5KSCA

E166a/r274n/r276n toho-1 beta-lactamase aztreonam acyl-enzyme intermediate
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
261
structure length
261
Chain Sequence
NSVQQQLEALEKSSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTAPTLNTAIPGDPRDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQPEQKAENRNDILAAAAKIVTHGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase Toho-1
publication title Active-Site Protonation States in an Acyl-Enzyme Intermediate of a Class A beta-Lactamase with a Monobactam Substrate.
pubmed doi rcsb
source organism Escherichia coli
total genus 88
structure length 261
sequence length 261
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2016-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5kscA00
3HLGA 5KMWA 1DJCA 1PW1A 5GHXA 1K54C 1NRFA 4LV2A 3A3FA 4CJNA 2XD1A 4PMAA 2Y2GA 3OPRA 4KZ5A 3IF6A 5FQJA 4WMCA 3OPPA 4S2PA 2Y2JA 4IVIA 1CK3A 1FCMA 1XGIA 5GHZA 4HBTA 1XX2A 4K91A 3GV9A 5CEBA 1IYSA 4X55A 1GA0A 1K57A 1W79A 2EFXA 2H10A 2WZZA 4KZ3A 2WKHA 3IQAA 4X68A 1PW8A 4FH4A 4B4ZA 1HD8A 2WUQA 4IVKA 4Y0TA 3WS1A 3N8RA 4OPYA 1VQQA 3MFDA 5KSHA 3ZHHA 4DXCA 3HLEA 5FAPA 3IWOA 4C6YA 1RCJA 4E3IA 4OOMA 1XA1A 4PM9A 4JF5A 5CTMA 3SS4A 2WK0A 3GR2A 4PM7A 3E2LA 4GD6A 4XUXA 3VOYA 5U47A 1GA9A 4X6TA 1JTDA 1W7FA 1SDEA 1PZOA 1NYYA 3P09A 2J7VA 5F1FA 4RA7A 3MKEA 5FATA 3MZDA 3C7UA 3HUNA 5EVIC 1XPBA 5AQ9A 4E3MA 3WS2A 1MWTA 1XKZA 3M6BA 4K0XA 4KQQA 4MBFA 3IF6B 4OQIA 3IH8A 4JLFA 3VP0A 3IXDA 3GVBA 1RGZA 1N9BA 1Z6FA 3NDEA 2JE5A 3PBOA 1ERMA 3CMZA 3UDFA 2Y2OA 4R4SA 3Q07A 1FSWA 2ZC4B 3VSKA 4UA9A 1GHIA 2OLUA 2CC1A 2Y2IA 2EX9A 2X01A 1ESIA 2IWCA 3N7WA 4WZ5A 4LV0A 4PM6A 3M6HA 4GD8A 1LLBA 2QZ6A 1NZUA 3VFFA 1BZAA 2WKEA 4KZ8A 2Y55A 3GMWA 3VP2A 4EV4A 1L0DA 3V5MA 2XD5A 1ONHA 3BM6A 2XH9A 3MZFA 4WELA 3BFEA 3RXXA 3TOIA 3Q82A 4EUZA 3IWQA 1MKIA 5HAQA 2ZM2A 2Y4AA 4PM5A 4JF4A 1O7EA 2XF3A 2OV5A 1IKIA 4XUZA 4E6WA 3NBLA 3IXBA 2DNSA 1L0FA 1BLSA 3G34A 1MWRA 3O3VA 3NDGA 4QY5A 1AXBA 3BFGA 1BSGA 1KGFA 1YMXA 2R9WA 4ID4A 4FCFA 3QNCA 3BFDA 3HUOA 3MBZA 3EQUA 3N6IA 4FH2A 4MBKA 2Z2MB 4UA6A 3WRZA 5KSCA 3UDIA 4Z9QA 4JPMA 4E3KA 3N8SA 1MWUA 4WYYA 3FKVA 4R3BA 4DKIA 3FWLA 4ZJ1A 4FSFA 4GZBA 1JWZA 1ZC2A 3VP4A 1VM1A 5JYOA 3EQVA 2H5SA 2XR0A 2OLVA 3M2KA 3G32A 3A3IA 3Q7VA 4U0TA 5CGSA 5CHUA 3UNWA 1SCWA 3W8KA 4DRTA 3ITBA 1ZKJA 4RYEA 4UA7A 1G6AA 5FA7A 1FQGA 2Y2MA 4UHUA 3GTCA 3OCNA 1KGEA 2EXBA 3MXRA 1M40A 1N4OA 4BENA 4R1GA 4R23A 1W8YA 2HP6A 1LI9A 3QHYA 1BT5A 3A3EA 4N1HA 2RCXA 3UPPA 1PWCA 2EFUA 4L0LA 5FQKA 3PBNA 3PBSA 5EUAA 4S2IA 3ZG9B 3CZDA 5FAOA 2Y2PA 4LV3A 4GNUA 4ZBEA 2QMIA 2Y59A 3HLFA 2WGIA 3BFFA 3OC2A 3HLDA 3AGDA 2PU4A 3SH8A 1HVBA 5CEDA 2X71A 5EPHA 3ZVTA 5HARA 2WKIA 1Q2PA 1RP5A 4OQGA 3OCLA 3ITAA 4N92A 1W8QA 1PIOA 2XGNA 4KG6A 2WAFA 3W4PA 3SS3A 1K54A 3Q7VB 4YINA 1IKGA 1GHPA 5FQIA 4ZDXA 1E25A 1CI9A 4OONA 5E2EA 3PAGA 5EOOA 2ZQ7A 3GQZA 4JBFA 4BLMA 1EROA 2QPNA 1TVFA 2ZM0A 4KZ7A 3HLBA 3UE1A 4DXBA 3OPHA 5CHJA 3ZFZA 1JWVA 4S2OA 4NETA 1H8YA 5FQMA 2DRWA 1IELA 4S2NA 2V20A 5EE8A 3TSGA 3UY6A 5L2FA 3LO7A 1CEGA 1SKFA 5CXWA 1J9MA 2ZC6B 2Y2LA 4DDSA 1BLCA 1BLPA 1O07A 4OQ0A 4DDYA 2ZMAA 4OH0A 5CHMA 5F82A 3TG9A 2VGJA 2ZQ9A 4EWFA 4OP5A 5CTNA 3RJUA 5E43A 1ERQA 4FD8A 4EBLA 4QJGA 3SOIA 4Y0OA 1YT4A 2EX8A 1K55A 3DWZA 5IHVA 4Y7PA 3CJMA 1MBLA 4B4XA 5BOHA 3IF5A 2XDMA 1L0GA 4JF6A 3UE3A 3ZG7B 4QHCA 4WM9A 1QMFA 1YM1A 3C4OA 4KQRA 2J9OA 3B3XA 4A5RA 1KVLA 3IHBA 5EVLA 3O86A 2ZQ8A 1XXMA 4E6XA 4B88A 3FKWA 3GRJA 1ES2A 2EX2A 1NZOA 3G30A 3MXSA 4R4RA 4KZ9A 5CGWA 1IEMA 1K38A 1FR1A 2GDNA 4CPKA 2FFYA 3LCEA 4HESA 3HVFA 3P98A 5FI6A 4KG2A 3V3SA 4OPRA 3MZEA 4LCLA 4N9LA 1LHYA 3FYZA 5DF8A 1GHMA 2H0TA 3BLMA 4KG5A 3S22A 4S2JA 4LENA 4EBNA 2Z2LB 4MLLA 4Q8IA 3WWXA 2PBYA 3W4OA 1ONGA 5M18A 2HDUA 1EWZA 3C4PA 5E2FA 1YQSA 5I94A 4ZAMA 4D2OA 4BD0A 2DCFA 1PZPA 5M19A 5DVAA 1TDGA 4JXWA 1TDLA 1M6KA 3CG5A 4P87A 2BLSA 4BD1A 2B5RA 4KZBA 1JVJA 1QMEA 4ZJ2A 5EVID 3SH9A 1KE3A 1E3UD 2WGWA 3Q81A 3ZDJA 4ZJ3A 1ZG4A 1OMEA 1ALQA 3HREA 3LY3A 4GKUA 5DTSA 3NIAA 4OLDA 1SDNA 3IT9A 5M1AA 1K56D 5DTTA 2RL3A 5FASA 3S1YA 2XFSA 3NCKA 3WS0A 5HAIA 4MEZA 1G68A 4E3LA 2WZXA 1FCOA 4JXVA 4IEDA 4JKTA 3UE0A 1I5QA 1E4DA 3S4XA 1S0WA 4C75A 3VOZA 5AQ7A 3LY4A 5FSRA 3ISGA 2XK1A 1C3BA 1DY6A 3O88A 4OOLA 2HDSA 3ZG8B 5CECA 4H8RA 4OOYA 2Q9MA 4XXRA 1I2WA 2JBFA 3BRMA 3G2ZA 4GDBA 2J8YA 2WGVA 3WS4A 2ZC5B 2HP9A 4OLGA 5HFOA 5TGFA 1K25A 1XP4A 2Y2QA 3G31A 1ESUA 3DTMA 2HPBA 3HBRA 3MKFA 2IWDA 1K6RA 2H0YA 3BEBA 3O87A 4WEJA 3UN7A 2WGWB 2E8IA 3NC8A 4JXSA 4P6BA 4HBUA 3D4FA 3FV7A 3AGFA 1U60A 1S6RA 2G2UA 1HTZA 5GLCA 5CGXA 4GN2A 4GB7A 5GLDA 2P9VA 1BTLA 2ZC7A 5JYPA 3NY4A 2A3UA 1WYBA 4JXGA 3M2JA 1FCNA 3PBTA 2EXAA 3IHAA 2V1ZA 4RVAA 5FQ9A 5A93A 2FFFB 4N1XA 1JTGA 4Y0UA 5DF9A 1KGGA 5GL9A 2Q9NA 3W4QA 3IF6C 3IWIA 4IBRA 2Y2NA 3VP3A 4PM8A 4EBPA 2WYXA 4KQOA 5GLBA 2OSUA 3A3JA 2WAEA 2ZD8A 4S2MA 1YLPA 4MBHA 1L2SA 4U0XA 5FI2A 2I72A 3IXHA 2PU2A 1RGYA 4DE2A 1K57C 4P85A 3ZNTA 5FDHA 5FI7A 5E2HA 2XLNA 4QD4A 2P74A 2UWXA 4X56A 2ZQCA 1HZOA 4S2NC 2J9PA 3PAEA 4WEKA 4DF6A 4IBXA 3ZG5A 5AQBA 3FZCA 2Y2KA 4UAAA 3BFCA 4OP8A 2VGKA 1YLWA 4BQMA 5KZHA 1KDSA 3BECA 1DJAA 3VFHA 3NI9A 4DE1A 1BUEA 1NJ4A 3AGEA 3Q1FA 3QNBA 1PI4A 4QY6A 3V50A 4S2LA 5A90A 5FAQA 3HLCA 3VP1A 5EVIA 1YLZA 1E3UA 1MPLA 2P9VB 3IXGA 4O7DA 1H5XA 1WE4A 1PI5A 2ZM8A 2Y91A 4E3NA 4GDNA 1EI5A 4KZ6A 1IYOA 2ZC3B 4E3JA 1K55C 2X02A 4N9KA 1K56A 1K4EA 5TR7A 5EOEA 1WYCA 3E2KA 1PYYA 4K0WA 1GCEA 5HW3A 5D3OA 3ZGAB 3G2YA 1ES4A 3ZVWA 1PWDA 1ES3A 1I2SA 2V2FF 5EECA 2G2WA 3BLSA 5J8XA 5CRFA 4WMCD 4NK3A 1LI0A 3BYDA 3I7JA 5DF7A 3G35A 4WZ5C 4DE0A 2WADA 4ZTKA 3C5AA 4BJPA 1YLYA 2ZLYA 1DJBA 1XGJA 5F83A 2A49A 4U3TA 1L0EA 2XEPA 4R0QA 2ZQAA 4C3QA 3ZCZA 4QU3A 2XQZA 4QB8A 2JC7A 3UPOA 4PPRA 1LL9A 5EVIB 4F94A 4X69A 3UDXA 3ZG0A 2IWBA 5CERA 4RX3A 1JWPA 3DW0A 1CEFA 5FQQA 2HP5A 5G18A 1KE4A 3HUMA 5TFQA 2C5WB 3SH7A 3ZNYA 1KDWA 4RX2A 4KZ4A 2EX6A 1BULA 1TEMA 3SS5A 3JYIA 3PTEA 2Y2HA 3Q7ZA 4MNRA 5HL1A 1K6SA 4WZ4A 3C7VA 3OPLA 3HLWA 4BL3A 5GHYA 5A92A 4S2KA 3LEZA 1PWGA 4KENB 4OKPA 4EQIA 1KVMA 3IH9A 3N8LA 3V39A 3PBRA 1XA7A 4BL2A 3WRTA 4WBGA 1YMSA 5AQAA 4LCMA 4HEFA 1FSYA 1BLHA 2C6WB 4OPQA 1MXOA 3A3DA 3OZHA 1Q2QA 2R9XA 2HDQA 1CI8A 1YLJA 4R3JA 3VSLA 5A91A 4M3KA 4OQHA 1Y54A 1YLTA 3G4PA 2XFTA 4X53A 3UPNA 1IYPA 3RXWA 1IYQA 1W5DA 4LV1A 1FR6A 4P0MA 4E3OA 1FOFA 3VMAA 5GLAA 2ZJ9A 1ZG6A 4GOGA 4YFMA 5DTKA 1NY0A 3N4IA 3PBQA 1SHVA 4OVDA 3WS5A 1LL5A 1KE0A 5F1GA 2HDRA 1H8ZA 3UO9A 3V3RA 4DE3A 4OPZA 2JCHA 1MY8A 3HL9A 1K4FA 2ZQDA 1NXYA 3GSGA 5HX9A 3DWKA 5E2GA 1ES5A 1MWSA 2BG1A 5HAPA 1NYMA 4KZAA
chains in the Genus database with same CATH superfamily
1K54C 5EM0A 1NRFA 4LV2A 4CJNA 4KZ5A 5FQJA 4WMCA 4S2PA 4Y5FA 1XX2A 4K91A 5CEBA 2H10A 4GLQA 5MC7A 3IQAA 4B4ZA 1HD8A 2WUQA 4IVKA 5KSHA 3ZHHA 2JKFA 5FAPA 1XFQA 2W27A 3P7NA 1XA1A 1D7EA 3MJQA 4XUXA 3E4PA 5G4YA 1GA9A 4NKPA 1S66L 4RA7A 5FATA 5EVIC 4E3MA 1MWTA 4KQQA 4OQIA 3LI8A 4PKYG 1D1JA 3PBOA 4XT2A 1ERMA 3DAVA 3VE4A 2Y2IA 2EX9A 2KOIA 3MQOA 3E4OA 3GMWA 2G7UA 3TOIA 4EUZA 4P6ZS 4L9FA 1IKIA 2DNSA 1BLSA 3G34A 4X1LA 4QY5A 1AXBA 3BFGA 3QP8A 1DP6A 3MBZA 3EQUA 4MBKA 2Z2MB 4Z9QA 4JPMA 3N8SA 1MWUA 4R3BA 4FSFA 4ARZB 1F2KA 3BQ8A 5CHUA 4EUVA 3UNWA 1SCWA 1ZKJA 2OWHA 2Y2MA 1CJFA 4WN5A 2WKPA 1KGEA 1M40A 1TF1A 3CPTB 3DTEA 2ZMVA 3PBNA 3ZG9B 4ZBEA 2Y59A 1NLYA 4M4XA 3B42A 2W3GA 4OQGA 1V9YA 1VB6A 4KG6A 4LRXC 1MKMA 2V0UA 3SS3A 1K54A 3Q7VB 1E25A 3PAGA 1CQAA 5TBMA 3HLBA 1N9OA 4D60A 5CHJA 3ZFZA 4NETA 4PKYA 4Y17A 5EM1A 3LEQA 2W3FA 2Y2LA 5CHMA 1TS8A 2VGJA 2ZQ9A 1G6OA 2PR5A 4II7A 4EBLA 4GHIB 2D01A 1K55A 2B18A 3DWZA 5L10A 2K2NA 4EEUA 5HPIA 2V8CA 3B47A 4WM9A 1YM1A 2J9OA 2VEAA 2ZQ8A 3H82A 3FKWA 2EX2A 3MXSA 3UMDA 3LCEA 3HVFA 5FI6A 4KG2A 1YSPA 4LCLA 4N9LA 1LHYA 2W1TA 3DBAA 2H0TA 4GW9A 4EBNA 2GNXA 1P9RA 2Z2LB 3C2WA 1YPRA 3PHYA 1WA9A 1VEUB 2W3HA 4D2OA 3C38A 5K5BA 1PZPA 4HI4A 1TDLA 1M6KA 2QWSA 4BD1A 2B5RA 4ZJ2A 3SH9A 4NXBA 2J3WA 1ZG4A 4LGWA 1ALQA 3HREA 5M1AA 4F3LA 1K56D 5DTTA 3S1YA 3WS0A 1LL8A 3KSIA 4MEZA 1XJ2A 2WZXA 1FCOA 4IEDA 4PAUA 4EERA 5AQ7A 1UGUA 3EOIA 1DY6A 2HDSA 3ZG8B 1G5UA 4GDBA 4HJ6A 3RH8B 1K25A 3S7PA 4WEJA 3UN7A 2WGWB 3ICYA 4P6BA 3FV7A 2G2UA 5GLCA 5CGXA 4GB7A 1BTLA 3H9WA 1DP8A 4LRZE 1WYBA 4L9EA 3M2JA 3PBTA 3IHAA 4JGPA 2HV1A 5A93A 4N1XA 3W4QA 1JTGA 5DF9A 3IF6C 3IWIA 4ME4A 1IFQA 1L2SA 1RGYA 2J80A 1K57C 3TW8A 2O9AA 2H28A 4HH3A 2J9PA 3PAEA 4IBXA 4IJGA 3ZG5A 3NI9A 2J3TC 4S2LA 5A90A 1P9WA 5FAQA 2BASA 3VP1A 2P9VB 1MPLA 1H5XA 1EI5A 2X02A 1K56A 3V67A 2W3EA 3CI6A 5TR7A 1WYCA 4K0WA 5D3OA 2IA2A 3ZVWA 3LGOA 5EECA 3I7JA 5DF7A 4DE0A 2XROA 4G3WA 3QP4A 2ZLYA 5IT5A 1XGJA 2A49A 1L0EA 4R0QA 4HHDA 2XQZA 3UPOA 3NULA 1LL9A 4F94A 4RX3A 4JGQA 3BQAA 2C5WB 1KDWA 4RX2A 2EX6A 2Y2HA 3Q7ZA 2ZOIA 1IOUA 5GHYA 5G4ZA 4OKPA 3V39A 5AJGA 4BL2A 3WRTA 4WBGA 1FSYA 1BLHA 4OPQA 1MXOA 2R9XA 2HDQA 1VETB 3IBRA 1XJ4A 1YLTA 3LR3A 2OOLA 1IYPA 4LV1A 4E3OA 4I3AA 5GLAA 2ZJ9A 4GOGA 3N4IA 3D9YA 4HNBA 1SHVA 3UO9A 2QJ5A 3MF0A 2JCHA 3L7HA 1K4FA 4WF0A 2GX5A 3GSGA 3QP1A 3IX8A 2EWWA 1YKDA 3A0RA 1NYMA 5KMWA 1PW1A 5GHXA 3A3FA 4BBUA 2O0YA 3IF6A 3OPPA 2Y2JA 2JKTM 4IVIA 3UE6A 3R7WA 3GV9A 1IYSA 1GA0A 1K57A 2EFXA 2WZZA 1PW8A 4FH4A 4Y0TA 1V9ZA 4OPYA 1VQQA 5AVEA 4DXCA 2W1RA 3HLEA 1YSQA 4LFUA 4C6YA 1RCJA 4E3IA 4KUKA 3IX4A 5CTMA 3SS4A 2WK0A 4PM7A 4GD6A 5EVEA 1L3LA 2O9BA 3E0YA 5U47A 1JNUA 1SDEA 2PR6A 4K08A 1PZOA 1NYYA 5DFXA 3P09A 2J7VA 3MKEA 3HUNA 5HWWA 1XPBA 3WS2A 4YOFA 3M6BA 4K0XA 4QPRA 3S7NA 1Z6FA 1D06A 3EEAA 4I39A 4UQIS 4DJ2A 3Q07A 2YKFA 4UA9A 1N9LA 3HCYA 2I9VA 1ESIA 2JHEA 4BBTA 5HL6A 2PYPA 1LLBA 4KZ8A 2XD5A 4WELA 3BFEA 3Q82A 1MKIA 3E98A 1OJ5A 2XF3A 4E6WA 3LYXA 3NDGA 4LPZA 1YMXA 1H8MA 2R9WA 4ID4A 4Q0HA 4UA6A 3WRZA 3UDIA 2XSSA 2A24B 4FUWA 4NXFA 3FWLA 1JWZA 3VP4A 5JYOA 3EQVA 1UWPX 5CGSA 3W8KA 3ITBA 4UA7A 1XJ3A 1EW0A 3F1PA 4N1HA 3UPPA 5FAOA 2Y2PA 4GNUA 3KYZA 2W0NA 2PDRA 3HLFA 2WGIA 3AGDA 2PU4A 3SH8A 1TS0A 1HVBA 3CUEC 5CEDA 1LT0A 3IS2B 2WKIA 1Q2PA 1RP5A 3OCLA 3ITAA 4N92A 2NUPC 1PIOA 2XGNA 1T18A 3MS6A 1GSWA 2JKRM 1IKGA 5FQIA 3D72A 2BTFP 4OONA 5E2EA 4BWIA 1STZA 2VKSA 2ZQ7A 1TVFA 3T12B 3OPHA 4S2OA 3CITA 4S2NA 1Y28A 2V20A 5EE8A 1XJ6A 3LO7A 3LR0A 2WKRA 1CEGA 2KX6A 5CXWA 2WKQA 3C8CA 1J9MA 2A2LA 1O07A 5DJUA 4R3AA 5CTNA 4JGOA 3RJUA 1OTAA 2FH5A 4FD8A 3A0VA 2Y8HA 4Y0OA 3T1SA 1YT4A 2EX8A 3NOUC 1OT9A 4Y7PA 1OTDA 3CJMA 4B4XA 3IF5A 1L0GA 1QMFA 3C4OA 3F1OB 3LUQA 4A5RA 4O01A 3G30A 4KZ9A 1K38A 2FFYA 3MXQA 1LSXA 3V3SA 4OPRA 3QP2A 3FYZA 3K3CA 5DF8A 1GHMA 4KG5A 4ZRRA 4NG2A 4UEYA 4MLLA 4Q8IA 5HSQA 3WWXA 1VHMA 5HPFA 1ONGA 5M18A 1EWZA 3C4PA 1YQSA 3UMEA 4BD0A 2DCFA 1TS7A 4I3IA 5EVID 1E3UD 2XA7M 4ZJ3A 4G3VA 1SDNA 4L9GA 2XFSA 5HAIA 4E3LA 2ZL1B 3H7WB 4JKTA 3UE0A 1I5QA 1S0WA 4C75A 2M7UA 4OOYA 1H3QA 2JBFA 3WS4A 2ZC5B 3CLOA 5TGFA 2Y2QA 3HBRA 2IWDA 4HP9A 3BEBA 4Z1WA 2E8IA 4JXSA 2AVXA 2K7SA 2M1CA 3AGFA 2XRNA 2V0WA 4GN2A 3NY4A 4JXGA 2ZOHA 1ZHHB 1FCNA 2EXAA 4RVAA 4HIAA 1Z09A 5L8MA 4Y0UA 2Q9NA 4IBRA 3CHWP 1YLPA 3C30A 4U0XA 5FI2A 2VGLM 2B95A 2PU2A 4DE2A 3ZNTA 3MQQA 5L07A 5E2HA 2XLNA 2UWXA 1HZOA 4DF6A 1P0ZA 2UV0E 2VGKA 5KZHA 5IU1A 1NJ4A 5EVIA 4GS9B 1E3UA 4ETZA 4E3NA 4MN5A 2Y91A 3W2ZA 4GDNA 3K2NA 2PD7A 2JN7A 4N9KA 4LRYC 3ZQ5A 1PYYA 1GCEA 5HD3A 1ES4A 3A0SA 1ES3A 1I2SA 1S4SA 5DKLA 4EQ1A 4NK3A 3BYDA 4WZ5C 3C5AA 1DJBA 3T4SA 4HQAA 4Q0JA 3MQ0A 1DRMA 1NLZA 4PPRA 3ZG0A 5CERA 1NRJA 3T4TA 3B33A 4DMZA 4AFIA 5TFQA 4BBVA 3OBFA 1TEMA 3SS5A 4MNRA 1J3WA 2O9CA 3C7VA 3OPLA 3HLWA 4BL3A 3LEZA 1PWGA 4KENB 4EQIA 1KVMA 3IH9A 2HJ9C 5F5YA 1XA7A 2L4RA 4LCMA 2M7VA 4MN7A 3DTKA 2Z6DA 3OZHA 3T1QB 4DJ3A 5A91A 5HDSA 4CLCB 2INWA 4HOIA 2KDKA 4X53A 2W3DA 5FEGA 4YFMA 1NY0A 3PBQA 3WS5A 1KE0A 5F1GA 3V3RA 1PFLA 4OPZA 3UB5P 3D3OA 2ZQDA 1ES5A 1MWSA 2BG1A 3LICA 5FEFA 2XD1A 3OPRA 2OAP1 2GJ3A 1FCMA 1XGIA 4HBTA 1W79A 4KZ3A 2WKHA 5HWTA 3F1NB 4H6JB 4EETB 1SKOB 3N8RA 4O8GA 4X1MA 3IWOA 3UB9A 4HY8A 3E2LA 2B02A 4X6TA 1W7FA 5F69A 1N9NA 2L1MA 3C7UA 3KYQA 4MBFA 1XKZA 5KIZA 3KO6A 3IXDA 3NDEA 2VK3A 3UDFA 2Y2OA 4R4SA 2ZC4B 2R78A 5F6AA 2OLUA 2X01A 4ARZA 3N7WA 4WZ5A 4PM6A 4GD8A 1BZAA 3VP2A 3V5MA 3BM6A 1ONHA 4HH2A 3RXXA 2QYBA 3CPTA 1SZVA 5HAQA 2Y4AA 4PM5A 4JF4A 2J3TD 1O7EA 1TS6A 2OV5A 1W63M 4XUZA 4CLCE 2ZMFA 1MWRA 1HLUP 1BSGA 4CLCC 4FCFA 3HUOA 4FH2A 5KSCA 4ETXA 1S4RA 4XT2B 4E3KA 2Q0OA 4BMWA 2VA0A 3VOLA 2P08A 4HJ4A 1VM1A 1PNEA 3Q7VA 3A3IA 5FA7A 3O5YA 1G6AA 1FQGA 3GTCA 3OCNA 3MXRA 4MCWA 1N4OA 4MN6A 3LR4A 4R1GA 4R23A 2HP6A 3K3DA 2RCXA 2P7JA 2EFUA 4L0LA 5FQKA 5EUAA 3CZDA 3BFFA 3BW6A 2X71A 4GHIA 5HARA 4CLCD 2JKTI 1W8QA 2WAFA 3W4PA 3CWFA 3KSFA 1GHPA 5CX7A 3FC7A 3S7QA 4MMNA 4JBFA 1EROA 4DXBA 1JWVA 5FQMA 1H8YA 2DRWA 3T4QA 5L2FA 4EESA 4DN0A 2PHYA 4DDSA 1BLCA 2ZMAA 4OH0A 5F82A 3TG9A 4EWFA 4WLAA 4B93A 1ERQA 5J4EA 3T4LA 5J7EA 1VEUA 5IHVA 3OOVA 1FILA 1MBLA 1S1YA 1X0OA 4JF6A 3ZG7B 4KQRA 5TBMB 3B3XA 3LIDA 3IHBA 3UB8A 1XXMA 1PRQA 2GZAA 1NZOA 5CGWA 1IEMA 1FR1A 2GDNA 3JVUA 4R70A 4CPKA 5J3WA 3P98A 5L09A 3T4KA 3MZEA 1H0MA 3DTIA 3BLMA 3S22A 3UB7A 4LENA 2JKGA 1YAXA 2VV6A 1ACFA 1OTIA 4GCZA 2PBYA 2HDUA 5EFWA 5I94A 3T4OA 3FG8A 5DVAA 1TDGA 4Q0IA 4P87A 2BLSA 4KZBA 1QMEA 3BJNA 2WGWA 3ZDJA 4I38A 3H82B 3LY3A 4GKUA 4OLDA 2RL3A 3LI9A 4Y3IA 2W1TB 1G68A 2EA9A 2VV8A 1E4DA 3S4XA 3T1XA 3LY4A 5FSRA 3ISGA 2OAQ1 4OOLA 4H8RA 4XXRA 4Y13A 1T19A 3BRMA 2WGVA 2HP9A 4OLGA 5HFOA 2D02A 1XP4A 3G31A 1ESUA 2HPBA 3KSHA 3MKFA 3L9KA 1K6RA 2PT7A 2JKRI 4HBUA 2PD8A 1U60A 2EWVA 1S6RA 1HTZA 5GLDA 4F3LB 2MJ6A 2P9VA 2A3UA 3JPUA 2V1ZA 5FQ9A 5GL9A 3MMHA 2OWJA 2Y2NA 4EBPA 2WYXA 5GLBA 2OSUA 4S2MA 4KQDA 4MBHA 2I72A 4IUKA 3G6OA 5FI7A 4X56A 4WEKA 2QHKA 3T1RA 2E8JA 5AQBA 3FZCA 3BFCA 4BQMA 2PBDP 3R4KA 4DE1A 1PI4A 3HLCA 1YLZA 3IXGA 1WE4A 4QWOA 3KSGA 4KZ6A 2ZC3B 4E3JA 1K55C 1K4EA 1T1AA 5HW3A 3ZGAB 2V2FF 1LSVA 3FPVA 5CRFA 2PAVP 3GECA 1LI0A 5I5LA 1ODVA 2WADA 5HDDA 2P04A 5F83A 4U3TA 2XEPA 1NWZA 2ZQAA 4QU3A 2JC7A 4EEPA 3IX3A 1VETA 3UDXA 5HD5A 2KLIA 4P6ZM 3DW0A 1CEFA 5FQQA 2HP5A 5G18A 1OTEA 3ZNYA 3SH7A 4KZ4A 1BULA 2NUTC 2V8FA 3JYIA 1MZUA 2XA7S 5HL1A 1K6SA 4WZ4A 5A92A 4S2KA 1KOUA 4I3JA 3N8LA 1T1BA 1Y4OA 4FOFA 2C6WB 3S7OA 3A3DA 1Q2QA 1CI8A 1YLJA 4R3JA 2LB9A 3VSLA 4M3KA 1Y54A 2XFTA 3RXWA 1IYQA 1W5DA 5DTKA 1ZG6A 3CUEA 1P97A 1F9IA 1H8ZA 2HDRA 3PR6A 4DE3A 4R38A 4FTXA 3DWKA 3BY8A 5HAPA 4C3QA 4KZAA 3HLGA 4IUHA 1DJCA 2DMWA 4YWZA 4PMAA 2Y2GA 1F5MA 2VGLS 1CK3A 5GHZA 2O99A 4X55A 4X68A 3NOPC 3WS1A 2Z6CA 3MFDA 4WL9A 1BYWA 4OOMA 3NJAA 4PM9A 4JF5A 3GR2A 3VOYA 4GJ4A 2K31A 1JTDA 1MC0A 5F1FA 2VJWA 3MZDA 5FDSA 5AQ9A 3IF6B 3IH8A 4JLFA 3VP0A 3GVBA 1RGZA 1N9BA 2JE5A 2A24A 3CMZA 3R7WB 4ESPA 1FSWA 3VSKA 1UWNX 3TJZC 1GHIA 2CC1A 2IWCA 2PRFA 1S1ZA 2YKHA 2VV7A 4LV0A 3M6HA 1OPXA 2QZ6A 4Y15A 1NZUA 3VFFA 2WKEA 4EW7A 2Y55A 4EV4A 1L0DA 2XH9A 3MZFA 1K0KA 3IWQA 2ZM2A 3NHQA 3NBLA 3IXBA 1L0FA 3O3VA 1KGFA 4YNRA 3QNCA 3BFDA 3N6IA 4RQ9A 1DP9A 3IS2A 4WYYA 3FKVA 4DKIA 4ZJ1A 2QJ7A 4GZBA 1ZC2A 2H5SA 2OLVA 2XR0A 3M2KA 3G32A 4U0TA 3MSHA 1AWIA 4DRTA 3BY9A 4RYEA 4X25A 3OLOA 4UHUA 3E4QA 2EXBA 3EWKA 4BENA 1W8YA 1LI9A 3QHYA 3EGDC 1ZTUA 1BT5A 3A3EA 3UB6A 3BWLA 1PWCA 1XFNA 3HJIA 3TRCA 3PBSA 4S2IA 4LV3A 4B9OA 2QMIA 3NOTC 3OC2A 3FPWA 3HLDA 4KUOA 5EPHA 3ZVTA 4HJ3A 5EV0A 4YINA 4ZDXA 3JVVA 1CI9A 5EOOA 3GQZA 4BLMA 1GSXA 2QPNA 3F1OA 2ZM0A 4KZ7A 3UE1A 1IELA 3F1PB 4CQHA 3TSGA 3UY6A 3QP5A 1LSWA 1SKFA 2ZC6B 1BLPA 4OQ0A 4E04A 4DDYA 4OP5A 3QP6A 1GSVA 5E43A 5HDCA 4QJGA 3SOIA 3TE8A 4HP4A 2VX8A 5BOHA 2PYRA 2XDMA 3T50A 3UE3A 4QHCA 1CF0A 2HJEA 4I5SA 1KVLA 5EVLA 3O86A 3MFXA 4E6XA 4B88A 3GRJA 1ES2A 4R4RA 4HESA 4R6LA 1A0KA 2ZL1A 3H7WA 4S2JA 5AVFA 5IS1A 2L0WA 2VZWA 3W4OA 5E2FA 4ZAMA 3RTYA 3VV4A 5M19A 4JXWA 3CG5A 2QKPA 1JVJA 5TJJA 1KE3A 3Q81A 3PYPA 3CAXA 3U2AA 4PHTA 1OMEA 2ACGA 2V1AA 5DTSA 3NIAA 3IT9A 5FASA 3NCKA 5F68A 4LLOB 3VE3A 3ULFA 3P01A 3LFVA 4JXVA 3LIFA 4NXGA 3VOZA 4JGRA 2V1BA 2XK1A 2HF6A 4NEED 1C3BA 3O88A 5CECA 1G28A 2Q9MA 1I2WA 3G2ZA 2J8YA 2V9AA 5LBRA 3DTMA 1T1CA 2H0YA 3O87A 3SZTA 3NC8A 1OJGA 3KYEA 3D4FA 5C5KA 4GS9A 2ZC7A 5JYPA 1TD5A 1F98A 2FFFB 1KGGA 1OT6A 3HJKA 1W63Q 3VP3A 4PM8A 4KQOA 3A3JA 2WAEA 2ZD8A 5HZHA 3IXHA 4G3KA 4P85A 5FDHA 3LIBA 2Y79A 4QD4A 2P74A 2ZQCA 4S2NC 3EEHA 3RFBA 2Y2KA 4UAAA 4OP8A 1YLWA 1KDSA 3BECA 1DJAA 3VFHA 3SW1A 1BUEA 2VLGA 3AGEA 3Q1FA 3QNBA 4QY6A 3U4LP 3V50A 5DFYA 4O7DA 1PI5A 2ZM8A 4NXEA 1IYOA 1S67L 2HGVA 2ZBBA 5FL3A 5EOEA 3E2KA 3G2YA 1PWDA 4UQIM 2G2WA 4MDZA 3BLSA 5J8XA 4WMCD 3G35A 5A8BA 4ZTKA 2HZ5A 4BJPA 1FIKA 1YLYA 5DJTA 2FZ0A 3ZCZA 2CMNA 3PXPA 4QB8A 4CLCA 5EVIB 4X69A 2IWBA 4IHQA 1JWPA 1KE4A 3HUMA 3PTEA 1OTBA 3LIAA 4EU0A 4O0PA 3LIEA 3EGXC 3KX0X 3PBRA 4Y2FA 1YMSA 5AQAA 4EXOA 4HEFA 5DKKA 5HWVA 3GDIA 3ZYTA 3NECA 4OQHA 3G4PA 3UPNA 3MR0A 3F1NA 4H6JA 1FR6A 4P0MA 1FOFA 1SKOA 3VMAA 3LR5A 4OVDA 1LL5A 2LB5A 1MY8A 3T4JA 3HL9A 3IBJA 4WUJA 1NXYA 5HX9A 5E2GA
chains in the Genus database with same CATH topology
3HLGA 5KMWA 1DJCA 1PW1A 5GHXA 1K54C 1NRFA 4LV2A 3A3FA 4CJNA 2XD1A 4PMAA 2Y2GA 3OPRA 4KZ5A 3IF6A 5FQJA 4WMCA 3OPPA 4S2PA 2Y2JA 4IVIA 1CK3A 1FCMA 1XGIA 5GHZA 4HBTA 1XX2A 4K91A 3GV9A 5CEBA 1IYSA 4X55A 1GA0A 1K57A 1W79A 2EFXA 2H10A 2WZZA 4KZ3A 2WKHA 3IQAA 4X68A 1PW8A 4FH4A 4B4ZA 1HD8A 2WUQA 4IVKA 4Y0TA 3WS1A 3N8RA 4OPYA 1VQQA 3MFDA 5KSHA 3ZHHA 4DXCA 3HLEA 5FAPA 3IWOA 4C6YA 1RCJA 4E3IA 4OOMA 1XA1A 4PM9A 4JF5A 5CTMA 3SS4A 2WK0A 3GR2A 4PM7A 3E2LA 4GD6A 4XUXA 3VOYA 5U47A 1GA9A 4X6TA 1JTDA 1W7FA 1SDEA 1PZOA 1NYYA 3P09A 2J7VA 5F1FA 4RA7A 3MKEA 5FATA 3MZDA 3C7UA 3HUNA 5EVIC 1XPBA 5AQ9A 4E3MA 3WS2A 1MWTA 1XKZA 3M6BA 4K0XA 4KQQA 4MBFA 3IF6B 4OQIA 3IH8A 4JLFA 3VP0A 3IXDA 3GVBA 1RGZA 1N9BA 1Z6FA 3NDEA 2JE5A 3PBOA 1ERMA 3CMZA 3UDFA 2Y2OA 4R4SA 3Q07A 1FSWA 2ZC4B 3VSKA 4UA9A 1GHIA 2OLUA 2CC1A 2Y2IA 2EX9A 2X01A 1ESIA 2IWCA 3N7WA 4WZ5A 4LV0A 4PM6A 3M6HA 4GD8A 1LLBA 2QZ6A 1NZUA 3VFFA 1BZAA 2WKEA 4KZ8A 2Y55A 3GMWA 3VP2A 4EV4A 1L0DA 3V5MA 2XD5A 1ONHA 3BM6A 2XH9A 3MZFA 4WELA 3BFEA 3RXXA 3TOIA 3Q82A 4EUZA 3IWQA 1MKIA 5HAQA 2ZM2A 2Y4AA 4PM5A 4JF4A 1O7EA 2XF3A 2OV5A 1IKIA 4XUZA 4E6WA 3NBLA 3IXBA 2DNSA 1L0FA 1BLSA 3G34A 1MWRA 3O3VA 3NDGA 4QY5A 1AXBA 3BFGA 1BSGA 1KGFA 1YMXA 2R9WA 4ID4A 4FCFA 3QNCA 3BFDA 3HUOA 3MBZA 3EQUA 3N6IA 4FH2A 4MBKA 2Z2MB 4UA6A 3WRZA 5KSCA 3UDIA 4Z9QA 4JPMA 4E3KA 3N8SA 1MWUA 4WYYA 3FKVA 4R3BA 4DKIA 3FWLA 4ZJ1A 4FSFA 4GZBA 1JWZA 1ZC2A 3VP4A 1VM1A 5JYOA 3EQVA 2H5SA 2XR0A 2OLVA 3M2KA 3G32A 3A3IA 3Q7VA 4U0TA 5CGSA 5CHUA 3UNWA 1SCWA 3W8KA 4DRTA 3ITBA 1ZKJA 4RYEA 4UA7A 1G6AA 5FA7A 1FQGA 2Y2MA 4UHUA 3GTCA 3OCNA 1KGEA 2EXBA 3MXRA 1M40A 1N4OA 4BENA 4R1GA 4R23A 1W8YA 2HP6A 1LI9A 3QHYA 1BT5A 3A3EA 4N1HA 2RCXA 3UPPA 1PWCA 2EFUA 4L0LA 5FQKA 3PBNA 3PBSA 5EUAA 4S2IA 3ZG9B 3CZDA 5FAOA 2Y2PA 4LV3A 4GNUA 4ZBEA 2QMIA 2Y59A 3HLFA 2WGIA 3BFFA 3OC2A 3HLDA 3AGDA 2PU4A 3SH8A 1HVBA 5CEDA 2X71A 5EPHA 3ZVTA 5HARA 2WKIA 1Q2PA 1RP5A 4OQGA 3OCLA 3ITAA 4N92A 1W8QA 1PIOA 2XGNA 4KG6A 2WAFA 3W4PA 3SS3A 1K54A 3Q7VB 4YINA 1IKGA 1GHPA 5FQIA 4ZDXA 1E25A 1CI9A 4OONA 5E2EA 3PAGA 5EOOA 2ZQ7A 3GQZA 4JBFA 4BLMA 1EROA 2QPNA 1TVFA 2ZM0A 4KZ7A 3HLBA 3UE1A 4DXBA 3OPHA 5CHJA 3ZFZA 1JWVA 4S2OA 4NETA 1H8YA 5FQMA 2DRWA 1IELA 4S2NA 2V20A 5EE8A 3TSGA 3UY6A 5L2FA 3LO7A 1CEGA 1SKFA 5CXWA 1J9MA 2ZC6B 2Y2LA 4DDSA 1BLCA 1BLPA 1O07A 4OQ0A 4DDYA 2ZMAA 4OH0A 5CHMA 5F82A 3TG9A 2VGJA 2ZQ9A 4EWFA 4OP5A 5CTNA 3RJUA 5E43A 1ERQA 4FD8A 4EBLA 4QJGA 3SOIA 4Y0OA 1YT4A 2EX8A 1K55A 3DWZA 5IHVA 4Y7PA 3CJMA 1MBLA 4B4XA 5BOHA 3IF5A 2XDMA 1L0GA 4JF6A 3UE3A 3ZG7B 4QHCA 4WM9A 1QMFA 1YM1A 3C4OA 4KQRA 2J9OA 3B3XA 4A5RA 1KVLA 3IHBA 5EVLA 3O86A 2ZQ8A 1XXMA 4E6XA 4B88A 3FKWA 3GRJA 1ES2A 2EX2A 1NZOA 3G30A 3MXSA 4R4RA 4KZ9A 5CGWA 1IEMA 1K38A 1FR1A 2GDNA 4CPKA 2FFYA 3LCEA 4HESA 3HVFA 3P98A 5FI6A 4KG2A 3V3SA 4OPRA 3MZEA 4LCLA 4N9LA 1LHYA 3FYZA 5DF8A 1GHMA 2H0TA 3BLMA 4KG5A 3S22A 4S2JA 4LENA 4EBNA 2Z2LB 4MLLA 4Q8IA 3WWXA 2PBYA 3W4OA 1ONGA 5M18A 2HDUA 1EWZA 3C4PA 5E2FA 1YQSA 5I94A 4ZAMA 4D2OA 4BD0A 2DCFA 1PZPA 5M19A 5DVAA 1TDGA 4JXWA 1TDLA 1M6KA 3CG5A 4P87A 2BLSA 4BD1A 2B5RA 4KZBA 1JVJA 1QMEA 4ZJ2A 5EVID 3SH9A 1KE3A 1E3UD 2WGWA 3Q81A 3ZDJA 4ZJ3A 1ZG4A 1OMEA 1ALQA 3HREA 3LY3A 4GKUA 5DTSA 3NIAA 4OLDA 1SDNA 3IT9A 5M1AA 1K56D 5DTTA 2RL3A 5FASA 3S1YA 2XFSA 3NCKA 3WS0A 5HAIA 4MEZA 1G68A 4E3LA 2WZXA 1FCOA 4JXVA 4IEDA 4JKTA 3UE0A 1I5QA 1E4DA 3S4XA 1S0WA 4C75A 3VOZA 5AQ7A 3LY4A 5FSRA 3ISGA 2XK1A 1C3BA 1DY6A 3O88A 4OOLA 2HDSA 3ZG8B 5CECA 4H8RA 4OOYA 2Q9MA 4XXRA 1I2WA 2JBFA 3BRMA 3G2ZA 4GDBA 2J8YA 2WGVA 3WS4A 2ZC5B 2HP9A 4OLGA 5HFOA 5TGFA 1K25A 1XP4A 2Y2QA 3G31A 1ESUA 3DTMA 2HPBA 3HBRA 3MKFA 2IWDA 1K6RA 2H0YA 3BEBA 3O87A 4WEJA 3UN7A 2WGWB 2E8IA 3NC8A 4JXSA 4P6BA 4HBUA 3D4FA 3FV7A 3AGFA 1U60A 1S6RA 2G2UA 1HTZA 5GLCA 5CGXA 4GN2A 4GB7A 5GLDA 2P9VA 1BTLA 2ZC7A 5JYPA 3NY4A 2A3UA 1WYBA 4JXGA 3M2JA 1FCNA 3PBTA 2EXAA 3IHAA 2V1ZA 4RVAA 5FQ9A 5A93A 2FFFB 4N1XA 1JTGA 4Y0UA 5DF9A 1KGGA 5GL9A 2Q9NA 3W4QA 3IF6C 3IWIA 4IBRA 2Y2NA 3VP3A 4PM8A 4EBPA 2WYXA 4KQOA 5GLBA 2OSUA 3A3JA 2WAEA 2ZD8A 4S2MA 1YLPA 4MBHA 1L2SA 4U0XA 5FI2A 2I72A 3IXHA 2PU2A 1RGYA 4DE2A 1K57C 4P85A 3ZNTA 5FDHA 5FI7A 5E2HA 2XLNA 4QD4A 2P74A 2UWXA 4X56A 2ZQCA 1HZOA 4S2NC 2J9PA 3PAEA 4WEKA 4DF6A 4IBXA 3ZG5A 5AQBA 3FZCA 2Y2KA 4UAAA 3BFCA 4OP8A 2VGKA 1YLWA 4BQMA 5KZHA 1KDSA 3BECA 1DJAA 3VFHA 3NI9A 4DE1A 1BUEA 1NJ4A 3AGEA 3Q1FA 3QNBA 1PI4A 4QY6A 3V50A 4S2LA 5A90A 5FAQA 3HLCA 3VP1A 5EVIA 1YLZA 1E3UA 1MPLA 2P9VB 3IXGA 4O7DA 1H5XA 1WE4A 1PI5A 2ZM8A 2Y91A 4E3NA 4GDNA 1EI5A 4KZ6A 1IYOA 2ZC3B 4E3JA 1K55C 2X02A 4N9KA 1K56A 1K4EA 5TR7A 5EOEA 1WYCA 3E2KA 1PYYA 4K0WA 1GCEA 5HW3A 5D3OA 3ZGAB 3G2YA 1ES4A 3ZVWA 1PWDA 1ES3A 1I2SA 2V2FF 5EECA 2G2WA 3BLSA 5J8XA 5CRFA 4WMCD 4NK3A 1LI0A 3BYDA 3I7JA 5DF7A 3G35A 4WZ5C 4DE0A 2WADA 4ZTKA 3C5AA 4BJPA 1YLYA 2ZLYA 1DJBA 1XGJA 5F83A 2A49A 4U3TA 1L0EA 2XEPA 4R0QA 2ZQAA 4C3QA 3ZCZA 4QU3A 2XQZA 4QB8A 2JC7A 3UPOA 4PPRA 1LL9A 5EVIB 4F94A 4X69A 3UDXA 3ZG0A 2IWBA 5CERA 4RX3A 1JWPA 3DW0A 1CEFA 5FQQA 2HP5A 5G18A 1KE4A 3HUMA 5TFQA 2C5WB 3SH7A 3ZNYA 1KDWA 4RX2A 4KZ4A 2EX6A 1BULA 1TEMA 3SS5A 3JYIA 3PTEA 2Y2HA 3Q7ZA 4MNRA 5HL1A 1K6SA 4WZ4A 3C7VA 3OPLA 3HLWA 4BL3A 5GHYA 5A92A 4S2KA 3LEZA 1PWGA 4KENB 4OKPA 4EQIA 1KVMA 3IH9A 3N8LA 3V39A 3PBRA 1XA7A 4BL2A 3WRTA 4WBGA 1YMSA 5AQAA 4LCMA 4HEFA 1FSYA 1BLHA 2C6WB 4OPQA 1MXOA 3A3DA 3OZHA 1Q2QA 2R9XA 2HDQA 1CI8A 1YLJA 4R3JA 3VSLA 5A91A 4M3KA 4OQHA 1Y54A 1YLTA 3G4PA 2XFTA 4X53A 3UPNA 1IYPA 3RXWA 1IYQA 1W5DA 4LV1A 1FR6A 4P0MA 4E3OA 1FOFA 3VMAA 5GLAA 2ZJ9A 1ZG6A 4GOGA 4YFMA 5DTKA 1NY0A 3N4IA 3PBQA 1SHVA 4OVDA 3WS5A 1LL5A 1KE0A 5F1GA 2HDRA 1H8ZA 3UO9A 3V3RA 4DE3A 4OPZA 2JCHA 1MY8A 3HL9A 1K4FA 2ZQDA 1NXYA 3GSGA 5HX9A 3DWKA 5E2GA 1ES5A 1MWSA 2BG1A 5HAPA 1NYMA 4KZAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HLG A;  5KMW A;  1DJC A;  1PW1 A;  5GHX A;  1K54 C;  1NRF A;  4LV2 A;  3A3F A;  4CJN A;  2XD1 A;  4PMA A;  2Y2G A;  3OPR A;  4KZ5 A;  3IF6 A;  5FQJ A;  4WMC A;  3OPP A;  4S2P A;  2Y2J A;  4IVI A;  1CK3 A;  1FCM A;  1XGI A;  5GHZ A;  4HBT A;  1XX2 A;  4K91 A;  3GV9 A;  5CEB A;  1IYS A;  4X55 A;  1GA0 A;  1K57 A;  1W79 A;  2EFX A;  2H10 A;  2WZZ A;  4KZ3 A;  2WKH A;  3IQA A;  4X68 A;  1PW8 A;  4FH4 A;  4B4Z A;  1HD8 A;  2WUQ A;  4IVK A;  4Y0T A;  3WS1 A;  3N8R A;  4OPY A;  1VQQ A;  3MFD A;  5KSH A;  3ZHH A;  4DXC A;  3HLE A;  5FAP A;  3IWO A;  4C6Y A;  1RCJ A;  4E3I A;  4OOM A;  1XA1 A;  4PM9 A;  4JF5 A;  5CTM A;  3SS4 A;  2WK0 A;  3GR2 A;  4PM7 A;  3E2L A;  4GD6 A;  4XUX A;  3VOY A;  5U47 A;  1GA9 A;  4X6T A;  1JTD A;  1W7F A;  1SDE A;  1PZO A;  1NYY A;  3P09 A;  2J7V A;  5F1F A;  4RA7 A;  3MKE A;  5FAT A;  3MZD A;  3C7U A;  3HUN A;  5EVI C;  1XPB A;  5AQ9 A;  4E3M A;  3WS2 A;  1MWT A;  1XKZ A;  3M6B A;  4K0X A;  4KQQ A;  4MBF A;  3IF6 B;  4OQI A;  3IH8 A;  4JLF A;  3VP0 A;  3IXD A;  3GVB A;  1RGZ A;  1N9B A;  1Z6F A;  3NDE A;  2JE5 A;  3PBO A;  1ERM A;  3CMZ A;  3UDF A;  2Y2O A;  4R4S A;  3Q07 A;  1FSW A;  2ZC4 B;  3VSK A;  4UA9 A;  1GHI A;  2OLU A;  2CC1 A;  2Y2I A;  2EX9 A;  2X01 A;  1ESI A;  2IWC A;  3N7W A;  4WZ5 A;  4LV0 A;  4PM6 A;  3M6H A;  4GD8 A;  1LLB A;  2QZ6 A;  1NZU A;  3VFF A;  1BZA A;  2WKE A;  4KZ8 A;  2Y55 A;  3GMW A;  3VP2 A;  4EV4 A;  1L0D A;  3V5M A;  2XD5 A;  1ONH A;  3BM6 A;  2XH9 A;  3MZF A;  4WEL A;  3BFE A;  3RXX A;  3TOI A;  3Q82 A;  4EUZ A;  3IWQ A;  1MKI A;  5HAQ A;  2ZM2 A;  2Y4A A;  4PM5 A;  4JF4 A;  1O7E A;  2XF3 A;  2OV5 A;  1IKI A;  4XUZ A;  4E6W A;  3NBL A;  3IXB A;  2DNS A;  1L0F A;  1BLS A;  3G34 A;  1MWR A;  3O3V A;  3NDG A;  4QY5 A;  1AXB A;  3BFG A;  1BSG A;  1KGF A;  1YMX A;  2R9W A;  4ID4 A;  4FCF A;  3QNC A;  3BFD A;  3HUO A;  3MBZ A;  3EQU A;  3N6I A;  4FH2 A;  4MBK A;  2Z2M B;  4UA6 A;  3WRZ A;  5KSC A;  3UDI A;  4Z9Q A;  4JPM A;  4E3K A;  3N8S A;  1MWU A;  4WYY A;  3FKV A;  4R3B A;  4DKI A;  3FWL A;  4ZJ1 A;  4FSF A;  4GZB A;  1JWZ A;  1ZC2 A;  3VP4 A;  1VM1 A;  5JYO A;  3EQV A;  2H5S A;  2XR0 A;  2OLV A;  3M2K A;  3G32 A;  3A3I A;  3Q7V A;  4U0T A;  5CGS A;  5CHU A;  3UNW A;  1SCW A;  3W8K A;  4DRT A;  3ITB A;  1ZKJ A;  4RYE A;  4UA7 A;  1G6A A;  5FA7 A;  1FQG A;  2Y2M A;  4UHU A;  3GTC A;  3OCN A;  1KGE A;  2EXB A;  3MXR A;  1M40 A;  1N4O A;  4BEN A;  4R1G A;  4R23 A;  1W8Y A;  2HP6 A;  1LI9 A;  3QHY A;  1BT5 A;  3A3E A;  4N1H A;  2RCX A;  3UPP A;  1PWC A;  2EFU A;  4L0L A;  5FQK A;  3PBN A;  3PBS A;  5EUA A;  4S2I A;  3ZG9 B;  3CZD A;  5FAO A;  2Y2P A;  4LV3 A;  4GNU A;  4ZBE A;  2QMI A;  2Y59 A;  3HLF A;  2WGI A;  3BFF A;  3OC2 A;  3HLD A;  3AGD A;  2PU4 A;  3SH8 A;  1HVB A;  5CED A;  2X71 A;  5EPH A;  3ZVT A;  5HAR A;  2WKI A;  1Q2P A;  1RP5 A;  4OQG A;  3OCL A;  3ITA A;  4N92 A;  1W8Q A;  1PIO A;  2XGN A;  4KG6 A;  2WAF A;  3W4P A;  3SS3 A;  1K54 A;  3Q7V B;  4YIN A;  1IKG A;  1GHP A;  5FQI A;  4ZDX A;  1E25 A;  1CI9 A;  4OON A;  5E2E A;  3PAG A;  5EOO A;  2ZQ7 A;  3GQZ A;  4JBF A;  4BLM A;  1ERO A;  2QPN A;  1TVF A;  2ZM0 A;  4KZ7 A;  3HLB A;  3UE1 A;  4DXB A;  3OPH A;  5CHJ A;  3ZFZ A;  1JWV A;  4S2O A;  4NET A;  1H8Y A;  5FQM A;  2DRW A;  1IEL A;  4S2N A;  2V20 A;  5EE8 A;  3TSG A;  3UY6 A;  5L2F A;  3LO7 A;  1CEG A;  1SKF A;  5CXW A;  1J9M A;  2ZC6 B;  2Y2L A;  4DDS A;  1BLC A;  1BLP A;  1O07 A;  4OQ0 A;  4DDY A;  2ZMA A;  4OH0 A;  5CHM A;  5F82 A;  3TG9 A;  2VGJ A;  2ZQ9 A;  4EWF A;  4OP5 A;  5CTN A;  3RJU A;  5E43 A;  1ERQ A;  4FD8 A;  4EBL A;  4QJG A;  3SOI A;  4Y0O A;  1YT4 A;  2EX8 A;  1K55 A;  3DWZ A;  5IHV A;  4Y7P A;  3CJM A;  1MBL A;  4B4X A;  5BOH A;  3IF5 A;  2XDM A;  1L0G A;  4JF6 A;  3UE3 A;  3ZG7 B;  4QHC A;  4WM9 A;  1QMF A;  1YM1 A;  3C4O A;  4KQR A;  2J9O A;  3B3X A;  4A5R A;  1KVL A;  3IHB A;  5EVL A;  3O86 A;  2ZQ8 A;  1XXM A;  4E6X A;  4B88 A;  3FKW A;  3GRJ A;  1ES2 A;  2EX2 A;  1NZO A;  3G30 A;  3MXS A;  4R4R A;  4KZ9 A;  5CGW A;  1IEM A;  1K38 A;  1FR1 A;  2GDN A;  4CPK A;  2FFY A;  3LCE A;  4HES A;  3HVF A;  3P98 A;  5FI6 A;  4KG2 A;  3V3S A;  4OPR A;  3MZE A;  4LCL A;  4N9L A;  1LHY A;  3FYZ A;  5DF8 A;  1GHM A;  2H0T A;  3BLM A;  4KG5 A;  3S22 A;  4S2J A;  4LEN A;  4EBN A;  2Z2L B;  4MLL A;  4Q8I A;  3WWX A;  2PBY A;  3W4O A;  1ONG A;  5M18 A;  2HDU A;  1EWZ A;  3C4P A;  5E2F A;  1YQS A;  5I94 A;  4ZAM A;  4D2O A;  4BD0 A;  2DCF A;  1PZP A;  5M19 A;  5DVA A;  1TDG A;  4JXW A;  1TDL A;  1M6K A;  3CG5 A;  4P87 A;  2BLS A;  4BD1 A;  2B5R A;  4KZB A;  1JVJ A;  1QME A;  4ZJ2 A;  5EVI D;  3SH9 A;  1KE3 A;  1E3U D;  2WGW A;  3Q81 A;  3ZDJ A;  4ZJ3 A;  1ZG4 A;  1OME A;  1ALQ A;  3HRE A;  3LY3 A;  4GKU A;  5DTS A;  3NIA A;  4OLD A;  1SDN A;  3IT9 A;  5M1A A;  1K56 D;  5DTT A;  2RL3 A;  5FAS A;  3S1Y A;  2XFS A;  3NCK A;  3WS0 A;  5HAI A;  4MEZ A;  1G68 A;  4E3L A;  2WZX A;  1FCO A;  4JXV A;  4IED A;  4JKT A;  3UE0 A;  1I5Q A;  1E4D A;  3S4X A;  1S0W A;  4C75 A;  3VOZ A;  5AQ7 A;  3LY4 A;  5FSR A;  3ISG A;  2XK1 A;  1C3B A;  1DY6 A;  3O88 A;  4OOL A;  2HDS A;  3ZG8 B;  5CEC A;  4H8R A;  4OOY A;  2Q9M A;  4XXR A;  1I2W A;  2JBF A;  3BRM A;  3G2Z A;  4GDB A;  2J8Y A;  2WGV A;  3WS4 A;  2ZC5 B;  2HP9 A;  4OLG A;  5HFO A;  5TGF A;  1K25 A;  1XP4 A;  2Y2Q A;  3G31 A;  1ESU A;  3DTM A;  2HPB A;  3HBR A;  3MKF A;  2IWD A;  1K6R A;  2H0Y A;  3BEB A;  3O87 A;  4WEJ A;  3UN7 A;  2WGW B;  2E8I A;  3NC8 A;  4JXS A;  4P6B A;  4HBU A;  3D4F A;  3FV7 A;  3AGF A;  1U60 A;  1S6R A;  2G2U A;  1HTZ A;  5GLC A;  5CGX A;  4GN2 A;  4GB7 A;  5GLD A;  2P9V A;  1BTL A;  2ZC7 A;  5JYP A;  3NY4 A;  2A3U A;  1WYB A;  4JXG A;  3M2J A;  1FCN A;  3PBT A;  2EXA A;  3IHA A;  2V1Z A;  4RVA A;  5FQ9 A;  5A93 A;  2FFF B;  4N1X A;  1JTG A;  4Y0U A;  5DF9 A;  1KGG A;  5GL9 A;  2Q9N A;  3W4Q A;  3IF6 C;  3IWI A;  4IBR A;  2Y2N A;  3VP3 A;  4PM8 A;  4EBP A;  2WYX A;  4KQO A;  5GLB A;  2OSU A;  3A3J A;  2WAE A;  2ZD8 A;  4S2M A;  1YLP A;  4MBH A;  1L2S A;  4U0X A;  5FI2 A;  2I72 A;  3IXH A;  2PU2 A;  1RGY A;  4DE2 A;  1K57 C;  4P85 A;  3ZNT A;  5FDH A;  5FI7 A;  5E2H A;  2XLN A;  4QD4 A;  2P74 A;  2UWX A;  4X56 A;  2ZQC A;  1HZO A;  4S2N C;  2J9P A;  3PAE A;  4WEK A;  4DF6 A;  4IBX A;  3ZG5 A;  5AQB A;  3FZC A;  2Y2K A;  4UAA A;  3BFC A;  4OP8 A;  2VGK A;  1YLW A;  4BQM A;  5KZH A;  1KDS A;  3BEC A;  1DJA A;  3VFH A;  3NI9 A;  4DE1 A;  1BUE A;  1NJ4 A;  3AGE A;  3Q1F A;  3QNB A;  1PI4 A;  4QY6 A;  3V50 A;  4S2L A;  5A90 A;  5FAQ A;  3HLC A;  3VP1 A;  5EVI A;  1YLZ A;  1E3U A;  1MPL A;  2P9V B;  3IXG A;  4O7D A;  1H5X A;  1WE4 A;  1PI5 A;  2ZM8 A;  2Y91 A;  4E3N A;  4GDN A;  1EI5 A;  4KZ6 A;  1IYO A;  2ZC3 B;  4E3J A;  1K55 C;  2X02 A;  4N9K A;  1K56 A;  1K4E A;  5TR7 A;  5EOE A;  1WYC A;  3E2K A;  1PYY A;  4K0W A;  1GCE A;  5HW3 A;  5D3O A;  3ZGA B;  3G2Y A;  1ES4 A;  3ZVW A;  1PWD A;  1ES3 A;  1I2S A;  2V2F F;  5EEC A;  2G2W A;  3BLS A;  5J8X A;  5CRF A;  4WMC D;  4NK3 A;  1LI0 A;  3BYD A;  3I7J A;  5DF7 A;  3G35 A;  4WZ5 C;  4DE0 A;  2WAD A;  4ZTK A;  3C5A A;  4BJP A;  1YLY A;  2ZLY A;  1DJB A;  1XGJ A;  5F83 A;  2A49 A;  4U3T A;  1L0E A;  2XEP A;  4R0Q A;  2ZQA A;  4C3Q A;  3ZCZ A;  4QU3 A;  2XQZ A;  4QB8 A;  2JC7 A;  3UPO A;  4PPR A;  1LL9 A;  5EVI B;  4F94 A;  4X69 A;  3UDX A;  3ZG0 A;  2IWB A;  5CER A;  4RX3 A;  1JWP A;  3DW0 A;  1CEF A;  5FQQ A;  2HP5 A;  5G18 A;  1KE4 A;  3HUM A;  5TFQ A;  2C5W B;  3SH7 A;  3ZNY A;  1KDW A;  4RX2 A;  4KZ4 A;  2EX6 A;  1BUL A;  1TEM A;  3SS5 A;  3JYI A;  3PTE A;  2Y2H A;  3Q7Z A;  4MNR A;  5HL1 A;  1K6S A;  4WZ4 A;  3C7V A;  3OPL A;  3HLW A;  4BL3 A;  5GHY A;  5A92 A;  4S2K A;  3LEZ A;  1PWG A;  4KEN B;  4OKP A;  4EQI A;  1KVM A;  3IH9 A;  3N8L A;  3V39 A;  3PBR A;  1XA7 A;  4BL2 A;  3WRT A;  4WBG A;  1YMS A;  5AQA A;  4LCM A;  4HEF A;  1FSY A;  1BLH A;  2C6W B;  4OPQ A;  1MXO A;  3A3D A;  3OZH A;  1Q2Q A;  2R9X A;  2HDQ A;  1CI8 A;  1YLJ A;  4R3J A;  3VSL A;  5A91 A;  4M3K A;  4OQH A;  1Y54 A;  1YLT A;  3G4P A;  2XFT A;  4X53 A;  3UPN A;  1IYP A;  3RXW A;  1IYQ A;  1W5D A;  4LV1 A;  1FR6 A;  4P0M A;  4E3O A;  1FOF A;  3VMA A;  5GLA A;  2ZJ9 A;  1ZG6 A;  4GOG A;  4YFM A;  5DTK A;  1NY0 A;  3N4I A;  3PBQ A;  1SHV A;  4OVD A;  3WS5 A;  1LL5 A;  1KE0 A;  5F1G A;  2HDR A;  1H8Z A;  3UO9 A;  3V3R A;  4DE3 A;  4OPZ A;  2JCH A;  1MY8 A;  3HL9 A;  1K4F A;  2ZQD A;  1NXY A;  3GSG A;  5HX9 A;  3DWK A;  5E2G A;  1ES5 A;  1MWS A;  2BG1 A;  5HAP A;  1NYM A;  4KZA A; 
#chains in the Genus database with same CATH topology
 1K54 C;  5EM0 A;  1NRF A;  4LV2 A;  4CJN A;  4KZ5 A;  5FQJ A;  4WMC A;  4S2P A;  4Y5F A;  1XX2 A;  4K91 A;  5CEB A;  2H10 A;  4GLQ A;  5MC7 A;  3IQA A;  4B4Z A;  1HD8 A;  2WUQ A;  4IVK A;  5KSH A;  3ZHH A;  2JKF A;  5FAP A;  1XFQ A;  2W27 A;  3P7N A;  1XA1 A;  1D7E A;  3MJQ A;  4XUX A;  3E4P A;  5G4Y A;  1GA9 A;  4NKP A;  1S66 L;  4RA7 A;  5FAT A;  5EVI C;  4E3M A;  1MWT A;  4KQQ A;  4OQI A;  3LI8 A;  4PKY G;  1D1J A;  3PBO A;  4XT2 A;  1ERM A;  3DAV A;  3VE4 A;  2Y2I A;  2EX9 A;  2KOI A;  3MQO A;  3E4O A;  3GMW A;  2G7U A;  3TOI A;  4EUZ A;  4P6Z S;  4L9F A;  1IKI A;  2DNS A;  1BLS A;  3G34 A;  4X1L A;  4QY5 A;  1AXB A;  3BFG A;  3QP8 A;  1DP6 A;  3MBZ A;  3EQU A;  4MBK A;  2Z2M B;  4Z9Q A;  4JPM A;  3N8S A;  1MWU A;  4R3B A;  4FSF A;  4ARZ B;  1F2K A;  3BQ8 A;  5CHU A;  4EUV A;  3UNW A;  1SCW A;  1ZKJ A;  2OWH A;  2Y2M A;  1CJF A;  4WN5 A;  2WKP A;  1KGE A;  1M40 A;  1TF1 A;  3CPT B;  3DTE A;  2ZMV A;  3PBN A;  3ZG9 B;  4ZBE A;  2Y59 A;  1NLY A;  4M4X A;  3B42 A;  2W3G A;  4OQG A;  1V9Y A;  1VB6 A;  4KG6 A;  4LRX C;  1MKM A;  2V0U A;  3SS3 A;  1K54 A;  3Q7V B;  1E25 A;  3PAG A;  1CQA A;  5TBM A;  3HLB A;  1N9O A;  4D60 A;  5CHJ A;  3ZFZ A;  4NET A;  4PKY A;  4Y17 A;  5EM1 A;  3LEQ A;  2W3F A;  2Y2L A;  5CHM A;  1TS8 A;  2VGJ A;  2ZQ9 A;  1G6O A;  2PR5 A;  4II7 A;  4EBL A;  4GHI B;  2D01 A;  1K55 A;  2B18 A;  3DWZ A;  5L10 A;  2K2N A;  4EEU A;  5HPI A;  2V8C A;  3B47 A;  4WM9 A;  1YM1 A;  2J9O A;  2VEA A;  2ZQ8 A;  3H82 A;  3FKW A;  2EX2 A;  3MXS A;  3UMD A;  3LCE A;  3HVF A;  5FI6 A;  4KG2 A;  1YSP A;  4LCL A;  4N9L A;  1LHY A;  2W1T A;  3DBA A;  2H0T A;  4GW9 A;  4EBN A;  2GNX A;  1P9R A;  2Z2L B;  3C2W A;  1YPR A;  3PHY A;  1WA9 A;  1VEU B;  2W3H A;  4D2O A;  3C38 A;  5K5B A;  1PZP A;  4HI4 A;  1TDL A;  1M6K A;  2QWS A;  4BD1 A;  2B5R A;  4ZJ2 A;  3SH9 A;  4NXB A;  2J3W A;  1ZG4 A;  4LGW A;  1ALQ A;  3HRE A;  5M1A A;  4F3L A;  1K56 D;  5DTT A;  3S1Y A;  3WS0 A;  1LL8 A;  3KSI A;  4MEZ A;  1XJ2 A;  2WZX A;  1FCO A;  4IED A;  4PAU A;  4EER A;  5AQ7 A;  1UGU A;  3EOI A;  1DY6 A;  2HDS A;  3ZG8 B;  1G5U A;  4GDB A;  4HJ6 A;  3RH8 B;  1K25 A;  3S7P A;  4WEJ A;  3UN7 A;  2WGW B;  3ICY A;  4P6B A;  3FV7 A;  2G2U A;  5GLC A;  5CGX A;  4GB7 A;  1BTL A;  3H9W A;  1DP8 A;  4LRZ E;  1WYB A;  4L9E A;  3M2J A;  3PBT A;  3IHA A;  4JGP A;  2HV1 A;  5A93 A;  4N1X A;  3W4Q A;  1JTG A;  5DF9 A;  3IF6 C;  3IWI A;  4ME4 A;  1IFQ A;  1L2S A;  1RGY A;  2J80 A;  1K57 C;  3TW8 A;  2O9A A;  2H28 A;  4HH3 A;  2J9P A;  3PAE A;  4IBX A;  4IJG A;  3ZG5 A;  3NI9 A;  2J3T C;  4S2L A;  5A90 A;  1P9W A;  5FAQ A;  2BAS A;  3VP1 A;  2P9V B;  1MPL A;  1H5X A;  1EI5 A;  2X02 A;  1K56 A;  3V67 A;  2W3E A;  3CI6 A;  5TR7 A;  1WYC A;  4K0W A;  5D3O A;  2IA2 A;  3ZVW A;  3LGO A;  5EEC A;  3I7J A;  5DF7 A;  4DE0 A;  2XRO A;  4G3W A;  3QP4 A;  2ZLY A;  5IT5 A;  1XGJ A;  2A49 A;  1L0E A;  4R0Q A;  4HHD A;  2XQZ A;  3UPO A;  3NUL A;  1LL9 A;  4F94 A;  4RX3 A;  4JGQ A;  3BQA A;  2C5W B;  1KDW A;  4RX2 A;  2EX6 A;  2Y2H A;  3Q7Z A;  2ZOI A;  1IOU A;  5GHY A;  5G4Z A;  4OKP A;  3V39 A;  5AJG A;  4BL2 A;  3WRT A;  4WBG A;  1FSY A;  1BLH A;  4OPQ A;  1MXO A;  2R9X A;  2HDQ A;  1VET B;  3IBR A;  1XJ4 A;  1YLT A;  3LR3 A;  2OOL A;  1IYP A;  4LV1 A;  4E3O A;  4I3A A;  5GLA A;  2ZJ9 A;  4GOG A;  3N4I A;  3D9Y A;  4HNB A;  1SHV A;  3UO9 A;  2QJ5 A;  3MF0 A;  2JCH A;  3L7H A;  1K4F A;  4WF0 A;  2GX5 A;  3GSG A;  3QP1 A;  3IX8 A;  2EWW A;  1YKD A;  3A0R A;  1NYM A;  5KMW A;  1PW1 A;  5GHX A;  3A3F A;  4BBU A;  2O0Y A;  3IF6 A;  3OPP A;  2Y2J A;  2JKT M;  4IVI A;  3UE6 A;  3R7W A;  3GV9 A;  1IYS A;  1GA0 A;  1K57 A;  2EFX A;  2WZZ A;  1PW8 A;  4FH4 A;  4Y0T A;  1V9Z A;  4OPY A;  1VQQ A;  5AVE A;  4DXC A;  2W1R A;  3HLE A;  1YSQ A;  4LFU A;  4C6Y A;  1RCJ A;  4E3I A;  4KUK A;  3IX4 A;  5CTM A;  3SS4 A;  2WK0 A;  4PM7 A;  4GD6 A;  5EVE A;  1L3L A;  2O9B A;  3E0Y A;  5U47 A;  1JNU A;  1SDE A;  2PR6 A;  4K08 A;  1PZO A;  1NYY A;  5DFX A;  3P09 A;  2J7V A;  3MKE A;  3HUN A;  5HWW A;  1XPB A;  3WS2 A;  4YOF A;  3M6B A;  4K0X A;  4QPR A;  3S7N A;  1Z6F A;  1D06 A;  3EEA A;  4I39 A;  4UQI S;  4DJ2 A;  3Q07 A;  2YKF A;  4UA9 A;  1N9L A;  3HCY A;  2I9V A;  1ESI A;  2JHE A;  4BBT A;  5HL6 A;  2PYP A;  1LLB A;  4KZ8 A;  2XD5 A;  4WEL A;  3BFE A;  3Q82 A;  1MKI A;  3E98 A;  1OJ5 A;  2XF3 A;  4E6W A;  3LYX A;  3NDG A;  4LPZ A;  1YMX A;  1H8M A;  2R9W A;  4ID4 A;  4Q0H A;  4UA6 A;  3WRZ A;  3UDI A;  2XSS A;  2A24 B;  4FUW A;  4NXF A;  3FWL A;  1JWZ A;  3VP4 A;  5JYO A;  3EQV A;  1UWP X;  5CGS A;  3W8K A;  3ITB A;  4UA7 A;  1XJ3 A;  1EW0 A;  3F1P A;  4N1H A;  3UPP A;  5FAO A;  2Y2P A;  4GNU A;  3KYZ A;  2W0N A;  2PDR A;  3HLF A;  2WGI A;  3AGD A;  2PU4 A;  3SH8 A;  1TS0 A;  1HVB A;  3CUE C;  5CED A;  1LT0 A;  3IS2 B;  2WKI A;  1Q2P A;  1RP5 A;  3OCL A;  3ITA A;  4N92 A;  2NUP C;  1PIO A;  2XGN A;  1T18 A;  3MS6 A;  1GSW A;  2JKR M;  1IKG A;  5FQI A;  3D72 A;  2BTF P;  4OON A;  5E2E A;  4BWI A;  1STZ A;  2VKS A;  2ZQ7 A;  1TVF A;  3T12 B;  3OPH A;  4S2O A;  3CIT A;  4S2N A;  1Y28 A;  2V20 A;  5EE8 A;  1XJ6 A;  3LO7 A;  3LR0 A;  2WKR A;  1CEG A;  2KX6 A;  5CXW A;  2WKQ A;  3C8C A;  1J9M A;  2A2L A;  1O07 A;  5DJU A;  4R3A A;  5CTN A;  4JGO A;  3RJU A;  1OTA A;  2FH5 A;  4FD8 A;  3A0V A;  2Y8H A;  4Y0O A;  3T1S A;  1YT4 A;  2EX8 A;  3NOU C;  1OT9 A;  4Y7P A;  1OTD A;  3CJM A;  4B4X A;  3IF5 A;  1L0G A;  1QMF A;  3C4O A;  3F1O B;  3LUQ A;  4A5R A;  4O01 A;  3G30 A;  4KZ9 A;  1K38 A;  2FFY A;  3MXQ A;  1LSX A;  3V3S A;  4OPR A;  3QP2 A;  3FYZ A;  3K3C A;  5DF8 A;  1GHM A;  4KG5 A;  4ZRR A;  4NG2 A;  4UEY A;  4MLL A;  4Q8I A;  5HSQ A;  3WWX A;  1VHM A;  5HPF A;  1ONG A;  5M18 A;  1EWZ A;  3C4P A;  1YQS A;  3UME A;  4BD0 A;  2DCF A;  1TS7 A;  4I3I A;  5EVI D;  1E3U D;  2XA7 M;  4ZJ3 A;  4G3V A;  1SDN A;  4L9G A;  2XFS A;  5HAI A;  4E3L A;  2ZL1 B;  3H7W B;  4JKT A;  3UE0 A;  1I5Q A;  1S0W A;  4C75 A;  2M7U A;  4OOY A;  1H3Q A;  2JBF A;  3WS4 A;  2ZC5 B;  3CLO A;  5TGF A;  2Y2Q A;  3HBR A;  2IWD A;  4HP9 A;  3BEB A;  4Z1W A;  2E8I A;  4JXS A;  2AVX A;  2K7S A;  2M1C A;  3AGF A;  2XRN A;  2V0W A;  4GN2 A;  3NY4 A;  4JXG A;  2ZOH A;  1ZHH B;  1FCN A;  2EXA A;  4RVA A;  4HIA A;  1Z09 A;  5L8M A;  4Y0U A;  2Q9N A;  4IBR A;  3CHW P;  1YLP A;  3C30 A;  4U0X A;  5FI2 A;  2VGL M;  2B95 A;  2PU2 A;  4DE2 A;  3ZNT A;  3MQQ A;  5L07 A;  5E2H A;  2XLN A;  2UWX A;  1HZO A;  4DF6 A;  1P0Z A;  2UV0 E;  2VGK A;  5KZH A;  5IU1 A;  1NJ4 A;  5EVI A;  4GS9 B;  1E3U A;  4ETZ A;  4E3N A;  4MN5 A;  2Y91 A;  3W2Z A;  4GDN A;  3K2N A;  2PD7 A;  2JN7 A;  4N9K A;  4LRY C;  3ZQ5 A;  1PYY A;  1GCE A;  5HD3 A;  1ES4 A;  3A0S A;  1ES3 A;  1I2S A;  1S4S A;  5DKL A;  4EQ1 A;  4NK3 A;  3BYD A;  4WZ5 C;  3C5A A;  1DJB A;  3T4S A;  4HQA A;  4Q0J A;  3MQ0 A;  1DRM A;  1NLZ A;  4PPR A;  3ZG0 A;  5CER A;  1NRJ A;  3T4T A;  3B33 A;  4DMZ A;  4AFI A;  5TFQ A;  4BBV A;  3OBF A;  1TEM A;  3SS5 A;  4MNR A;  1J3W A;  2O9C A;  3C7V A;  3OPL A;  3HLW A;  4BL3 A;  3LEZ A;  1PWG A;  4KEN B;  4EQI A;  1KVM A;  3IH9 A;  2HJ9 C;  5F5Y A;  1XA7 A;  2L4R A;  4LCM A;  2M7V A;  4MN7 A;  3DTK A;  2Z6D A;  3OZH A;  3T1Q B;  4DJ3 A;  5A91 A;  5HDS A;  4CLC B;  2INW A;  4HOI A;  2KDK A;  4X53 A;  2W3D A;  5FEG A;  4YFM A;  1NY0 A;  3PBQ A;  3WS5 A;  1KE0 A;  5F1G A;  3V3R A;  1PFL A;  4OPZ A;  3UB5 P;  3D3O A;  2ZQD A;  1ES5 A;  1MWS A;  2BG1 A;  3LIC A;  5FEF A;  2XD1 A;  3OPR A;  2OAP 1;  2GJ3 A;  1FCM A;  1XGI A;  4HBT A;  1W79 A;  4KZ3 A;  2WKH A;  5HWT A;  3F1N B;  4H6J B;  4EET B;  1SKO B;  3N8R A;  4O8G A;  4X1M A;  3IWO A;  3UB9 A;  4HY8 A;  3E2L A;  2B02 A;  4X6T A;  1W7F A;  5F69 A;  1N9N A;  2L1M A;  3C7U A;  3KYQ A;  4MBF A;  1XKZ A;  5KIZ A;  3KO6 A;  3IXD A;  3NDE A;  2VK3 A;  3UDF A;  2Y2O A;  4R4S A;  2ZC4 B;  2R78 A;  5F6A A;  2OLU A;  2X01 A;  4ARZ A;  3N7W A;  4WZ5 A;  4PM6 A;  4GD8 A;  1BZA A;  3VP2 A;  3V5M A;  3BM6 A;  1ONH A;  4HH2 A;  3RXX A;  2QYB A;  3CPT A;  1SZV A;  5HAQ A;  2Y4A A;  4PM5 A;  4JF4 A;  2J3T D;  1O7E A;  1TS6 A;  2OV5 A;  1W63 M;  4XUZ A;  4CLC E;  2ZMF A;  1MWR A;  1HLU P;  1BSG A;  4CLC C;  4FCF A;  3HUO A;  4FH2 A;  5KSC A;  4ETX A;  1S4R A;  4XT2 B;  4E3K A;  2Q0O A;  4BMW A;  2VA0 A;  3VOL A;  2P08 A;  4HJ4 A;  1VM1 A;  1PNE A;  3Q7V A;  3A3I A;  5FA7 A;  3O5Y A;  1G6A A;  1FQG A;  3GTC A;  3OCN A;  3MXR A;  4MCW A;  1N4O A;  4MN6 A;  3LR4 A;  4R1G A;  4R23 A;  2HP6 A;  3K3D A;  2RCX A;  2P7J A;  2EFU A;  4L0L A;  5FQK A;  5EUA A;  3CZD A;  3BFF A;  3BW6 A;  2X71 A;  4GHI A;  5HAR A;  4CLC D;  2JKT I;  1W8Q A;  2WAF A;  3W4P A;  3CWF A;  3KSF A;  1GHP A;  5CX7 A;  3FC7 A;  3S7Q A;  4MMN A;  4JBF A;  1ERO A;  4DXB A;  1JWV A;  5FQM A;  1H8Y A;  2DRW A;  3T4Q A;  5L2F A;  4EES A;  4DN0 A;  2PHY A;  4DDS A;  1BLC A;  2ZMA A;  4OH0 A;  5F82 A;  3TG9 A;  4EWF A;  4WLA A;  4B93 A;  1ERQ A;  5J4E A;  3T4L A;  5J7E A;  1VEU A;  5IHV A;  3OOV A;  1FIL A;  1MBL A;  1S1Y A;  1X0O A;  4JF6 A;  3ZG7 B;  4KQR A;  5TBM B;  3B3X A;  3LID A;  3IHB A;  3UB8 A;  1XXM A;  1PRQ A;  2GZA A;  1NZO A;  5CGW A;  1IEM A;  1FR1 A;  2GDN A;  3JVU A;  4R70 A;  4CPK A;  5J3W A;  3P98 A;  5L09 A;  3T4K A;  3MZE A;  1H0M A;  3DTI A;  3BLM A;  3S22 A;  3UB7 A;  4LEN A;  2JKG A;  1YAX A;  2VV6 A;  1ACF A;  1OTI A;  4GCZ A;  2PBY A;  2HDU A;  5EFW A;  5I94 A;  3T4O A;  3FG8 A;  5DVA A;  1TDG A;  4Q0I A;  4P87 A;  2BLS A;  4KZB A;  1QME A;  3BJN A;  2WGW A;  3ZDJ A;  4I38 A;  3H82 B;  3LY3 A;  4GKU A;  4OLD A;  2RL3 A;  3LI9 A;  4Y3I A;  2W1T B;  1G68 A;  2EA9 A;  2VV8 A;  1E4D A;  3S4X A;  3T1X A;  3LY4 A;  5FSR A;  3ISG A;  2OAQ 1;  4OOL A;  4H8R A;  4XXR A;  4Y13 A;  1T19 A;  3BRM A;  2WGV A;  2HP9 A;  4OLG A;  5HFO A;  2D02 A;  1XP4 A;  3G31 A;  1ESU A;  2HPB A;  3KSH A;  3MKF A;  3L9K A;  1K6R A;  2PT7 A;  2JKR I;  4HBU A;  2PD8 A;  1U60 A;  2EWV A;  1S6R A;  1HTZ A;  5GLD A;  4F3L B;  2MJ6 A;  2P9V A;  2A3U A;  3JPU A;  2V1Z A;  5FQ9 A;  5GL9 A;  3MMH A;  2OWJ A;  2Y2N A;  4EBP A;  2WYX A;  5GLB A;  2OSU A;  4S2M A;  4KQD A;  4MBH A;  2I72 A;  4IUK A;  3G6O A;  5FI7 A;  4X56 A;  4WEK A;  2QHK A;  3T1R A;  2E8J A;  5AQB A;  3FZC A;  3BFC A;  4BQM A;  2PBD P;  3R4K A;  4DE1 A;  1PI4 A;  3HLC A;  1YLZ A;  3IXG A;  1WE4 A;  4QWO A;  3KSG A;  4KZ6 A;  2ZC3 B;  4E3J A;  1K55 C;  1K4E A;  1T1A A;  5HW3 A;  3ZGA B;  2V2F F;  1LSV A;  3FPV A;  5CRF A;  2PAV P;  3GEC A;  1LI0 A;  5I5L A;  1ODV A;  2WAD A;  5HDD A;  2P04 A;  5F83 A;  4U3T A;  2XEP A;  1NWZ A;  2ZQA A;  4QU3 A;  2JC7 A;  4EEP A;  3IX3 A;  1VET A;  3UDX A;  5HD5 A;  2KLI A;  4P6Z M;  3DW0 A;  1CEF A;  5FQQ A;  2HP5 A;  5G18 A;  1OTE A;  3ZNY A;  3SH7 A;  4KZ4 A;  1BUL A;  2NUT C;  2V8F A;  3JYI A;  1MZU A;  2XA7 S;  5HL1 A;  1K6S A;  4WZ4 A;  5A92 A;  4S2K A;  1KOU A;  4I3J A;  3N8L A;  1T1B A;  1Y4O A;  4FOF A;  2C6W B;  3S7O A;  3A3D A;  1Q2Q A;  1CI8 A;  1YLJ A;  4R3J A;  2LB9 A;  3VSL A;  4M3K A;  1Y54 A;  2XFT A;  3RXW A;  1IYQ A;  1W5D A;  5DTK A;  1ZG6 A;  3CUE A;  1P97 A;  1F9I A;  1H8Z A;  2HDR A;  3PR6 A;  4DE3 A;  4R38 A;  4FTX A;  3DWK A;  3BY8 A;  5HAP A;  4C3Q A;  4KZA A;  3HLG A;  4IUH A;  1DJC A;  2DMW A;  4YWZ A;  4PMA A;  2Y2G A;  1F5M A;  2VGL S;  1CK3 A;  5GHZ A;  2O99 A;  4X55 A;  4X68 A;  3NOP C;  3WS1 A;  2Z6C A;  3MFD A;  4WL9 A;  1BYW A;  4OOM A;  3NJA A;  4PM9 A;  4JF5 A;  3GR2 A;  3VOY A;  4GJ4 A;  2K31 A;  1JTD A;  1MC0 A;  5F1F A;  2VJW A;  3MZD A;  5FDS A;  5AQ9 A;  3IF6 B;  3IH8 A;  4JLF A;  3VP0 A;  3GVB A;  1RGZ A;  1N9B A;  2JE5 A;  2A24 A;  3CMZ A;  3R7W B;  4ESP A;  1FSW A;  3VSK A;  1UWN X;  3TJZ C;  1GHI A;  2CC1 A;  2IWC A;  2PRF A;  1S1Z A;  2YKH A;  2VV7 A;  4LV0 A;  3M6H A;  1OPX A;  2QZ6 A;  4Y15 A;  1NZU A;  3VFF A;  2WKE A;  4EW7 A;  2Y55 A;  4EV4 A;  1L0D A;  2XH9 A;  3MZF A;  1K0K A;  3IWQ A;  2ZM2 A;  3NHQ A;  3NBL A;  3IXB A;  1L0F A;  3O3V A;  1KGF A;  4YNR A;  3QNC A;  3BFD A;  3N6I A;  4RQ9 A;  1DP9 A;  3IS2 A;  4WYY A;  3FKV A;  4DKI A;  4ZJ1 A;  2QJ7 A;  4GZB A;  1ZC2 A;  2H5S A;  2OLV A;  2XR0 A;  3M2K A;  3G32 A;  4U0T A;  3MSH A;  1AWI A;  4DRT A;  3BY9 A;  4RYE A;  4X25 A;  3OLO A;  4UHU A;  3E4Q A;  2EXB A;  3EWK A;  4BEN A;  1W8Y A;  1LI9 A;  3QHY A;  3EGD C;  1ZTU A;  1BT5 A;  3A3E A;  3UB6 A;  3BWL A;  1PWC A;  1XFN A;  3HJI A;  3TRC A;  3PBS A;  4S2I A;  4LV3 A;  4B9O A;  2QMI A;  3NOT C;  3OC2 A;  3FPW A;  3HLD A;  4KUO A;  5EPH A;  3ZVT A;  4HJ3 A;  5EV0 A;  4YIN A;  4ZDX A;  3JVV A;  1CI9 A;  5EOO A;  3GQZ A;  4BLM A;  1GSX A;  2QPN A;  3F1O A;  2ZM0 A;  4KZ7 A;  3UE1 A;  1IEL A;  3F1P B;  4CQH A;  3TSG A;  3UY6 A;  3QP5 A;  1LSW A;  1SKF A;  2ZC6 B;  1BLP A;  4OQ0 A;  4E04 A;  4DDY A;  4OP5 A;  3QP6 A;  1GSV A;  5E43 A;  5HDC A;  4QJG A;  3SOI A;  3TE8 A;  4HP4 A;  2VX8 A;  5BOH A;  2PYR A;  2XDM A;  3T50 A;  3UE3 A;  4QHC A;  1CF0 A;  2HJE A;  4I5S A;  1KVL A;  5EVL A;  3O86 A;  3MFX A;  4E6X A;  4B88 A;  3GRJ A;  1ES2 A;  4R4R A;  4HES A;  4R6L A;  1A0K A;  2ZL1 A;  3H7W A;  4S2J A;  5AVF A;  5IS1 A;  2L0W A;  2VZW A;  3W4O A;  5E2F A;  4ZAM A;  3RTY A;  3VV4 A;  5M19 A;  4JXW A;  3CG5 A;  2QKP A;  1JVJ A;  5TJJ A;  1KE3 A;  3Q81 A;  3PYP A;  3CAX A;  3U2A A;  4PHT A;  1OME A;  2ACG A;  2V1A A;  5DTS A;  3NIA A;  3IT9 A;  5FAS A;  3NCK A;  5F68 A;  4LLO B;  3VE3 A;  3ULF A;  3P01 A;  3LFV A;  4JXV A;  3LIF A;  4NXG A;  3VOZ A;  4JGR A;  2V1B A;  2XK1 A;  2HF6 A;  4NEE D;  1C3B A;  3O88 A;  5CEC A;  1G28 A;  2Q9M A;  1I2W A;  3G2Z A;  2J8Y A;  2V9A A;  5LBR A;  3DTM A;  1T1C A;  2H0Y A;  3O87 A;  3SZT A;  3NC8 A;  1OJG A;  3KYE A;  3D4F A;  5C5K A;  4GS9 A;  2ZC7 A;  5JYP A;  1TD5 A;  1F98 A;  2FFF B;  1KGG A;  1OT6 A;  3HJK A;  1W63 Q;  3VP3 A;  4PM8 A;  4KQO A;  3A3J A;  2WAE A;  2ZD8 A;  5HZH A;  3IXH A;  4G3K A;  4P85 A;  5FDH A;  3LIB A;  2Y79 A;  4QD4 A;  2P74 A;  2ZQC A;  4S2N C;  3EEH A;  3RFB A;  2Y2K A;  4UAA A;  4OP8 A;  1YLW A;  1KDS A;  3BEC A;  1DJA A;  3VFH A;  3SW1 A;  1BUE A;  2VLG A;  3AGE A;  3Q1F A;  3QNB A;  4QY6 A;  3U4L P;  3V50 A;  5DFY A;  4O7D A;  1PI5 A;  2ZM8 A;  4NXE A;  1IYO A;  1S67 L;  2HGV A;  2ZBB A;  5FL3 A;  5EOE A;  3E2K A;  3G2Y A;  1PWD A;  4UQI M;  2G2W A;  4MDZ A;  3BLS A;  5J8X A;  4WMC D;  3G35 A;  5A8B A;  4ZTK A;  2HZ5 A;  4BJP A;  1FIK A;  1YLY A;  5DJT A;  2FZ0 A;  3ZCZ A;  2CMN A;  3PXP A;  4QB8 A;  4CLC A;  5EVI B;  4X69 A;  2IWB A;  4IHQ A;  1JWP A;  1KE4 A;  3HUM A;  3PTE A;  1OTB A;  3LIA A;  4EU0 A;  4O0P A;  3LIE A;  3EGX C;  3KX0 X;  3PBR A;  4Y2F A;  1YMS A;  5AQA A;  4EXO A;  4HEF A;  5DKK A;  5HWV A;  3GDI A;  3ZYT A;  3NEC A;  4OQH A;  3G4P A;  3UPN A;  3MR0 A;  3F1N A;  4H6J A;  1FR6 A;  4P0M A;  1FOF A;  1SKO A;  3VMA A;  3LR5 A;  4OVD A;  1LL5 A;  2LB5 A;  1MY8 A;  3T4J A;  3HL9 A;  3IBJ A;  4WUJ A;  1NXY A;  5HX9 A;  5E2G A; 
#chains in the Genus database with same CATH homology
 3HLG A;  5KMW A;  1DJC A;  1PW1 A;  5GHX A;  1K54 C;  1NRF A;  4LV2 A;  3A3F A;  4CJN A;  2XD1 A;  4PMA A;  2Y2G A;  3OPR A;  4KZ5 A;  3IF6 A;  5FQJ A;  4WMC A;  3OPP A;  4S2P A;  2Y2J A;  4IVI A;  1CK3 A;  1FCM A;  1XGI A;  5GHZ A;  4HBT A;  1XX2 A;  4K91 A;  3GV9 A;  5CEB A;  1IYS A;  4X55 A;  1GA0 A;  1K57 A;  1W79 A;  2EFX A;  2H10 A;  2WZZ A;  4KZ3 A;  2WKH A;  3IQA A;  4X68 A;  1PW8 A;  4FH4 A;  4B4Z A;  1HD8 A;  2WUQ A;  4IVK A;  4Y0T A;  3WS1 A;  3N8R A;  4OPY A;  1VQQ A;  3MFD A;  5KSH A;  3ZHH A;  4DXC A;  3HLE A;  5FAP A;  3IWO A;  4C6Y A;  1RCJ A;  4E3I A;  4OOM A;  1XA1 A;  4PM9 A;  4JF5 A;  5CTM A;  3SS4 A;  2WK0 A;  3GR2 A;  4PM7 A;  3E2L A;  4GD6 A;  4XUX A;  3VOY A;  5U47 A;  1GA9 A;  4X6T A;  1JTD A;  1W7F A;  1SDE A;  1PZO A;  1NYY A;  3P09 A;  2J7V A;  5F1F A;  4RA7 A;  3MKE A;  5FAT A;  3MZD A;  3C7U A;  3HUN A;  5EVI C;  1XPB A;  5AQ9 A;  4E3M A;  3WS2 A;  1MWT A;  1XKZ A;  3M6B A;  4K0X A;  4KQQ A;  4MBF A;  3IF6 B;  4OQI A;  3IH8 A;  4JLF A;  3VP0 A;  3IXD A;  3GVB A;  1RGZ A;  1N9B A;  1Z6F A;  3NDE A;  2JE5 A;  3PBO A;  1ERM A;  3CMZ A;  3UDF A;  2Y2O A;  4R4S A;  3Q07 A;  1FSW A;  2ZC4 B;  3VSK A;  4UA9 A;  1GHI A;  2OLU A;  2CC1 A;  2Y2I A;  2EX9 A;  2X01 A;  1ESI A;  2IWC A;  3N7W A;  4WZ5 A;  4LV0 A;  4PM6 A;  3M6H A;  4GD8 A;  1LLB A;  2QZ6 A;  1NZU A;  3VFF A;  1BZA A;  2WKE A;  4KZ8 A;  2Y55 A;  3GMW A;  3VP2 A;  4EV4 A;  1L0D A;  3V5M A;  2XD5 A;  1ONH A;  3BM6 A;  2XH9 A;  3MZF A;  4WEL A;  3BFE A;  3RXX A;  3TOI A;  3Q82 A;  4EUZ A;  3IWQ A;  1MKI A;  5HAQ A;  2ZM2 A;  2Y4A A;  4PM5 A;  4JF4 A;  1O7E A;  2XF3 A;  2OV5 A;  1IKI A;  4XUZ A;  4E6W A;  3NBL A;  3IXB A;  2DNS A;  1L0F A;  1BLS A;  3G34 A;  1MWR A;  3O3V A;  3NDG A;  4QY5 A;  1AXB A;  3BFG A;  1BSG A;  1KGF A;  1YMX A;  2R9W A;  4ID4 A;  4FCF A;  3QNC A;  3BFD A;  3HUO A;  3MBZ A;  3EQU A;  3N6I A;  4FH2 A;  4MBK A;  2Z2M B;  4UA6 A;  3WRZ A;  5KSC A;  3UDI A;  4Z9Q A;  4JPM A;  4E3K A;  3N8S A;  1MWU A;  4WYY A;  3FKV A;  4R3B A;  4DKI A;  3FWL A;  4ZJ1 A;  4FSF A;  4GZB A;  1JWZ A;  1ZC2 A;  3VP4 A;  1VM1 A;  5JYO A;  3EQV A;  2H5S A;  2XR0 A;  2OLV A;  3M2K A;  3G32 A;  3A3I A;  3Q7V A;  4U0T A;  5CGS A;  5CHU A;  3UNW A;  1SCW A;  3W8K A;  4DRT A;  3ITB A;  1ZKJ A;  4RYE A;  4UA7 A;  1G6A A;  5FA7 A;  1FQG A;  2Y2M A;  4UHU A;  3GTC A;  3OCN A;  1KGE A;  2EXB A;  3MXR A;  1M40 A;  1N4O A;  4BEN A;  4R1G A;  4R23 A;  1W8Y A;  2HP6 A;  1LI9 A;  3QHY A;  1BT5 A;  3A3E A;  4N1H A;  2RCX A;  3UPP A;  1PWC A;  2EFU A;  4L0L A;  5FQK A;  3PBN A;  3PBS A;  5EUA A;  4S2I A;  3ZG9 B;  3CZD A;  5FAO A;  2Y2P A;  4LV3 A;  4GNU A;  4ZBE A;  2QMI A;  2Y59 A;  3HLF A;  2WGI A;  3BFF A;  3OC2 A;  3HLD A;  3AGD A;  2PU4 A;  3SH8 A;  1HVB A;  5CED A;  2X71 A;  5EPH A;  3ZVT A;  5HAR A;  2WKI A;  1Q2P A;  1RP5 A;  4OQG A;  3OCL A;  3ITA A;  4N92 A;  1W8Q A;  1PIO A;  2XGN A;  4KG6 A;  2WAF A;  3W4P A;  3SS3 A;  1K54 A;  3Q7V B;  4YIN A;  1IKG A;  1GHP A;  5FQI A;  4ZDX A;  1E25 A;  1CI9 A;  4OON A;  5E2E A;  3PAG A;  5EOO A;  2ZQ7 A;  3GQZ A;  4JBF A;  4BLM A;  1ERO A;  2QPN A;  1TVF A;  2ZM0 A;  4KZ7 A;  3HLB A;  3UE1 A;  4DXB A;  3OPH A;  5CHJ A;  3ZFZ A;  1JWV A;  4S2O A;  4NET A;  1H8Y A;  5FQM A;  2DRW A;  1IEL A;  4S2N A;  2V20 A;  5EE8 A;  3TSG A;  3UY6 A;  5L2F A;  3LO7 A;  1CEG A;  1SKF A;  5CXW A;  1J9M A;  2ZC6 B;  2Y2L A;  4DDS A;  1BLC A;  1BLP A;  1O07 A;  4OQ0 A;  4DDY A;  2ZMA A;  4OH0 A;  5CHM A;  5F82 A;  3TG9 A;  2VGJ A;  2ZQ9 A;  4EWF A;  4OP5 A;  5CTN A;  3RJU A;  5E43 A;  1ERQ A;  4FD8 A;  4EBL A;  4QJG A;  3SOI A;  4Y0O A;  1YT4 A;  2EX8 A;  1K55 A;  3DWZ A;  5IHV A;  4Y7P A;  3CJM A;  1MBL A;  4B4X A;  5BOH A;  3IF5 A;  2XDM A;  1L0G A;  4JF6 A;  3UE3 A;  3ZG7 B;  4QHC A;  4WM9 A;  1QMF A;  1YM1 A;  3C4O A;  4KQR A;  2J9O A;  3B3X A;  4A5R A;  1KVL A;  3IHB A;  5EVL A;  3O86 A;  2ZQ8 A;  1XXM A;  4E6X A;  4B88 A;  3FKW A;  3GRJ A;  1ES2 A;  2EX2 A;  1NZO A;  3G30 A;  3MXS A;  4R4R A;  4KZ9 A;  5CGW A;  1IEM A;  1K38 A;  1FR1 A;  2GDN A;  4CPK A;  2FFY A;  3LCE A;  4HES A;  3HVF A;  3P98 A;  5FI6 A;  4KG2 A;  3V3S A;  4OPR A;  3MZE A;  4LCL A;  4N9L A;  1LHY A;  3FYZ A;  5DF8 A;  1GHM A;  2H0T A;  3BLM A;  4KG5 A;  3S22 A;  4S2J A;  4LEN A;  4EBN A;  2Z2L B;  4MLL A;  4Q8I A;  3WWX A;  2PBY A;  3W4O A;  1ONG A;  5M18 A;  2HDU A;  1EWZ A;  3C4P A;  5E2F A;  1YQS A;  5I94 A;  4ZAM A;  4D2O A;  4BD0 A;  2DCF A;  1PZP A;  5M19 A;  5DVA A;  1TDG A;  4JXW A;  1TDL A;  1M6K A;  3CG5 A;  4P87 A;  2BLS A;  4BD1 A;  2B5R A;  4KZB A;  1JVJ A;  1QME A;  4ZJ2 A;  5EVI D;  3SH9 A;  1KE3 A;  1E3U D;  2WGW A;  3Q81 A;  3ZDJ A;  4ZJ3 A;  1ZG4 A;  1OME A;  1ALQ A;  3HRE A;  3LY3 A;  4GKU A;  5DTS A;  3NIA A;  4OLD A;  1SDN A;  3IT9 A;  5M1A A;  1K56 D;  5DTT A;  2RL3 A;  5FAS A;  3S1Y A;  2XFS A;  3NCK A;  3WS0 A;  5HAI A;  4MEZ A;  1G68 A;  4E3L A;  2WZX A;  1FCO A;  4JXV A;  4IED A;  4JKT A;  3UE0 A;  1I5Q A;  1E4D A;  3S4X A;  1S0W A;  4C75 A;  3VOZ A;  5AQ7 A;  3LY4 A;  5FSR A;  3ISG A;  2XK1 A;  1C3B A;  1DY6 A;  3O88 A;  4OOL A;  2HDS A;  3ZG8 B;  5CEC A;  4H8R A;  4OOY A;  2Q9M A;  4XXR A;  1I2W A;  2JBF A;  3BRM A;  3G2Z A;  4GDB A;  2J8Y A;  2WGV A;  3WS4 A;  2ZC5 B;  2HP9 A;  4OLG A;  5HFO A;  5TGF A;  1K25 A;  1XP4 A;  2Y2Q A;  3G31 A;  1ESU A;  3DTM A;  2HPB A;  3HBR A;  3MKF A;  2IWD A;  1K6R A;  2H0Y A;  3BEB A;  3O87 A;  4WEJ A;  3UN7 A;  2WGW B;  2E8I A;  3NC8 A;  4JXS A;  4P6B A;  4HBU A;  3D4F A;  3FV7 A;  3AGF A;  1U60 A;  1S6R A;  2G2U A;  1HTZ A;  5GLC A;  5CGX A;  4GN2 A;  4GB7 A;  5GLD A;  2P9V A;  1BTL A;  2ZC7 A;  5JYP A;  3NY4 A;  2A3U A;  1WYB A;  4JXG A;  3M2J A;  1FCN A;  3PBT A;  2EXA A;  3IHA A;  2V1Z A;  4RVA A;  5FQ9 A;  5A93 A;  2FFF B;  4N1X A;  1JTG A;  4Y0U A;  5DF9 A;  1KGG A;  5GL9 A;  2Q9N A;  3W4Q A;  3IF6 C;  3IWI A;  4IBR A;  2Y2N A;  3VP3 A;  4PM8 A;  4EBP A;  2WYX A;  4KQO A;  5GLB A;  2OSU A;  3A3J A;  2WAE A;  2ZD8 A;  4S2M A;  1YLP A;  4MBH A;  1L2S A;  4U0X A;  5FI2 A;  2I72 A;  3IXH A;  2PU2 A;  1RGY A;  4DE2 A;  1K57 C;  4P85 A;  3ZNT A;  5FDH A;  5FI7 A;  5E2H A;  2XLN A;  4QD4 A;  2P74 A;  2UWX A;  4X56 A;  2ZQC A;  1HZO A;  4S2N C;  2J9P A;  3PAE A;  4WEK A;  4DF6 A;  4IBX A;  3ZG5 A;  5AQB A;  3FZC A;  2Y2K A;  4UAA A;  3BFC A;  4OP8 A;  2VGK A;  1YLW A;  4BQM A;  5KZH A;  1KDS A;  3BEC A;  1DJA A;  3VFH A;  3NI9 A;  4DE1 A;  1BUE A;  1NJ4 A;  3AGE A;  3Q1F A;  3QNB A;  1PI4 A;  4QY6 A;  3V50 A;  4S2L A;  5A90 A;  5FAQ A;  3HLC A;  3VP1 A;  5EVI A;  1YLZ A;  1E3U A;  1MPL A;  2P9V B;  3IXG A;  4O7D A;  1H5X A;  1WE4 A;  1PI5 A;  2ZM8 A;  2Y91 A;  4E3N A;  4GDN A;  1EI5 A;  4KZ6 A;  1IYO A;  2ZC3 B;  4E3J A;  1K55 C;  2X02 A;  4N9K A;  1K56 A;  1K4E A;  5TR7 A;  5EOE A;  1WYC A;  3E2K A;  1PYY A;  4K0W A;  1GCE A;  5HW3 A;  5D3O A;  3ZGA B;  3G2Y A;  1ES4 A;  3ZVW A;  1PWD A;  1ES3 A;  1I2S A;  2V2F F;  5EEC A;  2G2W A;  3BLS A;  5J8X A;  5CRF A;  4WMC D;  4NK3 A;  1LI0 A;  3BYD A;  3I7J A;  5DF7 A;  3G35 A;  4WZ5 C;  4DE0 A;  2WAD A;  4ZTK A;  3C5A A;  4BJP A;  1YLY A;  2ZLY A;  1DJB A;  1XGJ A;  5F83 A;  2A49 A;  4U3T A;  1L0E A;  2XEP A;  4R0Q A;  2ZQA A;  4C3Q A;  3ZCZ A;  4QU3 A;  2XQZ A;  4QB8 A;  2JC7 A;  3UPO A;  4PPR A;  1LL9 A;  5EVI B;  4F94 A;  4X69 A;  3UDX A;  3ZG0 A;  2IWB A;  5CER A;  4RX3 A;  1JWP A;  3DW0 A;  1CEF A;  5FQQ A;  2HP5 A;  5G18 A;  1KE4 A;  3HUM A;  5TFQ A;  2C5W B;  3SH7 A;  3ZNY A;  1KDW A;  4RX2 A;  4KZ4 A;  2EX6 A;  1BUL A;  1TEM A;  3SS5 A;  3JYI A;  3PTE A;  2Y2H A;  3Q7Z A;  4MNR A;  5HL1 A;  1K6S A;  4WZ4 A;  3C7V A;  3OPL A;  3HLW A;  4BL3 A;  5GHY A;  5A92 A;  4S2K A;  3LEZ A;  1PWG A;  4KEN B;  4OKP A;  4EQI A;  1KVM A;  3IH9 A;  3N8L A;  3V39 A;  3PBR A;  1XA7 A;  4BL2 A;  3WRT A;  4WBG A;  1YMS A;  5AQA A;  4LCM A;  4HEF A;  1FSY A;  1BLH A;  2C6W B;  4OPQ A;  1MXO A;  3A3D A;  3OZH A;  1Q2Q A;  2R9X A;  2HDQ A;  1CI8 A;  1YLJ A;  4R3J A;  3VSL A;  5A91 A;  4M3K A;  4OQH A;  1Y54 A;  1YLT A;  3G4P A;  2XFT A;  4X53 A;  3UPN A;  1IYP A;  3RXW A;  1IYQ A;  1W5D A;  4LV1 A;  1FR6 A;  4P0M A;  4E3O A;  1FOF A;  3VMA A;  5GLA A;  2ZJ9 A;  1ZG6 A;  4GOG A;  4YFM A;  5DTK A;  1NY0 A;  3N4I A;  3PBQ A;  1SHV A;  4OVD A;  3WS5 A;  1LL5 A;  1KE0 A;  5F1G A;  2HDR A;  1H8Z A;  3UO9 A;  3V3R A;  4DE3 A;  4OPZ A;  2JCH A;  1MY8 A;  3HL9 A;  1K4F A;  2ZQD A;  1NXY A;  3GSG A;  5HX9 A;  3DWK A;  5E2G A;  1ES5 A;  1MWS A;  2BG1 A;  5HAP A;  1NYM A;  4KZA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...