  4CPK A;  5HAQ A;  3HLW A;  5CTM A;  1K4F A;  1Z6F A;  5CHJ A;  5FAQ A;  3VOY A;  5FQQ A;  4E3I A;  4OPZ A;  5TFQ A;  4XUZ A;  5EOO A;  3D4F A;  2G2U A;  3IH8 A;  3M2K A;  4OOY A;  2OV5 A;  3M2J A;  3IF6 A;  3O87 A;  4KQQ A;  2A3U A;  3BEB A;  4DRT A;  1BLP A;  1PI5 A;  4GDN A;  1G68 A;  3GRJ A;  3GV9 A;  3LCE A;  3N8L A;  1K25 A;  2DCF A;  5DF9 A;  3SH8 A;  3N4I A;  3WS5 A;  2WZZ A;  2ZLY A;  2UWX A;  5DVA A;  3G4P A;  1KGG A;  3DWZ A;  1ZC2 A;  4EBP A;  1N4O A;  2HPB A;  4RX3 A;  1L2S A;  3HLE A;  2ZC4 B;  1XA7 A;  4WZ5 A;  2OLU A;  3BRM A;  4A5R A;  1MY8 A;  3UDX A;  5CGS A;  1JWZ A;  1YLY A;  4MEZ A;  5KZH A;  3IF6 B;  1ZG6 A;  4OQH A;  2Y2Q A;  4D2O A;  4C3Q A;  5DTS A;  4JXG A;  5IHV A;  2B5R A;  2Y2O A;  4Y0U A;  2WAD A;  3RJU A;  3ZG8 B;  4BQM A;  3GMW A;  4JF5 A;  3V3S A;  3W4O A;  1G6A A;  1XA1 A;  2ZQC A;  4LV3 A;  4H8R A;  4UHU A;  2C5W B;  1MWS A;  4ZTK A;  5GLD A;  2Y2G A;  5M18 A;  4GNU A;  4ZDX A;  3SS4 A;  4FH4 A;  3VP0 A;  2QMI A;  2P9V A;  3VFH A;  2Y55 A;  4E3K A;  4B4Z A;  5CHU A;  3BLS A;  4QD4 A;  4DF6 A;  2VGK A;  4FCF A;  4QB8 A;  4S2K A;  3WS2 A;  1CEG A;  3G31 A;  1JWV A;  3M6H A;  1E3U A;  1LI9 A;  3HLC A;  4WEK A;  5A93 A;  1Q2P A;  2Y2L A;  5AQB A;  2P74 A;  1U60 A;  1GHP A;  1ONG A;  1XGI A;  3HLG A;  2HDU A;  4L0L A;  4LV0 A;  3UE3 A;  1KVL A;  2WGV A;  4PPR A;  4LV1 A;  2P9V B;  1GHM A;  3VFF A;  2J8Y A;  3I7J A;  1PZO A;  1N9B A;  3HUO A;  2XF3 A;  2WAE A;  1XGJ A;  3WRZ A;  5FAP A;  3MKF A;  1TVF A;  1LI0 A;  5KSH A;  4PM9 A;  3FWL A;  2EX9 A;  1K55 C;  2X02 A;  3IWO A;  1ERQ A;  1W5D A;  2WKE A;  5EVI B;  5CER A;  3ITB A;  3ZG5 A;  4DDS A;  5FI2 A;  5E2G A;  1K54 C;  3A3D A;  4MNR A;  4QY5 A;  1YT4 A;  1ESI A;  1NYY A;  3GSG A;  1MWU A;  5BOH A;  1L0F A;  1I2S A;  5EPH A;  2XFT A;  3ISG A;  5FQM A;  4UA7 A;  1YMS A;  4IBR A;  5CHM A;  3MBZ A;  4MBK A;  1RCJ A;  2HP5 A;  5FDH A;  1YMX A;  4P87 A;  5HFO A;  1IYQ A;  4C6Y A;  5F83 A;  2EXB A;  5E2H A;  3GR2 A;  3G35 A;  3HL9 A;  4GB7 A;  3P09 A;  3Q7Z A;  1PZP A;  3IHB A;  1BSG A;  5CGX A;  2H10 A;  3FKW A;  5DF8 A;  2XLN A;  4DE1 A;  4LCM A;  1FR1 A;  3IWQ A;  1XPB A;  3BM6 A;  4IED A;  4EBN A;  1CK3 A;  4M3K A;  5AQA A;  5U47 A;  5FA7 A;  1J9M A;  4JXW A;  3OZH A;  1L0E A;  2RL3 A;  2QPN A;  2WGW A;  5F1G A;  1LLB A;  1L0G A;  1LHY A;  3ITA A;  3UDI A;  2PU4 A;  4EV4 A;  1RGY A;  4NET A;  3N7W A;  4FH2 A;  3BFC A;  4OPQ A;  5EOE A;  4YFM A;  3ZG9 B;  3OCL A;  1IEM A;  5CRF A;  2XFS A;  3G2Z A;  1MWT A;  1LL9 A;  1KGE A;  4LV2 A;  4O7D A;  4S2I A;  4KG2 A;  4DDY A;  4E3L A;  2WGI A;  4Q8I A;  3V50 A;  3MXS A;  1ES5 A;  2R9W A;  3C4O A;  1E25 A;  3W4Q A;  2HDS A;  2WGW B;  3HUN A;  2Y2H A;  1YLJ A;  2ZQ7 A;  3MFD A;  1ES3 A;  1DJB A;  1YLZ A;  2Y2I A;  2BLS A;  3IT9 A;  4WBG A;  4UA9 A;  3IWI A;  4KQO A;  3UN7 A;  1NJ4 A;  2J9O A;  1RGZ A;  3FZC A;  3VP2 A;  3IXD A;  2EFX A;  4MBF A;  3VSL A;  4ID4 A;  4DKI A;  2EXA A;  4CJN A;  1PWC A;  3SH7 A;  3DWK A;  5FQI A;  4RVA A;  3VOZ A;  3BYD A;  4KZ8 A;  1JTD A;  4GOG A;  5FQ9 A;  3G2Y A;  3RXW A;  3UPN A;  3ZNT A;  3FYZ A;  4EQI A;  4R4R A;  5FI6 A;  4QHC A;  4Y0O A;  3UNW A;  3G34 A;  5F82 A;  1FCN A;  3O88 A;  4R23 A;  3OCN A;  5CXW A;  2X71 A;  5CGW A;  4PM8 A;  3W8K A;  1BUE A;  1HTZ A;  4LCL A;  3LO7 A;  3RXX A;  2GDN A;  3V5M A;  4QY6 A;  1BLS A;  1YM1 A;  2G2W A;  1KGF A;  3FV7 A;  3QNB A;  1YLW A;  2Y2K A;  1YLP A;  4PM5 A;  1VM1 A;  1BLC A;  3O3V A;  4S2N A;  5EVI C;  1XP4 A;  5AQ7 A;  3C7V A;  3NDE A;  2ZMA A;  4JF4 A;  2RCX A;  4N92 A;  4S2M A;  5J8X A;  4PM7 A;  2Y2J A;  4Y0T A;  3V3R A;  4OOL A;  3HUM A;  5E43 A;  5CED A;  1JVJ A;  1K4E A;  4K0W A;  2R9X A;  3VP3 A;  5A91 A;  3M6B A;  1NRF A;  4BD1 A;  1KE0 A;  3TSG A;  4PMA A;  1SHV A;  2FFY A;  4U3T A;  5EUA A;  1O7E A;  4WM9 A;  3DW0 A;  2X01 A;  1TDL A;  1MWR A;  4X6T A;  5D3O A;  5FI7 A;  5HAI A;  4N9K A;  1CI8 A;  4IBX A;  4JPM A;  2OLV A;  4OQI A;  1FCM A;  1ERO A;  4S2P A;  4ZJ1 A;  2VGJ A;  1BZA A;  1SDE A;  5GHY A;  1ALQ A;  4ZJ2 A;  1O07 A;  4KZ5 A;  1AXB A;  2ZC6 B;  3VP1 A;  5HW3 A;  1BLH A;  1ESU A;  4JF6 A;  2XD5 A;  4C75 A;  2V1Z A;  1MBL A;  2XDM A;  1I2W A;  5M19 A;  2E8I A;  4OP5 A;  4OON A;  3G32 A;  4JBF A;  1PI4 A;  4QJG A;  4ZBE A;  3ZFZ A;  4PM6 A;  3EQU A;  2ZC7 A;  5A92 A;  1KDS A;  3MXR A;  4RYE A;  5FAO A;  3NI9 A;  4E3M A;  1TDG A;  1M40 A;  1E3U D;  3IXH A;  3Q82 A;  5EVI D;  5E2F A;  4WMC D;  1IYP A;  2JC7 A;  4P6B A;  1S6R A;  1K57 C;  4MLL A;  3N8R A;  1QMF A;  3UE1 A;  3LY4 A;  4KQR A;  2WUQ A;  4OKP A;  5FQJ A;  4B4X A;  1KE3 A;  3C7U A;  3Q07 A;  3IXB A;  2H5S A;  2H0Y A;  3C4P A;  4N9L A;  4OVD A;  1FQG A;  4DXB A;  4RX2 A;  1C3B A;  1NZO A;  1EWZ A;  3B3X A;  3VSK A;  4B88 A;  4Z9Q A;  4K0X A;  2CC1 A;  3BFD A;  3S1Y A;  3PTE A;  3BFE A;  2JBF A;  4ZJ3 A;  2H0T A;  3FKV A;  5G18 A;  3NY4 A;  4BEN A;  1BTL A;  3C5A A;  5GL9 A;  3PBT A;  3W4P A;  3A3F A;  3IHA A;  4ZAM A;  1MKI A;  2ZQ8 A;  3NC8 A;  1I5Q A;  3SOI A;  2HP9 A;  1DY6 A;  2Q9N A;  1BT5 A;  3AGD A;  3HVF A;  1K56 A;  1IKG A;  2HP6 A;  3UO9 A;  3UDF A;  3ZCZ A;  4GZB A;  4KG6 A;  1ZKJ A;  5HX9 A;  2ZJ9 A;  3NDG A;  1M6K A;  1CEF A;  1ONH A;  3IF6 C;  3IQA A;  4X55 A;  1W8Q A;  5CTN A;  5TGF A;  3V39 A;  4E3J A;  4EWF A;  1JWP A;  2JCH A;  4GN2 A;  1DJC A;  1S0W A;  2HDQ A;  3GQZ A;  3QNC A;  3WS0 A;  4R1G A;  5CEC A;  1FCO A;  1K55 A;  2J7V A;  4OPY A;  3A3J A;  5GHZ A;  4WEJ A;  1YQS A;  4UAA A;  3VP4 A;  4S2J A;  3S4X A;  1FOF A;  2PBY A;  3Q81 A;  2ZC5 B;  1K54 A;  2Y59 A;  3PBN A;  3WRT A;  4EBL A;  3HLD A;  4OLD A;  1FSW A;  4WZ5 C;  5KSC A;  3NIA A;  3IH9 A;  5A90 A;  4XUX A;  3N6I A;  4YIN A;  3E2L A;  2Q9M A;  4GD8 A;  3OPL A;  4OPR A;  1K38 A;  3CZD A;  3Q1F A;  4R3B A;  1JTG A;  4UA6 A;  3CG5 A;  1GA9 A;  1GA0 A;  4KZ3 A;  1ERM A;  4R0Q A;  2IWC A;  3P98 A;  3UY6 A;  4HBT A;  5GHX A;  3HRE A;  5GLB A;  2HDR A;  3OPP A;  5FSR A;  2WKH A;  4N1H A;  5E2E A;  1NZU A;  3IF5 A;  4BD0 A;  4E3N A;  4E3O A;  2Z2M B;  2EFU A;  4MBH A;  5EEC A;  1HZO A;  1EI5 A;  1GCE A;  3ZNY A;  4DE3 A;  4K91 A;  4KEN B;  2XD1 A;  4HEF A;  4GDB A;  3VMA A;  3BFG A;  4RA7 A;  4Y7P A;  3ZG7 B;  3JYI A;  1WYC A;  5M1A A;  3QHY A;  1H8Y A;  1L0D A;  5FAT A;  1XX2 A;  1PWD A;  3ZDJ A;  5AQ9 A;  3HLF A;  4XXR A;  3A3E A;  2XR0 A;  5JYO A;  5FAS A;  3LEZ A;  2V20 A;  4DXC A;  4NK3 A;  4OOM A;  1XXM A;  2EX6 A;  3PBS A;  1E4D A;  5HAP A;  1HVB A;  2A49 A;  2Y91 A;  4FD8 A;  1Y54 A;  3AGF A;  1BUL A;  3MZD A;  1PWG A;  3HLB A;  3AGE A;  1IEL A;  1WYB A;  4KG5 A;  4DE0 A;  4EUZ A;  1Q2Q A;  3S22 A;  3BEC A;  1VQQ A;  1PYY A;  4JKT A;  5GLA A;  3PBO A;  2ZM2 A;  4KZ9 A;  2ZQD A;  2XK1 A;  1OME A;  1TEM A;  4N1X A;  4OLG A;  1IYS A;  1YLT A;  1K6S A;  3PAE A;  1MPL A;  4P0M A;  2IWB A;  3CJM A;  3WS4 A;  5CEB A;  3ZG0 A;  4DE2 A;  1WE4 A;  2WYX A;  1H8Z A;  3MKE A;  5TR7 A;  3TOI A;  3MZF A;  3A3I A;  4BJP A;  1RP5 A;  3BFF A;  1QME A;  1ZG4 A;  1ES2 A;  4R4S A;  4WMC A;  4JXV A;  5EVI A;  2WAF A;  1ES4 A;  5I94 A;  2DRW A;  4WYY A;  1NXY A;  2DNS A;  3LY3 A;  4OQG A;  1XKZ A;  5GLC A;  4KZ7 A;  4KZ6 A;  2XGN A;  5JYP A;  3UPO A;  1NY0 A;  1FSY A;  1K6R A;  2XEP A;  2ZC3 B;  5DF7 A;  3OPR A;  2Y2M A;  3DTM A;  1PW8 A;  2Z2L B;  4KZB A;  3PBQ A;  3G30 A;  2ZQ9 A; 
#chains in the Genus database with same CATH topology
 2EX8 A;  4OH0 A;  3TG9 A;  1W7F A;  1DP6 A;  2W3D A;  1CI9 A;  4BL2 A;  1FR6 A;  4JXS A;  4BLM A;  2VX8 A;  4FSF A;  3T1X A;  3WS1 A;  2EWV A;  2WKI A;  2VJW A;  2Y4A A;  3ZHH A;  4LEN A;  5FQK A;  1N9O A;  3DTE A;  4X53 A;  1KVM A;  1W79 A;  1TS8 A;  2Y2N A;  3IS2 B;  1W63 M;  4L9E A;  1LT0 A;  1K57 A;  3UPP A;  3O86 A;  3ZVT A;  3OC2 A;  4IVI A;  4G3V A;  2ZD8 A;  2WZX A;  4F94 A;  1HD8 A;  5KMW A;  4E6X A;  4EER A;  3CUE C;  1L3L A;  2PU2 A;  4GLQ A;  3IXG A;  1MZU A;  3JPU A;  5F69 A;  4CPK A;  2GX5 A;  4EU0 A;  4ETX A;  5AVE A;  4PHT A;  1F98 A;  4DN0 A;  4OOY A;  2OV5 A;  4KQQ A;  1CQA A;  2A3U A;  3EGD C;  3GRJ A;  2BAS A;  3N4I A;  3RFB A;  5FEG A;  3LIB A;  1ZC2 A;  3HLE A;  1A0K A;  5G4Z A;  4Y5F A;  4BMW A;  4A5R A;  5KZH A;  4C3Q A;  4YNR A;  5HD5 A;  3DTI A;  4BQM A;  3W4O A;  2ZQC A;  1XA1 A;  3UB5 P;  1VET A;  2PRF A;  2WKR A;  2XA7 S;  3IX3 A;  4ZDX A;  3SS4 A;  4FH4 A;  3NUL A;  2Y55 A;  4B4Z A;  5CHU A;  4DF6 A;  2QHK A;  3PXP A;  4MN5 A;  1JWV A;  1LI9 A;  3HLC A;  1ODV A;  4WEK A;  2P74 A;  1ONG A;  1KVL A;  2W3E A;  1GHM A;  3VFF A;  3WRZ A;  2EX9 A;  1K55 C;  3LGO A;  4JGP A;  3ZG5 A;  4DDS A;  5E2G A;  3A3D A;  4HJ4 A;  1NYY A;  3V67 A;  5BOH A;  4HJ3 A;  1YMS A;  2LB9 A;  4P87 A;  5EM0 A;  1IYQ A;  1LL8 A;  1OT9 A;  2J3T C;  3Q7Z A;  4HH2 A;  4MN7 A;  5CGX A;  5DF8 A;  3LFV A;  3IWQ A;  1T19 A;  4IED A;  4RQ9 A;  5FA7 A;  1J9M A;  2QPN A;  1LLB A;  1L0G A;  3ITA A;  4JGO A;  1P97 A;  2P7J A;  1D1J A;  1RGY A;  5EOE A;  3OCL A;  3F1P A;  2XFS A;  3G2Z A;  3EEH A;  4KG2 A;  4Q8I A;  2WGI A;  3V50 A;  1J3W A;  3MXS A;  4EES A;  2ZQ7 A;  1YLZ A;  3IT9 A;  2BLS A;  3UN7 A;  1NJ4 A;  3FZC A;  4L9G A;  4NXB A;  4ID4 A;  4DKI A;  3DWK A;  2J3T D;  4KZ8 A;  3G2Y A;  3ZNT A;  4R4R A;  4Y0O A;  2V0U A;  3UNW A;  1FCN A;  2M1C A;  4R23 A;  3FPV A;  5CXW A;  5CGW A;  4YOF A;  3S7Q A;  4QY6 A;  1KGF A;  2ZMV A;  2J3W A;  3FV7 A;  2Y2K A;  2D01 A;  4O8G A;  5EVI C;  5AQ7 A;  3C7V A;  4N92 A;  3CUE A;  3T4O A;  4WN5 A;  3HUM A;  5E43 A;  1JVJ A;  4K0W A;  5F6A A;  4HQA A;  4X1M A;  3C38 A;  5A91 A;  2L4R A;  3DW0 A;  1TDL A;  3LR3 A;  5D3O A;  4N9K A;  4HIA A;  1BZA A;  1SDE A;  5FEF A;  4CLC E;  2XD5 A;  2E8I A;  4OON A;  4JBF A;  1SZV A;  2WKP A;  3EQU A;  3QP4 A;  2P08 A;  3C8C A;  3NI9 A;  1ZTU A;  5EVI D;  2HJ9 C;  2VZW A;  3UE1 A;  2WUQ A;  4OKP A;  5FQJ A;  4B4X A;  3Q07 A;  4OVD A;  4RX2 A;  1Y28 A;  3CAX A;  1C3B A;  1NZO A;  3B3X A;  3VSK A;  1OTA A;  2VGL S;  3BFD A;  3UB7 A;  4ZJ3 A;  2H0T A;  1BTL A;  3C5A A;  5J3W A;  3A3F A;  3IHA A;  4ZAM A;  2HP9 A;  3T1R A;  2WKQ A;  3S7P A;  3ICY A;  2HP6 A;  3UO9 A;  3UDF A;  3LIA A;  2HGV A;  2PD7 A;  5TGF A;  2JCH A;  1DJC A;  3R7W B;  1K55 A;  2J7V A;  4OPY A;  5AJG A;  1YQS A;  3S4X A;  1FOF A;  3LYX A;  4X1L A;  3PBN A;  5KSC A;  4OLD A;  1FSW A;  5HWW A;  4XUX A;  3QP5 A;  4YIN A;  1VEU A;  3CG5 A;  3FG8 A;  4WL9 A;  1GA0 A;  3JVV A;  4KZ3 A;  2IWC A;  5GHX A;  3HRE A;  2HDR A;  5FSR A;  1NZU A;  3IF5 A;  5DJT A;  4E3N A;  3T50 A;  4E3O A;  1FIK A;  2Z2M B;  1HZO A;  1GCE A;  2QWS A;  3VMA A;  2HZ5 A;  4RA7 A;  4Y7P A;  5C5K A;  3JYI A;  5M1A A;  4UQI S;  3T4S A;  2Y79 A;  1XX2 A;  5AQ9 A;  4XXR A;  5JYO A;  2JKR I;  3MQO A;  1XXM A;  2W1T A;  2EX6 A;  5HAP A;  3B42 A;  4FD8 A;  2GNX A;  3HLB A;  3E4P A;  4NKP A;  5HPI A;  2A24 A;  4Y15 A;  3PBO A;  4MN6 A;  2NUP C;  4PKY G;  3T4J A;  4OLG A;  3LIF A;  4Q0I A;  1K6S A;  3MS6 A;  3HJK A;  3ZG0 A;  4EUV A;  2WYX A;  3MKE A;  2PDR A;  5EVI A;  4JXV A;  3T4T A;  1F5M A;  4KZ7 A;  1NY0 A;  1FSY A;  3OPR A;  4X25 A;  3DTM A;  3G30 A;  1VB6 A;  3BQ8 A;  4E6W A;  3SS3 A;  3E0Y A;  4JLF A;  3GTC A;  3NBL A;  2BG1 A;  4X68 A;  1SCW A;  1KOU A;  2ZM0 A;  3IS2 A;  3SS5 A;  4WF0 A;  1PW1 A;  1XJ3 A;  2ZM8 A;  2V2F F;  3QP2 A;  2J9P A;  4IVK A;  3GVB A;  4LFU A;  3SW1 A;  4BL3 A;  1KE4 A;  1KDW A;  2WK0 A;  2VK3 A;  2H28 A;  1PFL A;  2G7U A;  2C6W B;  3PAG A;  1P0Z A;  3A0S A;  1W8Y A;  4X69 A;  3OPH A;  2OSU A;  2JE5 A;  1GHI A;  1IKI A;  4K08 A;  2IWD A;  3ZVW A;  4U0X A;  1H5X A;  5HDC A;  2XQZ A;  4GHI B;  4U0T A;  5DTK A;  3HLW A;  4XT2 A;  5FQQ A;  5EOO A;  1OTI A;  3D4F A;  4G3W A;  1VEU B;  3IH8 A;  2A2L A;  3M2J A;  2YKF A;  4DRT A;  4GDN A;  3LCE A;  3SH8 A;  5DF9 A;  3WS5 A;  3MMH A;  3LI8 A;  3DWZ A;  4EBP A;  5KIZ A;  2HPB A;  1LSX A;  2OWH A;  4RX3 A;  1XA7 A;  4HJ6 A;  2HF6 A;  2K31 A;  5CGS A;  2L0W A;  1D06 A;  4D2O A;  5DTS A;  4IHQ A;  4LRY C;  2VV6 A;  3U4L P;  4AFI A;  3B47 A;  3A0R A;  2W1T B;  2VKS A;  4ZTK A;  4ME4 A;  5M18 A;  3VP0 A;  3MJQ A;  1P9R A;  3P7N A;  2VGK A;  4QB8 A;  1CEG A;  3G31 A;  2A24 B;  3M6H A;  1E3U A;  3IBJ A;  5AQB A;  1U60 A;  1GHP A;  3HLG A;  2P9V B;  2J8Y A;  1PZO A;  5IU1 A;  2WAE A;  1XGJ A;  3MKF A;  5KSH A;  4PM9 A;  4PKY A;  2VV8 A;  3BQA A;  1W5D A;  1IFQ A;  5EVI B;  3ITB A;  1V9Y A;  1ESI A;  1L0F A;  4DJ3 A;  4MBK A;  3CHW P;  2O99 A;  3NHQ A;  5J7E A;  4C6Y A;  2EXB A;  4WLA A;  4UEY A;  3IHB A;  3F1O B;  2FZ0 A;  4DE1 A;  4QWO A;  4LCM A;  1FR1 A;  3VE3 A;  1XPB A;  1CK3 A;  4M3K A;  5AQA A;  1L0E A;  3UDI A;  4LRZ E;  4EV4 A;  3TRC A;  4NET A;  4OPQ A;  3ZG9 B;  1IEM A;  1P9W A;  1LL9 A;  4LRX C;  5L8M A;  3W4Q A;  1ES5 A;  3C4O A;  3HUN A;  2Y2I A;  4WBG A;  3RTY A;  3IWI A;  2J9O A;  3IXD A;  5IS1 A;  4CJN A;  5EM1 A;  3KYZ A;  2KLI A;  4RVA A;  1F2K A;  4LGW A;  1JTD A;  5IT5 A;  4HOI A;  2FH5 A;  5FI6 A;  3G34 A;  4XT2 B;  3OCN A;  3QP1 A;  3V5M A;  4FUW A;  1YM1 A;  1DRM A;  1YLW A;  1YLP A;  4PM5 A;  3LI9 A;  3O3V A;  2EA9 A;  4KQD A;  3PHY A;  1NWZ A;  3S7O A;  2Y2J A;  3CLO A;  4NXF A;  3VE4 A;  4OOL A;  5CED A;  4EET B;  3NOP C;  3M6B A;  2QKP A;  3TSG A;  4Z1W A;  1SHV A;  4Q0H A;  1TS6 A;  2X01 A;  5HAI A;  1CI8 A;  4IBX A;  4OQI A;  2O9A A;  4S2P A;  4ZJ1 A;  4HHD A;  3E98 A;  1ALQ A;  3F1N B;  2KDK A;  1AXB A;  5HW3 A;  4JF6 A;  4I5S A;  2KOI A;  3W2Z A;  3MQQ A;  4C75 A;  1MBL A;  2XDM A;  1I2W A;  5M19 A;  3EOI A;  3G32 A;  4QJG A;  1PI4 A;  4Y3I A;  2HV1 A;  4PM6 A;  4P6Z M;  1MC0 A;  2ZC7 A;  1KDS A;  3MXR A;  2PBD P;  4RYE A;  1TDG A;  1M40 A;  3IXH A;  1VHM A;  1S6R A;  1STZ A;  1QMF A;  3LY4 A;  4KQR A;  1N9N A;  1KE3 A;  3C7U A;  1HLU P;  1EWZ A;  4B88 A;  4K0X A;  3S1Y A;  3BFE A;  3W4P A;  2OOL A;  2D02 A;  3R7W A;  3LEQ A;  1MKI A;  2B18 A;  2ZQ8 A;  5HWV A;  3AGD A;  1MKM A;  1G6O A;  2V1B A;  2Y8H A;  1ZKJ A;  5DFX A;  1ONH A;  2O9B A;  1YSP A;  3QNC A;  3LIC A;  3A3J A;  5GHZ A;  4UAA A;  4S2J A;  3L7H A;  2Y59 A;  5EV0 A;  3HLD A;  2NUT C;  5A90 A;  3OBF A;  3N6I A;  3E2L A;  3CZD A;  3Q1F A;  3H7W B;  1JTG A;  1OTD A;  3UY6 A;  4L9F A;  5A8B A;  1YAX A;  4GCZ A;  4M4X A;  2YKH A;  2JKT M;  3TE8 A;  3KYQ A;  3C30 A;  3ZNY A;  2OAP 1;  2PYR A;  4KEN B;  3ZG7 B;  3QP6 A;  1WYC A;  3QHY A;  1H8Y A;  3B33 A;  5FAT A;  1PWD A;  5EVE A;  3ZDJ A;  3HLF A;  5FAS A;  2V20 A;  4G3K A;  4DXC A;  4NK3 A;  4OOM A;  1E4D A;  1SKO A;  3MZD A;  3AGF A;  4WUJ A;  4H6J A;  4FOF A;  4KG5 A;  3S22 A;  1VQQ A;  1PYY A;  1NLY A;  4JKT A;  2Q0O A;  3H82 A;  2XK1 A;  4BBT A;  1OTE A;  3PAE A;  1V9Z A;  1MPL A;  4P0M A;  2IWB A;  2KX6 A;  2V1A A;  1WE4 A;  3TOI A;  3BY9 A;  3KO6 A;  1RP5 A;  3BFF A;  4HP4 A;  2WAF A;  4QPR A;  2DRW A;  1NXY A;  5TBM B;  3MXQ A;  2DNS A;  3LY3 A;  4MCW A;  5FDS A;  4KZ6 A;  2Y2M A;  4R6L A;  2Z2L B;  1BYW A;  1DJA A;  4OQ0 A;  3ZQ5 A;  3HBR A;  3UME A;  2V0W A;  4IUK A;  5EE8 A;  4R3J A;  5HPF A;  3C2W A;  3CMZ A;  4QU3 A;  4ESP A;  2FFF B;  2QZ6 A;  3T1Q B;  4HBU A;  4X56 A;  3UE0 A;  1T1A A;  3BJN A;  4GD6 A;  1Z09 A;  1K56 D;  5L2F A;  4GHI A;  1D7E A;  5F1F A;  2LB5 A;  4KUO A;  3R4K A;  3OLO A;  3SH9 A;  1G28 A;  3Q7V B;  4S2N C;  4EXO A;  3VOL A;  3K3C A;  2W3G A;  3DTK A;  4EQ1 A;  5HSQ A;  1UWP X;  2EX2 A;  1LL5 A;  4P85 A;  5HAQ A;  5CTM A;  5FAQ A;  3VOY A;  4OPZ A;  5TFQ A;  4XUZ A;  2JKR M;  2R78 A;  1YSQ A;  4ARZ B;  4EEP A;  2QJ7 A;  3UB9 A;  1BLP A;  1PI5 A;  1H3Q A;  1AWI A;  1K25 A;  2DCF A;  4FTX A;  2WZZ A;  5DVA A;  2M7V A;  1N4O A;  4II7 A;  1L2S A;  2ZC4 B;  4DJ2 A;  2OLU A;  1JWZ A;  1YLY A;  4MEZ A;  3HCY A;  2GJ3 A;  3IF6 B;  1ZG6 A;  5HDS A;  4JXG A;  5IHV A;  2Y2O A;  1LSW A;  4Y0U A;  3RJU A;  3GMW A;  4JF5 A;  1G6A A;  4LV3 A;  4UHU A;  2C5W B;  1MWS A;  2ZL1 B;  4GNU A;  3FC7 A;  1SKO B;  3OOV A;  2QMI A;  2P9V A;  4H6J B;  3BLS A;  1GSW A;  3D9Y A;  4QD4 A;  4HI4 A;  1G5U A;  5A93 A;  3H82 B;  4LV0 A;  3UE3 A;  3UB8 A;  2WGV A;  4PPR A;  3CIT A;  4GS9 B;  3HUO A;  1LI0 A;  2WKE A;  4ETZ A;  2W3H A;  3DAV A;  3RH8 B;  3F1O A;  1YT4 A;  2HJE A;  3GSG A;  4F3L B;  5EPH A;  2XFT A;  3ISG A;  3QP8 A;  4UA7 A;  5FQM A;  5CHM A;  4JGQ A;  4D60 A;  5FDH A;  3U2A A;  5MC7 A;  5E2H A;  3GR2 A;  3G35 A;  3HL9 A;  1F9I A;  3P09 A;  4GB7 A;  1PZP A;  1BSG A;  4CLC C;  2H10 A;  2XLN A;  5HL6 A;  4EBN A;  5U47 A;  1EW0 A;  5F1G A;  5G4Y A;  2VA0 A;  2JKF A;  1LHY A;  3BFC A;  3H9W A;  4YFM A;  5CRF A;  3T4Q A;  1MWT A;  4S2I A;  4DDY A;  4E3L A;  2WGW B;  3MF0 A;  2Y2H A;  1S66 L;  1JNU A;  4KQO A;  2VLG A;  4MBF A;  3VSL A;  5FQI A;  3VOZ A;  3A0V A;  2K7S A;  3RXW A;  3UPN A;  3FYZ A;  4CLC D;  4EQI A;  5F82 A;  2VV7 A;  3O88 A;  5AVF A;  2INW A;  1HTZ A;  4LCL A;  3LO7 A;  3RXX A;  2GDN A;  2G2W A;  3GDI A;  3LR5 A;  3QNB A;  4MDZ A;  1VM1 A;  4S2N A;  4JF4 A;  2RCX A;  5FL3 A;  3F1N A;  1K4E A;  2CMN A;  3VP3 A;  4BD1 A;  1NRF A;  1FIL A;  2FFY A;  1S67 L;  1O7E A;  4X6T A;  1MWR A;  3IX8 A;  4JPM A;  2OLV A;  3VV4 A;  1FCM A;  5GHY A;  4ZJ2 A;  4R70 A;  2ZC6 B;  3VP1 A;  1ESU A;  2V1Z A;  3K2N A;  4I3J A;  4NXG A;  3NJA A;  5A92 A;  2XRO A;  5FAO A;  4E3M A;  3T1S A;  3L9K A;  3Q82 A;  5E2F A;  4WMC D;  2JC7 A;  4P6B A;  4MLL A;  3N8R A;  4R3A A;  3IXB A;  3ULF A;  3C4P A;  1FQG A;  1WA9 A;  4Z9Q A;  2CC1 A;  3TJZ C;  1S4S A;  3PTE A;  2JBF A;  3NY4 A;  4BEN A;  5GL9 A;  3PBT A;  3NC8 A;  3SOI A;  3LR0 A;  2Q9N A;  1IKG A;  4GZB A;  4KG6 A;  2ZJ9 A;  2XA7 M;  1M6K A;  3IF6 C;  3IQA A;  3JVU A;  4E3J A;  3UE6 A;  2IA2 A;  1JWP A;  4GN2 A;  2HDQ A;  3H7W A;  1FCO A;  4WEJ A;  5DKL A;  2GZA A;  3KSH A;  4EBL A;  3WRT A;  3CWF A;  2W3F A;  4WZ5 C;  2ZMF A;  1IOU A;  2Q9M A;  4GD8 A;  1K38 A;  2PD8 A;  3MSH A;  2QYB A;  4UA6 A;  2UV0 E;  1ERM A;  2OAQ 1;  3MR0 A;  5GLB A;  4EW7 A;  4CLC A;  2WKH A;  4N1H A;  4BD0 A;  4MBH A;  5EEC A;  1EI5 A;  1XFQ A;  2XSS A;  4DE3 A;  4K91 A;  3BW6 A;  2XD1 A;  1K0K A;  4HEF A;  4GDB A;  3BFG A;  1L0D A;  2W1R A;  1TF1 A;  3NOU C;  4MMN A;  2Z6D A;  3PR6 A;  3A3E A;  5HD3 A;  4Q0J A;  1BUL A;  1PWG A;  1WYB A;  2M7U A;  4KUK A;  1T1C A;  5HZH A;  4DE0 A;  4EUZ A;  1S1Y A;  4BBV A;  5GLA A;  4IUH A;  3EEA A;  4KZ9 A;  5TBM A;  2ZQD A;  1OME A;  1TEM A;  1IYS A;  1YLT A;  2PHY A;  1YKD A;  5CEB A;  1H8Z A;  3NOT C;  3CI6 A;  2W0N A;  3MZF A;  4BJP A;  3BY8 A;  1QME A;  1ZG4 A;  4WMC A;  4R4S A;  4NEE D;  1ES4 A;  2V8C A;  2PAV P;  1XKZ A;  5JYP A;  3UPO A;  4HY8 A;  1K6R A;  2XEP A;  2ZC3 B;  5DF7 A;  2ACG A;  3PBQ A;  2ZQ9 A;  2L1M A;  2V9A A;  4S2O A;  4KZ4 A;  3PBR A;  5EFW A;  3MZE A;  1IYO A;  4GKU A;  4HES A;  1H0M A;  4S2L A;  4KZA A;  5DKK A;  2O9C A;  3WWX A;  1LSV A;  3Q7V A;  3LUQ A;  4Y2F A;  3E2K A;  3PYP A;  4I3I A;  1SKF A;  5HAR A;  4OP8 A;  2PR5 A;  3N8S A;  1MXO A;  4B9O A;  2EWW A;  2XH9 A;  4WEL A;  3NCK A;  4WZ4 A;  1SDN A;  2Y2P A;  2QJ5 A;  4I3A A;  1NLZ A;  2ZOH A;  2ZQA A;  5EVL A;  5HL1 A;  3EQV A;  4ARZ A;  1N9L A;  2I72 A;  3ZGA B;  5DTT A;  4CQH A;  3BLM A;  3IBR A;  5DJU A;  1PIO A;  1NYM A;  1S1Z A;  1K4F A;  1Z6F A;  5CHJ A;  4P6Z S;  4E3I A;  2G2U A;  3M2K A;  3O87 A;  3IF6 A;  3BEB A;  2VGL M;  1G68 A;  3GV9 A;  4CLC B;  3N8L A;  2ZLY A;  2MJ6 A;  2UWX A;  3G4P A;  1KGG A;  3EWK A;  5LBR A;  1ACF A;  1XJ4 A;  2ZL1 A;  4WZ5 A;  3BRM A;  3BWL A;  1MY8 A;  3UDX A;  4OQH A;  4I39 A;  2Y2Q A;  1S4R A;  2B5R A;  3LID A;  2WAD A;  2JKT I;  4NG2 A;  3UMD A;  3ZG8 B;  3V3S A;  3S7N A;  2PYP A;  2PR6 A;  4H8R A;  5GLD A;  3T4L A;  2Y2G A;  4GS9 A;  3VFH A;  4E3K A;  3E4Q A;  4HNB A;  4FCF A;  4S2K A;  3WS2 A;  1Q2P A;  2Y2L A;  5HWT A;  1VET B;  1XGI A;  4L0L A;  2HDU A;  3HJI A;  4R38 A;  1CJF A;  4F3L A;  4HH3 A;  4LV1 A;  3I7J A;  1N9B A;  2XF3 A;  4B93 A;  5FAP A;  1TVF A;  2J80 A;  3FWL A;  2X02 A;  3IWO A;  3K3D A;  1ERQ A;  4E04 A;  5CER A;  5I5L A;  5FI2 A;  2DMW A;  1K54 C;  4MNR A;  4QY5 A;  3SZT A;  1MWU A;  4UQI M;  3MQ0 A;  1I2S A;  2JN7 A;  3D3O A;  1GSX A;  4IBR A;  3T4K A;  3MBZ A;  1RCJ A;  2HP5 A;  1YMX A;  2P04 A;  5HFO A;  3KSG A;  5F83 A;  4BBU A;  3ZYT A;  3FKW A;  4Y13 A;  4GW9 A;  3BM6 A;  3CPT A;  1PRQ A;  4JXW A;  2XRN A;  3OZH A;  4DMZ A;  2RL3 A;  2WGW A;  2PU4 A;  3D72 A;  3N7W A;  4FH2 A;  1KGE A;  4LV2 A;  4O7D A;  2R9W A;  1E25 A;  2HDS A;  4EEU A;  1YLJ A;  3MFD A;  1ES3 A;  1DJB A;  4UA9 A;  3KYE A;  4NXE A;  1RGZ A;  3VP2 A;  2EFX A;  2EXA A;  3F1P B;  1PWC A;  2JKG A;  3SH7 A;  3IX4 A;  1NRJ A;  3BYD A;  1GSV A;  4GOG A;  4I38 A;  5FQ9 A;  4PAU A;  4QHC A;  2X71 A;  4PM8 A;  3W8K A;  1BUE A;  2VEA A;  1OPX A;  4O0P A;  2E8J A;  1BLS A;  2K2N A;  1BLC A;  1XP4 A;  3NDE A;  2ZMA A;  2B02 A;  4S2M A;  5J8X A;  4PM7 A;  4Y0T A;  3V3R A;  4ZRR A;  4O01 A;  2R9X A;  1UWN X;  1H8M A;  1KE0 A;  4PMA A;  4U3T A;  5EUA A;  5J4E A;  5L09 A;  4WM9 A;  5FI7 A;  5F5Y A;  5CX7 A;  1T1B A;  3KX0 X;  2V8F A;  4LLO B;  1ERO A;  2VGJ A;  4BWI A;  1CF0 A;  2BTF P;  1O07 A;  4KZ5 A;  1BLH A;  4OP5 A;  4ZBE A;  3ZFZ A;  3LR4 A;  3G6O A;  2I9V A;  1OTB A;  1E3U D;  1IYP A;  1K57 C;  4Y17 A;  4GJ4 A;  2H5S A;  2H0Y A;  4N9L A;  4DXB A;  1PNE A;  1OJG A;  3LIE A;  2PT7 A;  3FKV A;  5G18 A;  5K5B A;  1TD5 A;  1OJ5 A;  1I5Q A;  1DY6 A;  1BT5 A;  3HVF A;  5F68 A;  1K56 A;  1XJ2 A;  3ZCZ A;  5HX9 A;  4JGR A;  3NDG A;  1CEF A;  4X55 A;  3V39 A;  1W8Q A;  5CTN A;  4YWZ A;  1T18 A;  4EWF A;  1S0W A;  5CEC A;  3GQZ A;  3WS0 A;  4R1G A;  5HDD A;  3O5Y A;  1XFN A;  3VP4 A;  2PBY A;  3Q81 A;  2ZC5 B;  3CPT B;  1K54 A;  1TS0 A;  3T12 B;  3DBA A;  1DP8 A;  3EGX C;  3IH9 A;  3NIA A;  3MFX A;  3FPW A;  4OPR A;  3OPL A;  5L07 A;  3TW8 A;  4R3B A;  1GA9 A;  4R0Q A;  3P98 A;  2JHE A;  1X0O A;  4HBT A;  3OPP A;  5E2E A;  2B95 A;  2EFU A;  2W27 A;  1UGU A;  1DP9 A;  3KSF A;  4IJG A;  2XR0 A;  3LEZ A;  1OT6 A;  2AVX A;  3PBS A;  1HVB A;  2A49 A;  2Y91 A;  1Y54 A;  5DFY A;  1ZHH B;  2ZBB A;  3AGE A;  1IEL A;  3E4O A;  1Q2Q A;  4HP9 A;  3BEC A;  3P01 A;  2Z6C A;  1XJ6 A;  2ZM2 A;  4N1X A;  1TS7 A;  3NEC A;  1YPR A;  3CJM A;  3KSI A;  3WS4 A;  4DE2 A;  5TR7 A;  1Y4O A;  3A3I A;  1ES2 A;  2OWJ A;  2ZOI A;  5I94 A;  4WYY A;  2O0Y A;  5L10 A;  4OQG A;  3GEC A;  5GLC A;  5TJJ A;  2XGN A;  4LPZ A;  3UB6 A;  1W63 Q;  1PW8 A;  4KZB A; 
#chains in the Genus database with same CATH homology
 2EX8 A;  1DJA A;  4OH0 A;  4OQ0 A;  3HBR A;  3SS3 A;  3TG9 A;  4E6W A;  4S2O A;  1W7F A;  4JLF A;  4KZ4 A;  1CI9 A;  3PBR A;  4BL2 A;  3MZE A;  3GTC A;  1FR6 A;  3NBL A;  4JXS A;  4BLM A;  2BG1 A;  4X68 A;  1SCW A;  5EE8 A;  1IYO A;  2ZM0 A;  4FSF A;  4R3J A;  4GKU A;  3SS5 A;  4HES A;  3CMZ A;  4QU3 A;  3WS1 A;  4S2L A;  4KZA A;  2WKI A;  2Y4A A;  3ZHH A;  3WWX A;  1PW1 A;  2FFF B;  2ZM8 A;  2V2F F;  2QZ6 A;  4HBU A;  4LEN A;  4X56 A;  3Q7V A;  2J9P A;  5FQK A;  3E2K A;  3UE0 A;  4IVK A;  4X53 A;  1SKF A;  3GVB A;  1KVM A;  1W79 A;  4OP8 A;  5HAR A;  4GD6 A;  3N8S A;  1MXO A;  4BL3 A;  1KE4 A;  2Y2N A;  1K56 D;  1KDW A;  5L2F A;  2XH9 A;  4WEL A;  3NCK A;  4WZ4 A;  1K57 A;  1SDN A;  2WK0 A;  2Y2P A;  3UPP A;  5F1F A;  3O86 A;  3ZVT A;  3OC2 A;  4IVI A;  2ZQA A;  2ZD8 A;  5EVL A;  3SH9 A;  2WZX A;  4F94 A;  1HD8 A;  2C6W B;  3Q7V B;  3PAG A;  4S2N C;  5HL1 A;  3EQV A;  5KMW A;  4E6X A;  2I72 A;  1W8Y A;  4X69 A;  3ZGA B;  3OPH A;  2OSU A;  2JE5 A;  2PU2 A;  5DTT A;  1GHI A;  3BLM A;  1IKI A;  2IWD A;  3IXG A;  3ZVW A;  4U0X A;  1H5X A;  1PIO A;  1NYM A;  2EX2 A;  2XQZ A;  1LL5 A;  4U0T A;  5DTK A;  4P85 A;  4CPK A;  5HAQ A;  3HLW A;  5CTM A;  1K4F A;  1Z6F A;  5CHJ A;  5FAQ A;  3VOY A;  5FQQ A;  4E3I A;  4OPZ A;  5TFQ A;  4XUZ A;  5EOO A;  3D4F A;  2G2U A;  3IH8 A;  3M2K A;  4OOY A;  2OV5 A;  3M2J A;  3IF6 A;  3O87 A;  4KQQ A;  2A3U A;  3BEB A;  4DRT A;  1BLP A;  1PI5 A;  4GDN A;  1G68 A;  3GRJ A;  3GV9 A;  3LCE A;  3N8L A;  1K25 A;  2DCF A;  5DF9 A;  3SH8 A;  3N4I A;  3WS5 A;  2WZZ A;  2ZLY A;  2UWX A;  5DVA A;  3G4P A;  1KGG A;  3DWZ A;  1ZC2 A;  4EBP A;  1N4O A;  2HPB A;  4RX3 A;  1L2S A;  3HLE A;  2ZC4 B;  1XA7 A;  4WZ5 A;  2OLU A;  3BRM A;  4A5R A;  1MY8 A;  3UDX A;  5CGS A;  1JWZ A;  1YLY A;  4MEZ A;  5KZH A;  3IF6 B;  1ZG6 A;  4OQH A;  2Y2Q A;  4D2O A;  4C3Q A;  5DTS A;  4JXG A;  5IHV A;  2B5R A;  2Y2O A;  4Y0U A;  2WAD A;  3RJU A;  3ZG8 B;  4BQM A;  3GMW A;  4JF5 A;  3V3S A;  3W4O A;  1G6A A;  1XA1 A;  2ZQC A;  4LV3 A;  4H8R A;  4UHU A;  2C5W B;  1MWS A;  4ZTK A;  5GLD A;  2Y2G A;  5M18 A;  4GNU A;  4ZDX A;  3SS4 A;  4FH4 A;  3VP0 A;  2QMI A;  2P9V A;  3VFH A;  2Y55 A;  4E3K A;  4B4Z A;  5CHU A;  3BLS A;  4QD4 A;  4DF6 A;  2VGK A;  4FCF A;  4QB8 A;  4S2K A;  3WS2 A;  1CEG A;  3G31 A;  1JWV A;  3M6H A;  1E3U A;  1LI9 A;  3HLC A;  4WEK A;  5A93 A;  1Q2P A;  2Y2L A;  5AQB A;  2P74 A;  1U60 A;  1GHP A;  1ONG A;  1XGI A;  3HLG A;  2HDU A;  4L0L A;  4LV0 A;  3UE3 A;  1KVL A;  2WGV A;  4PPR A;  4LV1 A;  2P9V B;  1GHM A;  3VFF A;  2J8Y A;  3I7J A;  1PZO A;  1N9B A;  3HUO A;  2XF3 A;  2WAE A;  1XGJ A;  3WRZ A;  5FAP A;  3MKF A;  1TVF A;  1LI0 A;  5KSH A;  4PM9 A;  3FWL A;  2EX9 A;  1K55 C;  2X02 A;  3IWO A;  1ERQ A;  1W5D A;  2WKE A;  5EVI B;  5CER A;  3ITB A;  3ZG5 A;  4DDS A;  5FI2 A;  5E2G A;  1K54 C;  3A3D A;  4MNR A;  4QY5 A;  1YT4 A;  1ESI A;  1NYY A;  3GSG A;  1MWU A;  5BOH A;  1L0F A;  1I2S A;  5EPH A;  2XFT A;  3ISG A;  5FQM A;  4UA7 A;  1YMS A;  4IBR A;  5CHM A;  3MBZ A;  4MBK A;  1RCJ A;  2HP5 A;  5FDH A;  1YMX A;  4P87 A;  5HFO A;  1IYQ A;  4C6Y A;  5F83 A;  2EXB A;  5E2H A;  3GR2 A;  3G35 A;  3HL9 A;  4GB7 A;  3P09 A;  3Q7Z A;  1PZP A;  3IHB A;  1BSG A;  5CGX A;  2H10 A;  3FKW A;  5DF8 A;  2XLN A;  4DE1 A;  4LCM A;  1FR1 A;  3IWQ A;  1XPB A;  3BM6 A;  4IED A;  4EBN A;  1CK3 A;  4M3K A;  5AQA A;  5U47 A;  5FA7 A;  1J9M A;  4JXW A;  3OZH A;  1L0E A;  2RL3 A;  2QPN A;  2WGW A;  5F1G A;  1LLB A;  1L0G A;  1LHY A;  3ITA A;  3UDI A;  2PU4 A;  4EV4 A;  1RGY A;  4NET A;  3N7W A;  4FH2 A;  3BFC A;  4OPQ A;  5EOE A;  4YFM A;  3ZG9 B;  3OCL A;  1IEM A;  5CRF A;  2XFS A;  3G2Z A;  1MWT A;  1LL9 A;  1KGE A;  4LV2 A;  4O7D A;  4S2I A;  4KG2 A;  4DDY A;  4E3L A;  2WGI A;  4Q8I A;  3V50 A;  3MXS A;  1ES5 A;  2R9W A;  3C4O A;  1E25 A;  3W4Q A;  2HDS A;  2WGW B;  3HUN A;  2Y2H A;  1YLJ A;  2ZQ7 A;  3MFD A;  1ES3 A;  1DJB A;  1YLZ A;  2Y2I A;  2BLS A;  3IT9 A;  4WBG A;  4UA9 A;  3IWI A;  4KQO A;  3UN7 A;  1NJ4 A;  2J9O A;  1RGZ A;  3FZC A;  3VP2 A;  3IXD A;  2EFX A;  4MBF A;  3VSL A;  4ID4 A;  4DKI A;  2EXA A;  4CJN A;  1PWC A;  3SH7 A;  3DWK A;  5FQI A;  4RVA A;  3VOZ A;  3BYD A;  4KZ8 A;  1JTD A;  4GOG A;  5FQ9 A;  3G2Y A;  3RXW A;  3UPN A;  3ZNT A;  3FYZ A;  4EQI A;  4R4R A;  5FI6 A;  4QHC A;  4Y0O A;  3UNW A;  3G34 A;  5F82 A;  1FCN A;  3O88 A;  4R23 A;  3OCN A;  5CXW A;  2X71 A;  5CGW A;  4PM8 A;  3W8K A;  1BUE A;  1HTZ A;  4LCL A;  3LO7 A;  3RXX A;  2GDN A;  3V5M A;  4QY6 A;  1BLS A;  1YM1 A;  2G2W A;  1KGF A;  3FV7 A;  3QNB A;  1YLW A;  2Y2K A;  1YLP A;  4PM5 A;  1VM1 A;  1BLC A;  3O3V A;  4S2N A;  5EVI C;  1XP4 A;  5AQ7 A;  3C7V A;  3NDE A;  2ZMA A;  4JF4 A;  2RCX A;  4N92 A;  4S2M A;  5J8X A;  4PM7 A;  2Y2J A;  4Y0T A;  3V3R A;  4OOL A;  3HUM A;  5E43 A;  5CED A;  1JVJ A;  1K4E A;  4K0W A;  2R9X A;  3VP3 A;  5A91 A;  3M6B A;  1NRF A;  4BD1 A;  1KE0 A;  3TSG A;  4PMA A;  1SHV A;  2FFY A;  4U3T A;  5EUA A;  1O7E A;  4WM9 A;  3DW0 A;  2X01 A;  1TDL A;  1MWR A;  4X6T A;  5D3O A;  5FI7 A;  5HAI A;  4N9K A;  1CI8 A;  4IBX A;  4JPM A;  2OLV A;  4OQI A;  1FCM A;  1ERO A;  4S2P A;  4ZJ1 A;  2VGJ A;  1BZA A;  1SDE A;  5GHY A;  1ALQ A;  4ZJ2 A;  1O07 A;  4KZ5 A;  1AXB A;  2ZC6 B;  3VP1 A;  5HW3 A;  1BLH A;  1ESU A;  4JF6 A;  2XD5 A;  4C75 A;  2V1Z A;  1MBL A;  2XDM A;  1I2W A;  5M19 A;  2E8I A;  4OP5 A;  4OON A;  3G32 A;  4JBF A;  1PI4 A;  4QJG A;  4ZBE A;  3ZFZ A;  4PM6 A;  3EQU A;  2ZC7 A;  5A92 A;  1KDS A;  3MXR A;  4RYE A;  5FAO A;  3NI9 A;  4E3M A;  1TDG A;  1M40 A;  1E3U D;  3IXH A;  3Q82 A;  5EVI D;  5E2F A;  4WMC D;  1IYP A;  2JC7 A;  4P6B A;  1S6R A;  1K57 C;  4MLL A;  3N8R A;  1QMF A;  3UE1 A;  3LY4 A;  4KQR A;  2WUQ A;  4OKP A;  5FQJ A;  4B4X A;  1KE3 A;  3C7U A;  3Q07 A;  3IXB A;  2H5S A;  2H0Y A;  3C4P A;  4N9L A;  4OVD A;  1FQG A;  4DXB A;  4RX2 A;  1C3B A;  1NZO A;  1EWZ A;  3B3X A;  3VSK A;  4B88 A;  4Z9Q A;  4K0X A;  2CC1 A;  3BFD A;  3S1Y A;  3PTE A;  3BFE A;  2JBF A;  4ZJ3 A;  2H0T A;  3FKV A;  5G18 A;  3NY4 A;  4BEN A;  1BTL A;  3C5A A;  5GL9 A;  3PBT A;  3W4P A;  3A3F A;  3IHA A;  4ZAM A;  1MKI A;  2ZQ8 A;  3NC8 A;  1I5Q A;  3SOI A;  2HP9 A;  1DY6 A;  2Q9N A;  1BT5 A;  3AGD A;  3HVF A;  1K56 A;  1IKG A;  2HP6 A;  3UO9 A;  3UDF A;  3ZCZ A;  4GZB A;  4KG6 A;  1ZKJ A;  5HX9 A;  2ZJ9 A;  3NDG A;  1M6K A;  1CEF A;  1ONH A;  3IF6 C;  3IQA A;  4X55 A;  1W8Q A;  5CTN A;  5TGF A;  3V39 A;  4E3J A;  4EWF A;  1JWP A;  2JCH A;  4GN2 A;  1DJC A;  1S0W A;  2HDQ A;  3GQZ A;  3QNC A;  3WS0 A;  4R1G A;  5CEC A;  1FCO A;  1K55 A;  2J7V A;  4OPY A;  3A3J A;  5GHZ A;  4WEJ A;  1YQS A;  4UAA A;  3VP4 A;  4S2J A;  3S4X A;  1FOF A;  2PBY A;  3Q81 A;  2ZC5 B;  1K54 A;  2Y59 A;  3PBN A;  3WRT A;  4EBL A;  3HLD A;  4OLD A;  1FSW A;  4WZ5 C;  5KSC A;  3NIA A;  3IH9 A;  5A90 A;  4XUX A;  3N6I A;  4YIN A;  3E2L A;  2Q9M A;  4GD8 A;  3OPL A;  4OPR A;  1K38 A;  3CZD A;  3Q1F A;  4R3B A;  1JTG A;  4UA6 A;  3CG5 A;  1GA9 A;  1GA0 A;  4KZ3 A;  1ERM A;  4R0Q A;  2IWC A;  3P98 A;  3UY6 A;  4HBT A;  5GHX A;  3HRE A;  5GLB A;  2HDR A;  3OPP A;  5FSR A;  2WKH A;  4N1H A;  5E2E A;  1NZU A;  3IF5 A;  4BD0 A;  4E3N A;  4E3O A;  2Z2M B;  2EFU A;  4MBH A;  5EEC A;  1HZO A;  1EI5 A;  1GCE A;  3ZNY A;  4DE3 A;  4K91 A;  4KEN B;  2XD1 A;  4HEF A;  4GDB A;  3VMA A;  3BFG A;  4RA7 A;  4Y7P A;  3ZG7 B;  3JYI A;  1WYC A;  5M1A A;  3QHY A;  1H8Y A;  1L0D A;  5FAT A;  1XX2 A;  1PWD A;  3ZDJ A;  5AQ9 A;  3HLF A;  4XXR A;  3A3E A;  2XR0 A;  5JYO A;  5FAS A;  3LEZ A;  2V20 A;  4DXC A;  4NK3 A;  4OOM A;  1XXM A;  2EX6 A;  3PBS A;  1E4D A;  5HAP A;  1HVB A;  2A49 A;  2Y91 A;  4FD8 A;  1Y54 A;  3AGF A;  1BUL A;  3MZD A;  1PWG A;  3HLB A;  3AGE A;  1IEL A;  1WYB A;  4KG5 A;  4DE0 A;  4EUZ A;  1Q2Q A;  3S22 A;  3BEC A;  1VQQ A;  1PYY A;  4JKT A;  5GLA A;  3PBO A;  2ZM2 A;  4KZ9 A;  2ZQD A;  2XK1 A;  1OME A;  1TEM A;  4N1X A;  4OLG A;  1IYS A;  1YLT A;  1K6S A;  3PAE A;  1MPL A;  4P0M A;  2IWB A;  3CJM A;  3WS4 A;  5CEB A;  3ZG0 A;  4DE2 A;  1WE4 A;  2WYX A;  1H8Z A;  3MKE A;  5TR7 A;  3TOI A;  3MZF A;  3A3I A;  4BJP A;  1RP5 A;  3BFF A;  1QME A;  1ZG4 A;  1ES2 A;  4R4S A;  4WMC A;  4JXV A;  5EVI A;  2WAF A;  1ES4 A;  5I94 A;  2DRW A;  4WYY A;  1NXY A;  2DNS A;  3LY3 A;  4OQG A;  1XKZ A;  5GLC A;  4KZ7 A;  4KZ6 A;  2XGN A;  5JYP A;  3UPO A;  1NY0 A;  1FSY A;  1K6R A;  2XEP A;  2ZC3 B;  5DF7 A;  3OPR A;  2Y2M A;  3DTM A;  1PW8 A;  2Z2L B;  4KZB A;  3PBQ A;  3G30 A;  2ZQ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...