5KZHA

High resolution structure of acinetobacter baumannii beta-lactamase oxa-51
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
240
structure length
239
Chain Sequence
DEKAEKIKNLFNEVHTTGVLVIQQGQTQQSYGNDLARASTEYVPASTFMLNALIGLEHHKATTTEVFKWDGQKRLFPEWEKDMTLGDAMKASAIPVYQDLARRIGLELMSKEVKRVGYGNADIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSPKVQDEVQSMLFIEEKNGNKIYAKSGWGWDVDPQVGWLTGWVVQPQGNIVAFSLNLEMKKGIPSSVRKEITYKSLEQLGIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase
publication title The structure of a doripenem-bound OXA-51 class D beta-lactamase variant with enhanced carbapenemase activity.
pubmed doi rcsb
source organism Acinetobacter baumannii
total genus 79
structure length 239
sequence length 240
chains with identical sequence B, C, D
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2016-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5kzhA00
2RL3A 2WKIA 2ZQDA 1DJCA 1W8QA 4X6TA 3DTMA 1ES2A 3ZCZA 1KVMA 1K4EA 4JXSA 4IBRA 3GQZA 1RCJA 1RGZA 3M2JA 3UE0A 1N9BA 1MY8A 4IVKA 4OPYA 4S2NA 3WS4A 3GV9A 4UA6A 3LCEA 4Y0TA 5EVIB 1GCEA 4ZBEA 4BQMA 3IF5A 3OPHA 3A3JA 2WAEA 3ITBA 4MBFA 4JPMA 5BOHA 1GHIA 4MBHA 5EVLA 4HESA 3MZEA 5FAQA 5M1AA 4YFMA 4S2LA 3ZG0A 3ZFZA 4U0XA 5F1GA 3PAGA 3QNCA 1O07A 2XR0A 4KQOA 3RXXA 2J9PA 3FWLA 1EWZA 4OOMA 2ZQ7A 4ID4A 4KQRA 3O88A 4R3JA 1JWPA 1TDLA 5CTNA 3DW0A 3WS1A 2ZC4B 2EXBA 3VOZA 4M3KA 1K55C 1YM1A 5FDHA 5A93A 5FQ9A 1E4DA 3N7WA 3IF6C 5E43A 2XFSA 2EX2A 4XXRA 1EROA 3IWIA 4E3JA 2WZXA 3ZGAB 1IYOA 4X69A 1W79A 1XX2A 1ERMA 2I72A 2XGNA 4WEJA 4OPQA 4KQQA 3N8SA 3GR2A 1FCMA 1L0DA 2J8YA 4PM5A 2HP9A 1ES5A 2WKHA 2Y55A 4R4SA 4X53A 4QY5A 5IHVA 1NJ4A 1K56D 1PYYA 4PMAA 3ZDJA 4KZ7A 3N4IA 4GD6A 4RA7A 1SHVA 5GHZA 1K6SA 3BFGA 3Q7ZA 4S2MA 1FR1A 3CJMA 2Y2QA 5E2HA 4OLGA 2R9WA 3N8RA 2ZC3B 3VP4A 5AQBA 4B4ZA 4OONA 3BLMA 5AQ7A 4WZ4A 1L0EA 1K38A 1VQQA 2Y91A 3MFDA 3W4QA 4DE0A 2ZQ9A 2HP6A 4JKTA 3IXGA 3LY3A 4Q8IA 3C7VA 5GLDA 4JXWA 4S2IA 3A3EA 4JBFA 1GA9A 3V3SA 4OP5A 5M18A 1XP4A 1MBLA 4GN2A 1ALQA 2QPNA 5D3OA 4LENA 3BEBA 3G35A 5CGXA 1PWGA 1OMEA 4WBGA 2EX9A 4FCFA 2Y2NA 1K55A 4X55A 1IELA 3ZNYA 3AGDA 4IEDA 4DF6A 2PU4A 1M6KA 2Y4AA 3MKEA 2G2WA 1GHMA 3PBSA 5F82A 4DE1A 3S4XA 3QHYA 1M40A 1MXOA 1K57A 4GOGA 3UY6A 2XD5A 2H10A 2EFXA 2DNSA 4OQHA 4WM9A 5DTSA 3HLWA 1YQSA 3CMZA 4X56A 3WS5A 1XGJA 4JF4A 1K54C 2Q9NA 2R9XA 1FQGA 3W8KA 5CHMA 3OCNA 3N6IA 1N4OA 3VOYA 4D2OA 3VFFA 3GTCA 3O3VA 2PU2A 1KE0A 1NYMA 3VSLA 1NYYA 5FQQA 3CZDA 1L2SA 1MWUA 1H5XA 3ZG9B 3NCKA 3DWKA 1GHPA 4OQIA 1E25A 1BT5A 3ITAA 4FSFA 2Z2LB 3UE1A 1KGFA 1PI5A 1G68A 1DJBA 1YLWA 1YMXA 1CK3A 4UA9A 1PWCA 4K0WA 3Q81A 1XXMA 1SDNA 3NDGA 2ZQCA 1E3UD 4N92A 3UPPA 5I94A 1FCNA 1MKIA 1NY0A 3O86A 5CECA 1MWSA 1LHYA 2X02A 5KZHA 4DKIA 3Q82A 1JTGA 3HUNA 5G18A 5CRFA 1BLPA 4QY6A 4BENA 2EX8A 2ZC6B 4L0LA 4QHCA 3V39A 3SOIA 3IH8A 4ZJ3A 1BULA 4WZ5A 3DWZA 4OVDA 1RP5A 4S2JA 3ZVWA 1ONHA 1C3BA 1VM1A 4DRTA 2ZJ9A 3IHAA 4HEFA 4Z9QA 4BL3A 3M2KA 5CGWA 2Y2IA 3HUOA 4RYEA 1LL5A 3HLBA 3A3FA 3PBTA 1HZOA 3MZDA 4QB8A 2HDSA 5DF8A 1ZKJA 2ZMAA 5EVID 2WAFA 2X01A 1K54A 2IWDA 3IHBA 3M6BA 1HTZA 3PTEA 3Q7VA 4IBXA 1Z6FA 1K4FA 4JLFA 4KZ8A 4MNRA 2XD1A 5FI6A 1PW8A 3UDXA 3BFDA 3P98A 4N9LA 4YINA 3OPRA 3HLCA 4ZAMA 2Q9MA 1KE4A 1KVLA 3I7JA 4E3OA 5CHUA 3NIAA 5EPHA 1W5DA 1TVFA 3AGFA 4EV4A 1XGIA 2WUQA 3LY4A 3MXRA 1ZC2A 4KG2A 4KZ4A 4LV3A 5EVIC 1BLSA 3HLGA 3O87A 4UHUA 1IYQA 2A49A 2WK0A 2Y2OA 5FAOA 3IXDA 3PBQA 4RX2A 4ZJ2A 4JXVA 5CEBA 5EE8A 4NK3A 3P09A 3FKWA 1BLHA 3A3DA 3N8LA 1H8ZA 5EUAA 2WGVA 2ZD8A 2VGJA 2V20A 3IXBA 5AQAA 2C6WB 2XFTA 4WMCD 4OQGA 4OLDA 4EWFA 3G31A 3C4PA 3NBLA 5J8XA 1DJAA 4S2OA 4EBPA 5KSHA 2OSUA 1ES3A 2WYXA 5FI2A 3V3RA 4E3LA 1HD8A 4K0XA 3S22A 1I2SA 3FYZA 3IXHA 2XF3A 4OOYA 4ZJ1A 5L2FA 2V1ZA 4FH2A 1PW1A 3Q07A 1JTDA 1LLBA 4R4RA 2QMIA 3BM6A 3GMWA 5CERA 4OPRA 4A5RA 2FFFB 4OPZA 1YMSA 3PBOA 1ZG6A 4LV2A 2WKEA 1HVBA 4R3BA 4E6XA 2V2FF 1RGYA 1NRFA 4WYYA 1ONGA 1DY6A 2A3UA 2Y2GA 4R23A 2QZ6A 3IF6A 3IQAA 1NXYA 4LV1A 1EI5A 1FSWA 3HLEA 3HREA 4EBLA 5EOOA 3GRJA 1W8YA 1CEGA 2ZC5B 1BTLA 1CEFA 3BFFA 3Q7VB 4X68A 4EQIA 5A92A 3C7UA 4HBTA 1TEMA 2WADA 1LI0A 4JXGA 3WS0A 2BG1A 3ZHHA 4Y7PA 1ESUA 3OCLA 4R1GA 4BJPA 1J9MA 1JWZA 2XK1A 1Y54A 2Y2PA 1QMFA 4BL2A 4P6BA 2OV5A 5GHYA 4ZDXA 4R0QA 5DF9A 4S2NC 3IWQA 5E2EA 1W7FA 3SH9A 4U3TA 2FFYA 2XLNA 5U47A 4WELA 4KZAA 3BYDA 5HAIA 5GLCA 3G34A 4HBUA 3UPNA 3G32A 4MBKA 5GLAA 3LEZA 4BD1A 2G2UA 4GNUA 4UA7A 2HPBA 3RXWA 1K25A 2HDUA 4OH0A 2ZQAA 4GZBA 2Y59A 5CTMA 5FQIA 4EBNA 5JYOA 4ZTKA 4GDNA 1ESIA 5GL9A 3NDEA 3NY4A 4IVIA 4WEKA 5F1FA 1G6AA 1MPLA 3MBZA 4KG6A 4RX3A 3IWOA 3VSKA 3UO9A 3HVFA 2P74A 4KZ5A 2P9VA 3C5AA 1ERQA 4E3IA 5FASA 3BFEA 1XA1A 4P85A 2J9OA 3SS4A 5HX9A 2Y2HA 2HDQA 3EQVA 2XH9A 4MLLA 3SH8A 1S0WA 4C6YA 2ZLYA 1I2WA 4QU3A 3VMAA 3EQUA 1WYBA 4LV0A 1IKGA 1H8YA 1SCWA 4GB7A 3BECA 1U60A 3PAEA 1LI9A 1YT4A 4P87A 3RJUA 4B88A 5DF7A 4N9KA 5DVAA 5F83A 4RVAA 4E3KA 1NZOA 3D4FA 4JF6A 5TFQA 1XKZA 3MXSA 3VP3A 3WRTA 4DE3A 3VP0A 3ZNTA 1NZUA 3IF6B 5A90A 4S2KA 4BLMA 1KE3A 1WYCA 3HLFA 5CGSA 2JCHA 2ZM8A 4FH4A 5A91A 1MWRA 3WRZA 5CEDA 4GKUA 5DTKA 2ZM0A 4E3NA 5E2GA 5AQ9A 3HLDA 2ZQ8A 2EX6A 2J7VA 3G2ZA 2B5RA 1YLYA 3UNWA 1AXBA 3MZFA 3UE3A 1IYPA 4DXBA 4N1HA 1Q2PA 3AGEA 5E2FA 5FSRA 3VFHA 3VP1A 2X71A 4F94A 3B3XA 3FKVA 2E8IA 1GA0A 4QJGA 1CI8A 4CJNA 3GVBA 4DE2A 3W4PA 4H8RA 2Y2LA 1KGEA 5HL1A 5FQKA 2HDRA 2OLVA 2WGWA 4B4XA 5M19A 3PBNA 4C75A 5FA7A 3JYIA 3ZVTA 3E2KA 2Y2MA 3Q1FA 5KSCA 1FCOA 1QMEA 2UWXA 2JBFA 2EFUA 1I5QA 1ES4A 4PM9A 5EECA 4LCLA 3FZCA 1IKIA 1K57C 3G30A 4QD4A 4Y0UA 2WZZA 1E3UA 3W4OA 3G4PA 4GDBA 2Z2MB 1BZAA 2P9VB 3HL9A 3WWXA 4KENB 5CXWA 4BD0A 2WGIA 3C4OA 3NI9A 3SS5A 3ZG5A 2XEPA 1KDSA 2Y2JA 2RCXA 4C3QA 1WE4A 1XPBA 2DRWA 4NETA 3SH7A 2BLSA 2VGKA 3HBRA 5HARA 3IT9A 1XA7A 3G2YA 2XDMA 4KZBA 4U0TA 4CPKA 4Y0OA 1PZOA 3UPOA 3ZG7B 4KZ6A 1ZG4A 1PI4A 3WS2A 1SDEA 5GLBA 3V50A 5FAPA 4PM8A 3M6HA 1LL9A 1L0FA 3FV7A 5DTTA 5FI7A 1L0GA 5FQJA 4OP8A 4PM7A 1S6RA 3OPLA 5EVIA 2IWCA 3TG9A 3NC8A 5HW3A 5KMWA 4N1XA 5GHXA 4DDYA 4KZ3A 1BUEA 1YLTA 5CHJA 4XUZA 5HFOA 4OQ0A 2ZM2A 3CG5A 3PBRA 3ZG8B 1CI9A 3ISGA 1FOFA 4GD8A 3E2LA 4JF5A 4E6WA 4OKPA 5TR7A 3VP2A 3UDFA 3GSGA 3OZHA 2C5WB 4FD8A 4KG5A 4P0MA 2IWBA 4E3MA 3UDIA 2CC1A 1PWDA 1JWVA 4WZ5C 2Y2KA 2JE5A 3V5MA 3OPPA 3S1YA 2HP5A 1BLCA 3UN7A 3BRMA 5HAPA 3TSGA 2OLUA 4LCMA 2WGWB 4PM6A 1Q2QA 3LO7A 4UAAA 1FSYA 3OC2A 3SS3A 1TDGA 1JVJA 4KZ9A 1O7EA 4MEZA 1KGGA 4EUZA 1FR6A 2H0YA 2EXAA 4OOLA 1IEMA 4DDSA 4DXCA 1K56A 3TOIA 1K6RA 2ZC7A 4WMCA 1YLPA 5FATA 2DCFA 3QNBA 4XUXA 1IYSA 2GDNA 1SKFA 3IH9A 1YLZA 5HAQA 2H0TA 3MKFA 1PZPA 3HUMA 5EOEA 4K91A 1KDWA 1BSGA 4PPRA 2XQZA 4O7DA 2PBYA 3A3IA 3BLSA 5FQMA 3BFCA 5JYPA 5TGFA 2JC7A 2H5SA 1MWTA 4S2PA 1PIOA 1YLJA
chains in the Genus database with same CATH superfamily
3DTMA 1GSWA 3RFBA 3A0VA 4CLCC 2ZMFA 3DBAA 4YWZA 2PR6A 1N9BA 4HNBA 3JPUA 3A3JA 3MMHA 4HESA 3MZEA 3ZFZA 1TS8A 3PAGA 2XR0A 4BBTA 2J9PA 3FWLA 1OTDA 4ID4A 4R3JA 1F98A 5HWWA 5CTNA 3DW0A 3VOZA 3BQ8A 4LFUA 5FQ9A 3TRCA 4IUKA 1IYOA 1NLYA 1W79A 1XX2A 1ERMA 2VV8A 4KQQA 1FCMA 3T4OA 2HP9A 2WKHA 3ZDJA 1SHVA 3NJAA 4DJ2A 3LI8A 4S2MA 3CJMA 4OLGA 2FH5A 3C2WA 3T1QB 2R9WA 3VP4A 4JGOA 3BLMA 4LLOB 5DKLA 4BBVA 2OWHA 2HP6A 4JKTA 3A3EA 5HL6A 3V3SA 4OP5A 5M18A 3UB7A 1T1AA 2QPNA 4I3IA 3NOTC 5CGXA 1LL8A 4FCFA 1IOUA 4EW7A 3ZNYA 3QP2A 5HDCA 1P0ZA 1M6KA 3LICA 3MKEA 3S4XA 3T4JA 4GOGA 2H10A 4OQHA 3HLWA 2H28A 3WS5A 3T1RA 1FQGA 4D2OA 3N6IA 5HDSA 2R78A 4ESPA 1KE0A 3BY8A 1LSVA 3ZG9B 3NCKA 2Z2LB 1DJBA 1E3UD 3B47A 1FCNA 5AVFA 5KZHA 1JTGA 4JGPA 4QY6A 3UE6A 3SOIA 4ZJ3A 2V0UA 4OVDA 4S2JA 3TW8A 4JGRA 3FPWA 4HEFA 2VV6A 3HUOA 2ZMVA 3EGDC 1P9WA 2QJ7A 5DF8A 5EVID 4EESA 1K54A 2IWDA 3IHBA 3M6BA 4IBXA 2PD8A 5FI6A 1PW8A 3UDXA 2FZ0A 3P98A 4ZAMA 2Y8HA 4WLAA 4BWIA 3LY4A 3MXRA 3CPTB 2V8CA 4I5SA 3O87A 4UHUA 2WK0A 5HWVA 3IXDA 3PBQA 5CEBA 4JXVA 3P09A 4I38A 1T19A 3A3DA 2KOIA 1Y4OA 2HGVA 5AQAA 4Q0JA 3LIFA 3G31A 2W1TA 4S2OA 5KSHA 3C30A 2OSUA 3T4LA 1ES3A 5FI2A 3V3RA 4E3LA 4HP4A 4ZJ1A 5L2FA 2PYPA 5DJUA 3F1PA 4OPRA 1ZHHB 1S1YA 4OPZA 1YMSA 3PBOA 1ZG6A 1ACFA 2B18A 2Q0OA 4E6XA 2WKPA 5I5LA 1RGYA 4WYYA 2Y2GA 4HIAA 3KYZA 1FSWA 2ZC5B 4EQIA 4HBTA 2DMWA 2ZL1B 2UV0E 2XK1A 2Y2PA 4BL2A 5GHYA 4ZDXA 3IWQA 2M1CA 3IS2A 4HJ3A 2JKTI 2FFYA 2O99A 4U3TA 4WELA 3G34A 4HBUA 5TBMA 4EEPA 4BMWA 1LSXA 3L9KA 4EXOA 2HDUA 3GECA 2WKQA 4EBNA 4GDNA 3JVVA 1MPLA 4IHQA 4KG6A 4O0PA 3HVFA 3C5AA 4WUJA 1YAXA 2J9OA 2WKRA 3PXPA 5HX9A 3SH8A 4C6YA 1I2WA 4P6ZS 3CHWP 4GS9B 1IKGA 1H8YA 1SCWA 1U60A 3PAEA 3U4LP 1YT4A 3UB5P 4EERA 5DVAA 5F83A 3DTEA 1XJ4A 3WRTA 3VP3A 2JKTM 5CX7A 5CEDA 5A91A 5L07A 3WRZA 3MQ0A 2ZM0A 4E3NA 4GLQA 3HLDA 2ZQ8A 2EX6A 2J7VA 3MJQA 4JGQA 1AXBA 3MZFA 4E04A 4N1HA 2J80A 1Q2PA 3VP1A 3VFHA 2X71A 4QJGA 1S4SA 2Y2LA 5HL1A 2OLVA 2WGWA 4B4XA 3PBNA 5FA7A 3ZVTA 3QP1A 5KSCA 1QMEA 2QYBA 1ES4A 4I3AA 1VETB 4PM9A 4YNRA 2OWJA 4QD4A 2WZZA 3F1NB 3G4PA 4GDBA 5CXWA 1OTBA 5EM1A 1OTAA 3FPVA 2QWSA 3K2NA 1XA7A 4Y0OA 1L3LA 1DRMA 1TS7A 5GLBA 1MC0A 2JN7A 3K3CA 3OPLA 3MR0A 4EU0A 2IWCA 4X1LA 3E98A 4DDYA 5CHJA 4XUZA 5HFOA 4H6JB 3C8CA 1CI9A 1OJ5A 3UB8A 4NXBA 2JE5A 1UWNX 3UN7A 3EWKA 4LCMA 5AVEA 4PM6A 1Q2QA 2EWVA 4Y13A 2VX8A 3OC2A 4NG2A 1TDGA 4X1MA 4KZ9A 1O7EA 4MEZA 1KGGA 2H0YA 2EXAA 1IEMA 3BJNA 4DXCA 3CPTA 1K6RA 4CLCD 4XUXA 1IYSA 1S1ZA 1SKFA 3IH9A 3O5YA 3HUMA 5EOEA 4K91A 1BSGA 3OLOA 4O7DA 2PBYA 5EM0A 5F6AA 5JYPA 2JC7A 1MWTA 2WKIA 1DJCA 5HPFA 2P04A 2M7VA 5DFXA 4Y15A 1K4EA 4JXSA 4IBRA 1RCJA 4R38A 2VKSA 4S2NA 5AJGA 1F5MA 3MXQA 3LCEA 5EVIB 1GCEA 1YKDA 4ZBEA 2I9VA 3ITBA 1GHIA 4MBHA 3UB9A 5M1AA 4YFMA 3UMDA 5F1GA 3QNCA 1O07A 3BW6A 4UQIS 1G6OA 1Z09A 1TDLA 2ZC4B 5A93A 1YM1A 2ZL1A 1E4DA 3N7WA 2XFSA 1EROA 4E3JA 3T4SA 4X69A 2KX6A 1HLUP 4WEJA 5TJJA 3N8SA 2JHEA 3DTKA 4PM5A 5IHVA 1NJ4A 4PMAA 3N4IA 4GD6A 1K6SA 3BFGA 3Q7ZA 5E2HA 2BASA 3N8RA 2ZC3B 5AQBA 4OONA 1L0EA 1K38A 4CLCE 4DE0A 3W4QA 2ZQ9A 4Q8IA 3IXGA 3LY3A 3C7VA 4S2IA 3LIAA 4ARZA 4GN2A 4GS9A 4WBGA 2YKHA 1K55A 2PU4A 1DP8A 1P97A 2G2WA 1UWPX 2IA2A 5F82A 3MFXA 4LRXC 4B93A 5J7EA 2XD5A 3TE8A 2DNSA 4WM9A 3D9YA 3CITA 2Q9NA 3HCYA 3VOYA 3KO6A 3T1SA 4HP9A 5IS1A 1NYMA 3VSLA 1NYYA 3RTYA 3CZDA 3KX0X 1T1CA 4OQIA 1BT5A 3ITAA 3UE1A 1KGFA 1H8MA 3KYEA 1YLWA 1YMXA 1CK3A 1PWCA 1SDNA 5EV0A 3ZYTA 3K3DA 3UPPA 5I94A 1FIKA 1MKIA 1MWSA 2INWA 5KIZA 3V67A 1BLPA 4BENA 3V39A 3IH8A 1BULA 2ZOIA 3DWZA 1ONHA 4HJ6A 2W3FA 4RYEA 2HDSA 4G3VA 3Q7VA 1K4FA 4AFIA 4KZ8A 2XD1A 3BFDA 2EWWA 4N9LA 3T4KA 3BQAA 3HLCA 1K0KA 2PAVP 3OOVA 5CHUA 3P7NA 1W5DA 4EV4A 4KZ4A 4LV3A 3HJIA 4ZJ2A 5EE8A 4NK3A 3FKWA 5EUAA 3PYPA 4WMCD 5FL3A 2L4RA 4II7A 2LB9A 3NBLA 3C38A 5J8XA 5C5KA 1HD8A 2XRNA 3IXHA 1VEUB 2XF3A 3QP6A 1MKMA 1TS6A 2V1ZA 4FH2A 3Q07A 3GMWA 3KSHA 2KLIA 2V8FA 4R3BA 3MF0A 3KYQA 3R7WA 4MN6A 2A3UA 2QZ6A 3IF6A 3IQAA 1OTIA 4LV1A 4Z1WA 4X68A 1G28A 2BG1A 1ESUA 3OCLA 4R1GA 4HQAA 1Y54A 1H3QA 4P6BA 2W3HA 4DJ3A 4R0QA 4D60A 4HJ4A 5DF9A 4S2NC 1W7FA 3SH9A 4ME4A 3UPNA 2Y79A 2G2UA 4GNUA 4DMZA 2A24B 2PRFA 4CLCB 2HPBA 3RXWA 3E0YA 2Y59A 5CTMA 2YKFA 5FQIA 1ESIA 2OAQ1 5GL9A 3UMEA 4WEKA 4IVIA 1G6AA 3VSKA 4F3LB 4Y5FA 2P74A 2P9VA 3BFEA 4P85A 2VLGA 2HV1A 3EQVA 3H82B 1S0WA 2GJ3A 4QU3A 1TF1A 4L9EA 4GB7A 3BECA 4P87A 4NXFA 3EEHA 3MXSA 1NWZA 1NZUA 1N9LA 3HLFA 4MN7A 1MWRA 3U2AA 4KUKA 1D1JA 5E2GA 5AQ9A 5HDDA 1H0MA 2B5RA 3NOUC 4F94A 3FKVA 2E8IA 4H8RA 1KGEA 5EFWA 4C75A 3CLOA 5HPIA 1FCOA 2EFUA 5EECA 4Y0UA 2V1AA 2Z2MB 3WWXA 1J3WA 3SS5A 3LEQA 3S7PA 3ZG5A 2Y2JA 2RCXA 2DRWA 4QPRA 3MQOA 2VGKA 3HBRA 3G2YA 2XDMA 4KZBA 4KQDA 2AVXA 1ZG4A 1PI4A 1SDEA 3V50A 1L0GA 1LL9A 1L0FA 3FV7A 4PM7A 2O9BA 3NC8A 5KMWA 3NULA 2K31A 4N1XA 1BUEA 3ISGA 1FOFA 2W0NA 4OKPA 5TR7A 2JKRI 4P0MA 1N9OA 2CC1A 3BRMA 5HAPA 2OLUA 4HH2A 3LO7A 2D01A 2VZWA 4IJGA 3SS3A 4EUZA 3FC7A 1K56A 1SKOB 4NKPA 1S67L 1YLPA 5FATA 2DCFA 4MCWA 4PPRA 3D72A 4EEUA 5K5BA 2XQZA 3A3IA 3BLSA 5FQMA 3BFCA 4ZRRA 1BYWA 2ZQDA 1W8QA 4X6TA 1ES2A 3ZCZA 1XJ6A 2Z6CA 2J3TD 3M2JA 3UE0A 1MY8A 4IVKA 4OPYA 3WS4A 4Y0TA 3H7WB 4BQMA 1GSVA 1VB6A 2WAEA 2GX5A 1A0KA 5EVLA 3IX3A 4QWOA 4S2LA 3ZG0A 4U0XA 3BWLA 4KQOA 3RXXA 4RQ9A 1EWZA 2ZQ7A 3T4QA 3MSHA 4KQRA 3O88A 3VV4A 4NXGA 3S7QA 3WS1A 2EXBA 3PR6A 3QP5A 4M3KA 3LGOA 3IF6C 2EX2A 3IWIA 4MMNA 4Q0HA 3ZGAB 4L9GA 1V9ZA 1YSQA 4MDZA 2I72A 2XGNA 3LR0A 3SW1A 3GR2A 5FEFA 2W27A 1L0DA 2HJ9C 4GHIB 2Y55A 4R4SA 4QY5A 1K56D 1PYYA 4KZ7A 5GHZA 1FR1A 3VE4A 2LB5A 4F3LA 4WZ4A 1VQQA 3MFDA 4HH3A 4JBFA 2O0YA 3L7HA 5LBRA 3H82A 1XP4A 3RH8B 1MBLA 1ALQA 5D3OA 3BEBA 3G35A 2Y2NA 1IELA 3AGDA 4IEDA 1OTEA 4DF6A 2Y4AA 5HWTA 2O9CA 3PBSA 3QHYA 1M40A 1MXOA 3DTIA 4NXEA 4MN5A 2EFXA 5DTSA 1YQSA 3CMZA 3NHQA 4JF4A 1K54C 5L09A 2R9XA 2V1BA 3VFFA 3GTCA 3O3VA 1UGUA 3DWKA 2KDKA 1E25A 4FSFA 1PI5A 1G68A 4UA9A 3Q81A 2VGLM 2ZQCA 2QHKA 1TD5A 1YPRA 4G3WA 4N92A 1NY0A 5A8BA 3Q82A 3B42A 5G18A 5CRFA 4LPZA 2ZC6B 4QHCA 4WZ5A 2XA7S 3ZVWA 4FUWA 2ZJ9A 3IHAA 4BL3A 2Y2IA 3PBTA 3CUEA 1ZKJA 3S7OA 2ZMAA 2WAFA 2X01A 3T1XA 1HTZA 2J3TC 3PTEA 5IU1A 3S7NA 4JLFA 4YINA 2A2LA 2E8JA 2Q9MA 3I7JA 3D3OA 1XGIA 2WUQA 4KG2A 1ZC2A 4HY8A 1BLSA 3HLGA 2A49A 5FAOA 2BTFP 2L1MA 4O01A 4RX2A 1BLHA 2ZD8A 1F9IA 2V20A 2XFTA 4I39A 4EWFA 3C4PA 1SKOA 1DJAA 4LGWA 4EBPA 4K0XA 3S22A 1I2SA 4OOYA 1PW1A 5CERA 3CAXA 3B33A 2VEAA 4R4RA 3E4PA 4A5RA 4LV2A 3ULFA 2V2FF 2D02A 3FG8A 1NRFA 1ONGA 4R23A 1NXYA 2XROA 1EI5A 5HD3A 4Y3IA 4EBLA 1W8YA 1CEGA 1TEMA 2WADA 1ODVA 1CF0A 4BJPA 1J9MA 4X25A 3MS6A 1JWZA 3R4KA 1T18A 3G6OA 5U47A 3DAVA 4KZAA 1D7EA 5GLCA 2W3EA 3G32A 4MBKA 5GLAA 3LEZA 1XJ2A 4BD1A 3A0RA 4OH0A 3SZTA 1VETA 1NLZA 5JYOA 4WN5A 1OT6A 1ZTUA 3NDEA 3NY4A 2W1TB 2XSSA 3HJKA 4LRYC 3F1OB 3F1NA 4NEED 3NECA 2J3WA 5FASA 1SZVA 1YSPA 2W3DA 4GJ4A 2ZLYA 3VMAA 1PNEA 3RJUA 4DN0A 5DF7A 4N9KA 2PD7A 4RVAA 1G5UA 3LUQA 3D4FA 1XKZA 4DE3A 3VP0A 2VA0A 5A90A 1EW0A 4BLMA 1WYCA 5CGSA 2JCHA 2ZM8A 3PHYA 4FH4A 3NOPC 4GKUA 3QP4A 4H6JA 2OOLA 3G2ZA 3UNWA 3UE3A 1IYPA 4DXBA 4BBUA 1XJ3A 5FSRA 3IS2B 4CJNA 3W4PA 5TBMB 2O9AA 2HDRA 4GW9A 5M19A 3JYIA 3ZQ5A 3E2KA 2Y2MA 2UWXA 2JBFA 2PT7A 1IKIA 3G30A 1E3UA 3W4OA 2HZ5A 1BZAA 3HL9A 1LSWA 3NI9A 2ZOHA 4C3QA 2PR5A 1XPBA 3ICYA 3IT9A 4PHTA 4U0TA 1XFNA 1PZOA 3UPOA 4I3JA 4FOFA 5FAPA 4PM8A 5DTTA 5FQJA 4OP8A 1S6RA 2ACGA 1JNUA 5EVIA 3TG9A 5FDSA 2JKGA 1Y28A 3CG5A 3ZG8B 4JF5A 4GD8A 4E6WA 4G3KA 3UDFA 4FD8A 2C5WB 2IWBA 4E3MA 5HZHA 3UDIA 1JWVA 4WZ5C 3LIDA 2Y2KA 3LR4A 3V5MA 3OPPA 1BLCA 4K08A 2V0WA 3TSGA 2WGWB 3T12B 3CUEC 4UAAA 1X0OA 4B9OA 4PKYA 3KSIA 1FR6A 2ZBBA 4OOLA 4DDSA 3TOIA 2ZC7A 1OPXA 3QNBA 5HAQA 2H0TA 1PFLA 1PZPA 1KDWA 1T1BA 5TGFA 1PIOA 1W63M 5J4EA 1LT0A 2RL3A 1KVMA 2OAP1 3GQZA 1RGZA 3GV9A 3IX4A 4UA6A 2B02A 4WL9A 1XFQA 3IF5A 3LI9A 2HJEA 3OPHA 3W2ZA 4MBFA 4JPMA 2M7UA 5BOHA 2QKPA 5FAQA 3H9WA 4R70A 4GCZA 4OOMA 1JWPA 1CQAA 1K55C 5FDHA 5E43A 4XXRA 2WZXA 2HF6A 3EGXC 1KOUA 3LR5A 4OPQA 1S4RA 2J8YA 1ES5A 4X53A 4RA7A 5EVEA 2Y2QA 1STZA 4B4ZA 5AQ7A 3F1OA 3T4TA 1WA9A 2Y91A 5GLDA 4JXWA 1D06A 1GA9A 2K7SA 3GDIA 2JKFA 4EQ1A 4LENA 5HSQA 1PWGA 1OMEA 2EX9A 5J3WA 2PBDP 4X55A 2L0WA 3EEAA 4PKYG 1GHMA 4P6ZM 4DE1A 1K57A 3IX8A 3UY6A 4X56A 2MJ6A 1XGJA 3TJZC 3W8KA 5CHMA 3OCNA 1N4OA 4PAUA 2PU2A 5DKKA 1DP9A 4ETZA 5FQQA 1L2SA 1MWUA 1H5XA 2PHYA 1F2KA 1GHPA 2CMNA 4K0WA 1XXMA 3NDGA 1PRQA 1GSXA 2VV7A 3O86A 5F69A 5CECA 3BY9A 1LHYA 2X02A 2JKRM 4DKIA 3KSFA 1VEUA 3HUNA 2EX8A 4L0LA 2VJWA 4IUHA 4ARZB 5DFYA 1V9YA 2QJ5A 3MQQA 3OBFA 1RP5A 1VM1A 1C3BA 4DRTA 4Z9QA 4CQHA 3M2KA 5CGWA 1LL5A 3HLBA 3A3FA 3VE3A 1HZOA 3MZDA 4QB8A 1P9RA 1Z6FA 4MNRA 3UB6A 3E4QA 3OPRA 1KE4A 1KVLA 4E3OA 3NIAA 5EPHA 1TVFA 3AGFA 3KSGA 5EVIC 1IYQA 2Y2OA 1FILA 4LRZE 4XT2B 3N8LA 1H8ZA 2A24A 4Q0IA 4R6LA 2WGVA 4CLCA 2W3GA 2VGJA 3IXBA 1N9NA 3LYXA 2C6WB 4OQGA 2B95A 4OLDA 3A0SA 4HOIA 2WYXA 4EETB 3FYZA 3JVUA 1JTDA 1LLBA 2QMIA 3BM6A 2FFFB 4KUOA 2WKEA 1HVBA 5L10A 2K2NA 5MC7A 1DY6A 4L9FA 3HLEA 3HREA 5EOOA 3GRJA 5A92A 1BTLA 1CEFA 3BFFA 3Q7VB 2PYRA 3C7UA 1LI0A 4JXGA 4Y17A 3WS0A 5G4YA 3ZHHA 3E4OA 4Y7PA 4O8GA 3VOLA 3IBJA 1QMFA 2OV5A 4HI4A 5E2EA 2VK3A 2XA7M 2XLNA 3BYDA 5HAIA 3T50A 3P01A 4UA7A 1K25A 2ZQAA 4GZBA 4UQIM 2GNXA 4ZTKA 4FTXA 5F1FA 3MBZA 4RX3A 3IWOA 3UO9A 4KZ5A 4E3IA 1ERQA 1XA1A 3SS4A 2Y2HA 2HDQA 2XH9A 4MLLA 3EQUA 1WYBA 4LV0A 4B88A 2G7UA 1LI9A 4E3KA 1NZOA 4JF6A 5HD5A 5TFQA 3R7WB 3ZNTA 3IF6B 3EOIA 5F68A 4S2KA 1KE3A 5FEGA 1AWIA 5DTKA 1S66L 3LR3A 2PDRA 1YLYA 1CJFA 3AGEA 1OJGA 5E2FA 3B3XA 3QP8A 4YOFA 1GA0A 2VGLS 1CI8A 4DE2A 3CWFA 3GVBA 5FQKA 2P7JA 4WF0A 3Q1FA 1I5QA 4M4XA 4LCLA 3FZCA 3CI6A 1K57C 5F5YA 2EA9A 1IFQA 2GZAA 2P9VB 2Z6DA 4KENB 4BD0A 2WGIA 3C4OA 4R3AA 2XEPA 5L8MA 1KDSA 1MZUA 1WE4A 4NETA 3SH7A 2BLSA 5HARA 2NUPC 4CPKA 3ZG7B 4KZ6A 4ETXA 3WS2A 5FI7A 3M6HA 1DP6A 3H7WA 5HW3A 5GHXA 4KZ3A 1YLTA 2V9AA 4OQ0A 1W63Q 2ZM2A 3PBRA 3E2LA 1NRJA 3LFVA 4Y2FA 5G4ZA 3VP2A 3GSGA 3OZHA 4KG5A 2W1RA 1PWDA 3IBRA 3S1YA 2HP5A 1VHMA 2P08A 1FSYA 1JVJA 5DJTA 4UEYA 4EUVA 2NUTC 4HHDA 4WMCA 1TS0A 3LIBA 2GDNA 4XT2A 1YLZA 1OT9A 4GHIA 3MKFA 3LIEA 3F1PB 5IT5A 2H5SA 4S2PA 1YLJA
chains in the Genus database with same CATH topology
2RL3A 2WKIA 2ZQDA 1DJCA 1W8QA 4X6TA 3DTMA 1ES2A 3ZCZA 1KVMA 1K4EA 4JXSA 4IBRA 3GQZA 1RCJA 1RGZA 3M2JA 3UE0A 1N9BA 1MY8A 4IVKA 4OPYA 4S2NA 3WS4A 3GV9A 4UA6A 3LCEA 4Y0TA 5EVIB 1GCEA 4ZBEA 4BQMA 3IF5A 3OPHA 3A3JA 2WAEA 3ITBA 4MBFA 4JPMA 5BOHA 1GHIA 4MBHA 5EVLA 4HESA 3MZEA 5FAQA 5M1AA 4YFMA 4S2LA 3ZG0A 3ZFZA 4U0XA 5F1GA 3PAGA 3QNCA 1O07A 2XR0A 4KQOA 3RXXA 2J9PA 3FWLA 1EWZA 4OOMA 2ZQ7A 4ID4A 4KQRA 3O88A 4R3JA 1JWPA 1TDLA 5CTNA 3DW0A 3WS1A 2ZC4B 2EXBA 3VOZA 4M3KA 1K55C 1YM1A 5FDHA 5A93A 5FQ9A 1E4DA 3N7WA 3IF6C 5E43A 2XFSA 2EX2A 4XXRA 1EROA 3IWIA 4E3JA 2WZXA 3ZGAB 1IYOA 4X69A 1W79A 1XX2A 1ERMA 2I72A 2XGNA 4WEJA 4OPQA 4KQQA 3N8SA 3GR2A 1FCMA 1L0DA 2J8YA 4PM5A 2HP9A 1ES5A 2WKHA 2Y55A 4R4SA 4X53A 4QY5A 5IHVA 1NJ4A 1K56D 1PYYA 4PMAA 3ZDJA 4KZ7A 3N4IA 4GD6A 4RA7A 1SHVA 5GHZA 1K6SA 3BFGA 3Q7ZA 4S2MA 1FR1A 3CJMA 2Y2QA 5E2HA 4OLGA 2R9WA 3N8RA 2ZC3B 3VP4A 5AQBA 4B4ZA 4OONA 3BLMA 5AQ7A 4WZ4A 1L0EA 1K38A 1VQQA 2Y91A 3MFDA 3W4QA 4DE0A 2ZQ9A 2HP6A 4JKTA 3IXGA 3LY3A 4Q8IA 3C7VA 5GLDA 4JXWA 4S2IA 3A3EA 4JBFA 1GA9A 3V3SA 4OP5A 5M18A 1XP4A 1MBLA 4GN2A 1ALQA 2QPNA 5D3OA 4LENA 3BEBA 3G35A 5CGXA 1PWGA 1OMEA 4WBGA 2EX9A 4FCFA 2Y2NA 1K55A 4X55A 1IELA 3ZNYA 3AGDA 4IEDA 4DF6A 2PU4A 1M6KA 2Y4AA 3MKEA 2G2WA 1GHMA 3PBSA 5F82A 4DE1A 3S4XA 3QHYA 1M40A 1MXOA 1K57A 4GOGA 3UY6A 2XD5A 2H10A 2EFXA 2DNSA 4OQHA 4WM9A 5DTSA 3HLWA 1YQSA 3CMZA 4X56A 3WS5A 1XGJA 4JF4A 1K54C 2Q9NA 2R9XA 1FQGA 3W8KA 5CHMA 3OCNA 3N6IA 1N4OA 3VOYA 4D2OA 3VFFA 3GTCA 3O3VA 2PU2A 1KE0A 1NYMA 3VSLA 1NYYA 5FQQA 3CZDA 1L2SA 1MWUA 1H5XA 3ZG9B 3NCKA 3DWKA 1GHPA 4OQIA 1E25A 1BT5A 3ITAA 4FSFA 2Z2LB 3UE1A 1KGFA 1PI5A 1G68A 1DJBA 1YLWA 1YMXA 1CK3A 4UA9A 1PWCA 4K0WA 3Q81A 1XXMA 1SDNA 3NDGA 2ZQCA 1E3UD 4N92A 3UPPA 5I94A 1FCNA 1MKIA 1NY0A 3O86A 5CECA 1MWSA 1LHYA 2X02A 5KZHA 4DKIA 3Q82A 1JTGA 3HUNA 5G18A 5CRFA 1BLPA 4QY6A 4BENA 2EX8A 2ZC6B 4L0LA 4QHCA 3V39A 3SOIA 3IH8A 4ZJ3A 1BULA 4WZ5A 3DWZA 4OVDA 1RP5A 4S2JA 3ZVWA 1ONHA 1C3BA 1VM1A 4DRTA 2ZJ9A 3IHAA 4HEFA 4Z9QA 4BL3A 3M2KA 5CGWA 2Y2IA 3HUOA 4RYEA 1LL5A 3HLBA 3A3FA 3PBTA 1HZOA 3MZDA 4QB8A 2HDSA 5DF8A 1ZKJA 2ZMAA 5EVID 2WAFA 2X01A 1K54A 2IWDA 3IHBA 3M6BA 1HTZA 3PTEA 3Q7VA 4IBXA 1Z6FA 1K4FA 4JLFA 4KZ8A 4MNRA 2XD1A 5FI6A 1PW8A 3UDXA 3BFDA 3P98A 4N9LA 4YINA 3OPRA 3HLCA 4ZAMA 2Q9MA 1KE4A 1KVLA 3I7JA 4E3OA 5CHUA 3NIAA 5EPHA 1W5DA 1TVFA 3AGFA 4EV4A 1XGIA 2WUQA 3LY4A 3MXRA 1ZC2A 4KG2A 4KZ4A 4LV3A 5EVIC 1BLSA 3HLGA 3O87A 4UHUA 1IYQA 2A49A 2WK0A 2Y2OA 5FAOA 3IXDA 3PBQA 4RX2A 4ZJ2A 4JXVA 5CEBA 5EE8A 4NK3A 3P09A 3FKWA 1BLHA 3A3DA 3N8LA 1H8ZA 5EUAA 2WGVA 2ZD8A 2VGJA 2V20A 3IXBA 5AQAA 2C6WB 2XFTA 4WMCD 4OQGA 4OLDA 4EWFA 3G31A 3C4PA 3NBLA 5J8XA 1DJAA 4S2OA 4EBPA 5KSHA 2OSUA 1ES3A 2WYXA 5FI2A 3V3RA 4E3LA 1HD8A 4K0XA 3S22A 1I2SA 3FYZA 3IXHA 2XF3A 4OOYA 4ZJ1A 5L2FA 2V1ZA 4FH2A 1PW1A 3Q07A 1JTDA 1LLBA 4R4RA 2QMIA 3BM6A 3GMWA 5CERA 4OPRA 4A5RA 2FFFB 4OPZA 1YMSA 3PBOA 1ZG6A 4LV2A 2WKEA 1HVBA 4R3BA 4E6XA 2V2FF 1RGYA 1NRFA 4WYYA 1ONGA 1DY6A 2A3UA 2Y2GA 4R23A 2QZ6A 3IF6A 3IQAA 1NXYA 4LV1A 1EI5A 1FSWA 3HLEA 3HREA 4EBLA 5EOOA 3GRJA 1W8YA 1CEGA 2ZC5B 1BTLA 1CEFA 3BFFA 3Q7VB 4X68A 4EQIA 5A92A 3C7UA 4HBTA 1TEMA 2WADA 1LI0A 4JXGA 3WS0A 2BG1A 3ZHHA 4Y7PA 1ESUA 3OCLA 4R1GA 4BJPA 1J9MA 1JWZA 2XK1A 1Y54A 2Y2PA 1QMFA 4BL2A 4P6BA 2OV5A 5GHYA 4ZDXA 4R0QA 5DF9A 4S2NC 3IWQA 5E2EA 1W7FA 3SH9A 4U3TA 2FFYA 2XLNA 5U47A 4WELA 4KZAA 3BYDA 5HAIA 5GLCA 3G34A 4HBUA 3UPNA 3G32A 4MBKA 5GLAA 3LEZA 4BD1A 2G2UA 4GNUA 4UA7A 2HPBA 3RXWA 1K25A 2HDUA 4OH0A 2ZQAA 4GZBA 2Y59A 5CTMA 5FQIA 4EBNA 5JYOA 4ZTKA 4GDNA 1ESIA 5GL9A 3NDEA 3NY4A 4IVIA 4WEKA 5F1FA 1G6AA 1MPLA 3MBZA 4KG6A 4RX3A 3IWOA 3VSKA 3UO9A 3HVFA 2P74A 4KZ5A 2P9VA 3C5AA 1ERQA 4E3IA 5FASA 3BFEA 1XA1A 4P85A 2J9OA 3SS4A 5HX9A 2Y2HA 2HDQA 3EQVA 2XH9A 4MLLA 3SH8A 1S0WA 4C6YA 2ZLYA 1I2WA 4QU3A 3VMAA 3EQUA 1WYBA 4LV0A 1IKGA 1H8YA 1SCWA 4GB7A 3BECA 1U60A 3PAEA 1LI9A 1YT4A 4P87A 3RJUA 4B88A 5DF7A 4N9KA 5DVAA 5F83A 4RVAA 4E3KA 1NZOA 3D4FA 4JF6A 5TFQA 1XKZA 3MXSA 3VP3A 3WRTA 4DE3A 3VP0A 3ZNTA 1NZUA 3IF6B 5A90A 4S2KA 4BLMA 1KE3A 1WYCA 3HLFA 5CGSA 2JCHA 2ZM8A 4FH4A 5A91A 1MWRA 3WRZA 5CEDA 4GKUA 5DTKA 2ZM0A 4E3NA 5E2GA 5AQ9A 3HLDA 2ZQ8A 2EX6A 2J7VA 3G2ZA 2B5RA 1YLYA 3UNWA 1AXBA 3MZFA 3UE3A 1IYPA 4DXBA 4N1HA 1Q2PA 3AGEA 5E2FA 5FSRA 3VFHA 3VP1A 2X71A 4F94A 3B3XA 3FKVA 2E8IA 1GA0A 4QJGA 1CI8A 4CJNA 3GVBA 4DE2A 3W4PA 4H8RA 2Y2LA 1KGEA 5HL1A 5FQKA 2HDRA 2OLVA 2WGWA 4B4XA 5M19A 3PBNA 4C75A 5FA7A 3JYIA 3ZVTA 3E2KA 2Y2MA 3Q1FA 5KSCA 1FCOA 1QMEA 2UWXA 2JBFA 2EFUA 1I5QA 1ES4A 4PM9A 5EECA 4LCLA 3FZCA 1IKIA 1K57C 3G30A 4QD4A 4Y0UA 2WZZA 1E3UA 3W4OA 3G4PA 4GDBA 2Z2MB 1BZAA 2P9VB 3HL9A 3WWXA 4KENB 5CXWA 4BD0A 2WGIA 3C4OA 3NI9A 3SS5A 3ZG5A 2XEPA 1KDSA 2Y2JA 2RCXA 4C3QA 1WE4A 1XPBA 2DRWA 4NETA 3SH7A 2BLSA 2VGKA 3HBRA 5HARA 3IT9A 1XA7A 3G2YA 2XDMA 4KZBA 4U0TA 4CPKA 4Y0OA 1PZOA 3UPOA 3ZG7B 4KZ6A 1ZG4A 1PI4A 3WS2A 1SDEA 5GLBA 3V50A 5FAPA 4PM8A 3M6HA 1LL9A 1L0FA 3FV7A 5DTTA 5FI7A 1L0GA 5FQJA 4OP8A 4PM7A 1S6RA 3OPLA 5EVIA 2IWCA 3TG9A 3NC8A 5HW3A 5KMWA 4N1XA 5GHXA 4DDYA 4KZ3A 1BUEA 1YLTA 5CHJA 4XUZA 5HFOA 4OQ0A 2ZM2A 3CG5A 3PBRA 3ZG8B 1CI9A 3ISGA 1FOFA 4GD8A 3E2LA 4JF5A 4E6WA 4OKPA 5TR7A 3VP2A 3UDFA 3GSGA 3OZHA 2C5WB 4FD8A 4KG5A 4P0MA 2IWBA 4E3MA 3UDIA 2CC1A 1PWDA 1JWVA 4WZ5C 2Y2KA 2JE5A 3V5MA 3OPPA 3S1YA 2HP5A 1BLCA 3UN7A 3BRMA 5HAPA 3TSGA 2OLUA 4LCMA 2WGWB 4PM6A 1Q2QA 3LO7A 4UAAA 1FSYA 3OC2A 3SS3A 1TDGA 1JVJA 4KZ9A 1O7EA 4MEZA 1KGGA 4EUZA 1FR6A 2H0YA 2EXAA 4OOLA 1IEMA 4DDSA 4DXCA 1K56A 3TOIA 1K6RA 2ZC7A 4WMCA 1YLPA 5FATA 2DCFA 3QNBA 4XUXA 1IYSA 2GDNA 1SKFA 3IH9A 1YLZA 5HAQA 2H0TA 3MKFA 1PZPA 3HUMA 5EOEA 4K91A 1KDWA 1BSGA 4PPRA 2XQZA 4O7DA 2PBYA 3A3IA 3BLSA 5FQMA 3BFCA 5JYPA 5TGFA 2JC7A 2H5SA 1MWTA 4S2PA 1PIOA 1YLJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RL3 A;  2WKI A;  2ZQD A;  1DJC A;  1W8Q A;  4X6T A;  3DTM A;  1ES2 A;  3ZCZ A;  1KVM A;  1K4E A;  4JXS A;  4IBR A;  3GQZ A;  1RCJ A;  1RGZ A;  3M2J A;  3UE0 A;  1N9B A;  1MY8 A;  4IVK A;  4OPY A;  4S2N A;  3WS4 A;  3GV9 A;  4UA6 A;  3LCE A;  4Y0T A;  5EVI B;  1GCE A;  4ZBE A;  4BQM A;  3IF5 A;  3OPH A;  3A3J A;  2WAE A;  3ITB A;  4MBF A;  4JPM A;  5BOH A;  1GHI A;  4MBH A;  5EVL A;  4HES A;  3MZE A;  5FAQ A;  5M1A A;  4YFM A;  4S2L A;  3ZG0 A;  3ZFZ A;  4U0X A;  5F1G A;  3PAG A;  3QNC A;  1O07 A;  2XR0 A;  4KQO A;  3RXX A;  2J9P A;  3FWL A;  1EWZ A;  4OOM A;  2ZQ7 A;  4ID4 A;  4KQR A;  3O88 A;  4R3J A;  1JWP A;  1TDL A;  5CTN A;  3DW0 A;  3WS1 A;  2ZC4 B;  2EXB A;  3VOZ A;  4M3K A;  1K55 C;  1YM1 A;  5FDH A;  5A93 A;  5FQ9 A;  1E4D A;  3N7W A;  3IF6 C;  5E43 A;  2XFS A;  2EX2 A;  4XXR A;  1ERO A;  3IWI A;  4E3J A;  2WZX A;  3ZGA B;  1IYO A;  4X69 A;  1W79 A;  1XX2 A;  1ERM A;  2I72 A;  2XGN A;  4WEJ A;  4OPQ A;  4KQQ A;  3N8S A;  3GR2 A;  1FCM A;  1L0D A;  2J8Y A;  4PM5 A;  2HP9 A;  1ES5 A;  2WKH A;  2Y55 A;  4R4S A;  4X53 A;  4QY5 A;  5IHV A;  1NJ4 A;  1K56 D;  1PYY A;  4PMA A;  3ZDJ A;  4KZ7 A;  3N4I A;  4GD6 A;  4RA7 A;  1SHV A;  5GHZ A;  1K6S A;  3BFG A;  3Q7Z A;  4S2M A;  1FR1 A;  3CJM A;  2Y2Q A;  5E2H A;  4OLG A;  2R9W A;  3N8R A;  2ZC3 B;  3VP4 A;  5AQB A;  4B4Z A;  4OON A;  3BLM A;  5AQ7 A;  4WZ4 A;  1L0E A;  1K38 A;  1VQQ A;  2Y91 A;  3MFD A;  3W4Q A;  4DE0 A;  2ZQ9 A;  2HP6 A;  4JKT A;  3IXG A;  3LY3 A;  4Q8I A;  3C7V A;  5GLD A;  4JXW A;  4S2I A;  3A3E A;  4JBF A;  1GA9 A;  3V3S A;  4OP5 A;  5M18 A;  1XP4 A;  1MBL A;  4GN2 A;  1ALQ A;  2QPN A;  5D3O A;  4LEN A;  3BEB A;  3G35 A;  5CGX A;  1PWG A;  1OME A;  4WBG A;  2EX9 A;  4FCF A;  2Y2N A;  1K55 A;  4X55 A;  1IEL A;  3ZNY A;  3AGD A;  4IED A;  4DF6 A;  2PU4 A;  1M6K A;  2Y4A A;  3MKE A;  2G2W A;  1GHM A;  3PBS A;  5F82 A;  4DE1 A;  3S4X A;  3QHY A;  1M40 A;  1MXO A;  1K57 A;  4GOG A;  3UY6 A;  2XD5 A;  2H10 A;  2EFX A;  2DNS A;  4OQH A;  4WM9 A;  5DTS A;  3HLW A;  1YQS A;  3CMZ A;  4X56 A;  3WS5 A;  1XGJ A;  4JF4 A;  1K54 C;  2Q9N A;  2R9X A;  1FQG A;  3W8K A;  5CHM A;  3OCN A;  3N6I A;  1N4O A;  3VOY A;  4D2O A;  3VFF A;  3GTC A;  3O3V A;  2PU2 A;  1KE0 A;  1NYM A;  3VSL A;  1NYY A;  5FQQ A;  3CZD A;  1L2S A;  1MWU A;  1H5X A;  3ZG9 B;  3NCK A;  3DWK A;  1GHP A;  4OQI A;  1E25 A;  1BT5 A;  3ITA A;  4FSF A;  2Z2L B;  3UE1 A;  1KGF A;  1PI5 A;  1G68 A;  1DJB A;  1YLW A;  1YMX A;  1CK3 A;  4UA9 A;  1PWC A;  4K0W A;  3Q81 A;  1XXM A;  1SDN A;  3NDG A;  2ZQC A;  1E3U D;  4N92 A;  3UPP A;  5I94 A;  1FCN A;  1MKI A;  1NY0 A;  3O86 A;  5CEC A;  1MWS A;  1LHY A;  2X02 A;  5KZH A;  4DKI A;  3Q82 A;  1JTG A;  3HUN A;  5G18 A;  5CRF A;  1BLP A;  4QY6 A;  4BEN A;  2EX8 A;  2ZC6 B;  4L0L A;  4QHC A;  3V39 A;  3SOI A;  3IH8 A;  4ZJ3 A;  1BUL A;  4WZ5 A;  3DWZ A;  4OVD A;  1RP5 A;  4S2J A;  3ZVW A;  1ONH A;  1C3B A;  1VM1 A;  4DRT A;  2ZJ9 A;  3IHA A;  4HEF A;  4Z9Q A;  4BL3 A;  3M2K A;  5CGW A;  2Y2I A;  3HUO A;  4RYE A;  1LL5 A;  3HLB A;  3A3F A;  3PBT A;  1HZO A;  3MZD A;  4QB8 A;  2HDS A;  5DF8 A;  1ZKJ A;  2ZMA A;  5EVI D;  2WAF A;  2X01 A;  1K54 A;  2IWD A;  3IHB A;  3M6B A;  1HTZ A;  3PTE A;  3Q7V A;  4IBX A;  1Z6F A;  1K4F A;  4JLF A;  4KZ8 A;  4MNR A;  2XD1 A;  5FI6 A;  1PW8 A;  3UDX A;  3BFD A;  3P98 A;  4N9L A;  4YIN A;  3OPR A;  3HLC A;  4ZAM A;  2Q9M A;  1KE4 A;  1KVL A;  3I7J A;  4E3O A;  5CHU A;  3NIA A;  5EPH A;  1W5D A;  1TVF A;  3AGF A;  4EV4 A;  1XGI A;  2WUQ A;  3LY4 A;  3MXR A;  1ZC2 A;  4KG2 A;  4KZ4 A;  4LV3 A;  5EVI C;  1BLS A;  3HLG A;  3O87 A;  4UHU A;  1IYQ A;  2A49 A;  2WK0 A;  2Y2O A;  5FAO A;  3IXD A;  3PBQ A;  4RX2 A;  4ZJ2 A;  4JXV A;  5CEB A;  5EE8 A;  4NK3 A;  3P09 A;  3FKW A;  1BLH A;  3A3D A;  3N8L A;  1H8Z A;  5EUA A;  2WGV A;  2ZD8 A;  2VGJ A;  2V20 A;  3IXB A;  5AQA A;  2C6W B;  2XFT A;  4WMC D;  4OQG A;  4OLD A;  4EWF A;  3G31 A;  3C4P A;  3NBL A;  5J8X A;  1DJA A;  4S2O A;  4EBP A;  5KSH A;  2OSU A;  1ES3 A;  2WYX A;  5FI2 A;  3V3R A;  4E3L A;  1HD8 A;  4K0X A;  3S22 A;  1I2S A;  3FYZ A;  3IXH A;  2XF3 A;  4OOY A;  4ZJ1 A;  5L2F A;  2V1Z A;  4FH2 A;  1PW1 A;  3Q07 A;  1JTD A;  1LLB A;  4R4R A;  2QMI A;  3BM6 A;  3GMW A;  5CER A;  4OPR A;  4A5R A;  2FFF B;  4OPZ A;  1YMS A;  3PBO A;  1ZG6 A;  4LV2 A;  2WKE A;  1HVB A;  4R3B A;  4E6X A;  2V2F F;  1RGY A;  1NRF A;  4WYY A;  1ONG A;  1DY6 A;  2A3U A;  2Y2G A;  4R23 A;  2QZ6 A;  3IF6 A;  3IQA A;  1NXY A;  4LV1 A;  1EI5 A;  1FSW A;  3HLE A;  3HRE A;  4EBL A;  5EOO A;  3GRJ A;  1W8Y A;  1CEG A;  2ZC5 B;  1BTL A;  1CEF A;  3BFF A;  3Q7V B;  4X68 A;  4EQI A;  5A92 A;  3C7U A;  4HBT A;  1TEM A;  2WAD A;  1LI0 A;  4JXG A;  3WS0 A;  2BG1 A;  3ZHH A;  4Y7P A;  1ESU A;  3OCL A;  4R1G A;  4BJP A;  1J9M A;  1JWZ A;  2XK1 A;  1Y54 A;  2Y2P A;  1QMF A;  4BL2 A;  4P6B A;  2OV5 A;  5GHY A;  4ZDX A;  4R0Q A;  5DF9 A;  4S2N C;  3IWQ A;  5E2E A;  1W7F A;  3SH9 A;  4U3T A;  2FFY A;  2XLN A;  5U47 A;  4WEL A;  4KZA A;  3BYD A;  5HAI A;  5GLC A;  3G34 A;  4HBU A;  3UPN A;  3G32 A;  4MBK A;  5GLA A;  3LEZ A;  4BD1 A;  2G2U A;  4GNU A;  4UA7 A;  2HPB A;  3RXW A;  1K25 A;  2HDU A;  4OH0 A;  2ZQA A;  4GZB A;  2Y59 A;  5CTM A;  5FQI A;  4EBN A;  5JYO A;  4ZTK A;  4GDN A;  1ESI A;  5GL9 A;  3NDE A;  3NY4 A;  4IVI A;  4WEK A;  5F1F A;  1G6A A;  1MPL A;  3MBZ A;  4KG6 A;  4RX3 A;  3IWO A;  3VSK A;  3UO9 A;  3HVF A;  2P74 A;  4KZ5 A;  2P9V A;  3C5A A;  1ERQ A;  4E3I A;  5FAS A;  3BFE A;  1XA1 A;  4P85 A;  2J9O A;  3SS4 A;  5HX9 A;  2Y2H A;  2HDQ A;  3EQV A;  2XH9 A;  4MLL A;  3SH8 A;  1S0W A;  4C6Y A;  2ZLY A;  1I2W A;  4QU3 A;  3VMA A;  3EQU A;  1WYB A;  4LV0 A;  1IKG A;  1H8Y A;  1SCW A;  4GB7 A;  3BEC A;  1U60 A;  3PAE A;  1LI9 A;  1YT4 A;  4P87 A;  3RJU A;  4B88 A;  5DF7 A;  4N9K A;  5DVA A;  5F83 A;  4RVA A;  4E3K A;  1NZO A;  3D4F A;  4JF6 A;  5TFQ A;  1XKZ A;  3MXS A;  3VP3 A;  3WRT A;  4DE3 A;  3VP0 A;  3ZNT A;  1NZU A;  3IF6 B;  5A90 A;  4S2K A;  4BLM A;  1KE3 A;  1WYC A;  3HLF A;  5CGS A;  2JCH A;  2ZM8 A;  4FH4 A;  5A91 A;  1MWR A;  3WRZ A;  5CED A;  4GKU A;  5DTK A;  2ZM0 A;  4E3N A;  5E2G A;  5AQ9 A;  3HLD A;  2ZQ8 A;  2EX6 A;  2J7V A;  3G2Z A;  2B5R A;  1YLY A;  3UNW A;  1AXB A;  3MZF A;  3UE3 A;  1IYP A;  4DXB A;  4N1H A;  1Q2P A;  3AGE A;  5E2F A;  5FSR A;  3VFH A;  3VP1 A;  2X71 A;  4F94 A;  3B3X A;  3FKV A;  2E8I A;  1GA0 A;  4QJG A;  1CI8 A;  4CJN A;  3GVB A;  4DE2 A;  3W4P A;  4H8R A;  2Y2L A;  1KGE A;  5HL1 A;  5FQK A;  2HDR A;  2OLV A;  2WGW A;  4B4X A;  5M19 A;  3PBN A;  4C75 A;  5FA7 A;  3JYI A;  3ZVT A;  3E2K A;  2Y2M A;  3Q1F A;  5KSC A;  1FCO A;  1QME A;  2UWX A;  2JBF A;  2EFU A;  1I5Q A;  1ES4 A;  4PM9 A;  5EEC A;  4LCL A;  3FZC A;  1IKI A;  1K57 C;  3G30 A;  4QD4 A;  4Y0U A;  2WZZ A;  1E3U A;  3W4O A;  3G4P A;  4GDB A;  2Z2M B;  1BZA A;  2P9V B;  3HL9 A;  3WWX A;  4KEN B;  5CXW A;  4BD0 A;  2WGI A;  3C4O A;  3NI9 A;  3SS5 A;  3ZG5 A;  2XEP A;  1KDS A;  2Y2J A;  2RCX A;  4C3Q A;  1WE4 A;  1XPB A;  2DRW A;  4NET A;  3SH7 A;  2BLS A;  2VGK A;  3HBR A;  5HAR A;  3IT9 A;  1XA7 A;  3G2Y A;  2XDM A;  4KZB A;  4U0T A;  4CPK A;  4Y0O A;  1PZO A;  3UPO A;  3ZG7 B;  4KZ6 A;  1ZG4 A;  1PI4 A;  3WS2 A;  1SDE A;  5GLB A;  3V50 A;  5FAP A;  4PM8 A;  3M6H A;  1LL9 A;  1L0F A;  3FV7 A;  5DTT A;  5FI7 A;  1L0G A;  5FQJ A;  4OP8 A;  4PM7 A;  1S6R A;  3OPL A;  5EVI A;  2IWC A;  3TG9 A;  3NC8 A;  5HW3 A;  5KMW A;  4N1X A;  5GHX A;  4DDY A;  4KZ3 A;  1BUE A;  1YLT A;  5CHJ A;  4XUZ A;  5HFO A;  4OQ0 A;  2ZM2 A;  3CG5 A;  3PBR A;  3ZG8 B;  1CI9 A;  3ISG A;  1FOF A;  4GD8 A;  3E2L A;  4JF5 A;  4E6W A;  4OKP A;  5TR7 A;  3VP2 A;  3UDF A;  3GSG A;  3OZH A;  2C5W B;  4FD8 A;  4KG5 A;  4P0M A;  2IWB A;  4E3M A;  3UDI A;  2CC1 A;  1PWD A;  1JWV A;  4WZ5 C;  2Y2K A;  2JE5 A;  3V5M A;  3OPP A;  3S1Y A;  2HP5 A;  1BLC A;  3UN7 A;  3BRM A;  5HAP A;  3TSG A;  2OLU A;  4LCM A;  2WGW B;  4PM6 A;  1Q2Q A;  3LO7 A;  4UAA A;  1FSY A;  3OC2 A;  3SS3 A;  1TDG A;  1JVJ A;  4KZ9 A;  1O7E A;  4MEZ A;  1KGG A;  4EUZ A;  1FR6 A;  2H0Y A;  2EXA A;  4OOL A;  1IEM A;  4DDS A;  4DXC A;  1K56 A;  3TOI A;  1K6R A;  2ZC7 A;  4WMC A;  1YLP A;  5FAT A;  2DCF A;  3QNB A;  4XUX A;  1IYS A;  2GDN A;  1SKF A;  3IH9 A;  1YLZ A;  5HAQ A;  2H0T A;  3MKF A;  1PZP A;  3HUM A;  5EOE A;  4K91 A;  1KDW A;  1BSG A;  4PPR A;  2XQZ A;  4O7D A;  2PBY A;  3A3I A;  3BLS A;  5FQM A;  3BFC A;  5JYP A;  5TGF A;  2JC7 A;  2H5S A;  1MWT A;  4S2P A;  1PIO A;  1YLJ A; 
#chains in the Genus database with same CATH topology
 3DTM A;  1GSW A;  3RFB A;  3A0V A;  4CLC C;  2ZMF A;  3DBA A;  4YWZ A;  2PR6 A;  1N9B A;  4HNB A;  3JPU A;  3A3J A;  3MMH A;  4HES A;  3MZE A;  3ZFZ A;  1TS8 A;  3PAG A;  2XR0 A;  4BBT A;  2J9P A;  3FWL A;  1OTD A;  4ID4 A;  4R3J A;  1F98 A;  5HWW A;  5CTN A;  3DW0 A;  3VOZ A;  3BQ8 A;  4LFU A;  5FQ9 A;  3TRC A;  4IUK A;  1IYO A;  1NLY A;  1W79 A;  1XX2 A;  1ERM A;  2VV8 A;  4KQQ A;  1FCM A;  3T4O A;  2HP9 A;  2WKH A;  3ZDJ A;  1SHV A;  3NJA A;  4DJ2 A;  3LI8 A;  4S2M A;  3CJM A;  4OLG A;  2FH5 A;  3C2W A;  3T1Q B;  2R9W A;  3VP4 A;  4JGO A;  3BLM A;  4LLO B;  5DKL A;  4BBV A;  2OWH A;  2HP6 A;  4JKT A;  3A3E A;  5HL6 A;  3V3S A;  4OP5 A;  5M18 A;  3UB7 A;  1T1A A;  2QPN A;  4I3I A;  3NOT C;  5CGX A;  1LL8 A;  4FCF A;  1IOU A;  4EW7 A;  3ZNY A;  3QP2 A;  5HDC A;  1P0Z A;  1M6K A;  3LIC A;  3MKE A;  3S4X A;  3T4J A;  4GOG A;  2H10 A;  4OQH A;  3HLW A;  2H28 A;  3WS5 A;  3T1R A;  1FQG A;  4D2O A;  3N6I A;  5HDS A;  2R78 A;  4ESP A;  1KE0 A;  3BY8 A;  1LSV A;  3ZG9 B;  3NCK A;  2Z2L B;  1DJB A;  1E3U D;  3B47 A;  1FCN A;  5AVF A;  5KZH A;  1JTG A;  4JGP A;  4QY6 A;  3UE6 A;  3SOI A;  4ZJ3 A;  2V0U A;  4OVD A;  4S2J A;  3TW8 A;  4JGR A;  3FPW A;  4HEF A;  2VV6 A;  3HUO A;  2ZMV A;  3EGD C;  1P9W A;  2QJ7 A;  5DF8 A;  5EVI D;  4EES A;  1K54 A;  2IWD A;  3IHB A;  3M6B A;  4IBX A;  2PD8 A;  5FI6 A;  1PW8 A;  3UDX A;  2FZ0 A;  3P98 A;  4ZAM A;  2Y8H A;  4WLA A;  4BWI A;  3LY4 A;  3MXR A;  3CPT B;  2V8C A;  4I5S A;  3O87 A;  4UHU A;  2WK0 A;  5HWV A;  3IXD A;  3PBQ A;  5CEB A;  4JXV A;  3P09 A;  4I38 A;  1T19 A;  3A3D A;  2KOI A;  1Y4O A;  2HGV A;  5AQA A;  4Q0J A;  3LIF A;  3G31 A;  2W1T A;  4S2O A;  5KSH A;  3C30 A;  2OSU A;  3T4L A;  1ES3 A;  5FI2 A;  3V3R A;  4E3L A;  4HP4 A;  4ZJ1 A;  5L2F A;  2PYP A;  5DJU A;  3F1P A;  4OPR A;  1ZHH B;  1S1Y A;  4OPZ A;  1YMS A;  3PBO A;  1ZG6 A;  1ACF A;  2B18 A;  2Q0O A;  4E6X A;  2WKP A;  5I5L A;  1RGY A;  4WYY A;  2Y2G A;  4HIA A;  3KYZ A;  1FSW A;  2ZC5 B;  4EQI A;  4HBT A;  2DMW A;  2ZL1 B;  2UV0 E;  2XK1 A;  2Y2P A;  4BL2 A;  5GHY A;  4ZDX A;  3IWQ A;  2M1C A;  3IS2 A;  4HJ3 A;  2JKT I;  2FFY A;  2O99 A;  4U3T A;  4WEL A;  3G34 A;  4HBU A;  5TBM A;  4EEP A;  4BMW A;  1LSX A;  3L9K A;  4EXO A;  2HDU A;  3GEC A;  2WKQ A;  4EBN A;  4GDN A;  3JVV A;  1MPL A;  4IHQ A;  4KG6 A;  4O0P A;  3HVF A;  3C5A A;  4WUJ A;  1YAX A;  2J9O A;  2WKR A;  3PXP A;  5HX9 A;  3SH8 A;  4C6Y A;  1I2W A;  4P6Z S;  3CHW P;  4GS9 B;  1IKG A;  1H8Y A;  1SCW A;  1U60 A;  3PAE A;  3U4L P;  1YT4 A;  3UB5 P;  4EER A;  5DVA A;  5F83 A;  3DTE A;  1XJ4 A;  3WRT A;  3VP3 A;  2JKT M;  5CX7 A;  5CED A;  5A91 A;  5L07 A;  3WRZ A;  3MQ0 A;  2ZM0 A;  4E3N A;  4GLQ A;  3HLD A;  2ZQ8 A;  2EX6 A;  2J7V A;  3MJQ A;  4JGQ A;  1AXB A;  3MZF A;  4E04 A;  4N1H A;  2J80 A;  1Q2P A;  3VP1 A;  3VFH A;  2X71 A;  4QJG A;  1S4S A;  2Y2L A;  5HL1 A;  2OLV A;  2WGW A;  4B4X A;  3PBN A;  5FA7 A;  3ZVT A;  3QP1 A;  5KSC A;  1QME A;  2QYB A;  1ES4 A;  4I3A A;  1VET B;  4PM9 A;  4YNR A;  2OWJ A;  4QD4 A;  2WZZ A;  3F1N B;  3G4P A;  4GDB A;  5CXW A;  1OTB A;  5EM1 A;  1OTA A;  3FPV A;  2QWS A;  3K2N A;  1XA7 A;  4Y0O A;  1L3L A;  1DRM A;  1TS7 A;  5GLB A;  1MC0 A;  2JN7 A;  3K3C A;  3OPL A;  3MR0 A;  4EU0 A;  2IWC A;  4X1L A;  3E98 A;  4DDY A;  5CHJ A;  4XUZ A;  5HFO A;  4H6J B;  3C8C A;  1CI9 A;  1OJ5 A;  3UB8 A;  4NXB A;  2JE5 A;  1UWN X;  3UN7 A;  3EWK A;  4LCM A;  5AVE A;  4PM6 A;  1Q2Q A;  2EWV A;  4Y13 A;  2VX8 A;  3OC2 A;  4NG2 A;  1TDG A;  4X1M A;  4KZ9 A;  1O7E A;  4MEZ A;  1KGG A;  2H0Y A;  2EXA A;  1IEM A;  3BJN A;  4DXC A;  3CPT A;  1K6R A;  4CLC D;  4XUX A;  1IYS A;  1S1Z A;  1SKF A;  3IH9 A;  3O5Y A;  3HUM A;  5EOE A;  4K91 A;  1BSG A;  3OLO A;  4O7D A;  2PBY A;  5EM0 A;  5F6A A;  5JYP A;  2JC7 A;  1MWT A;  2WKI A;  1DJC A;  5HPF A;  2P04 A;  2M7V A;  5DFX A;  4Y15 A;  1K4E A;  4JXS A;  4IBR A;  1RCJ A;  4R38 A;  2VKS A;  4S2N A;  5AJG A;  1F5M A;  3MXQ A;  3LCE A;  5EVI B;  1GCE A;  1YKD A;  4ZBE A;  2I9V A;  3ITB A;  1GHI A;  4MBH A;  3UB9 A;  5M1A A;  4YFM A;  3UMD A;  5F1G A;  3QNC A;  1O07 A;  3BW6 A;  4UQI S;  1G6O A;  1Z09 A;  1TDL A;  2ZC4 B;  5A93 A;  1YM1 A;  2ZL1 A;  1E4D A;  3N7W A;  2XFS A;  1ERO A;  4E3J A;  3T4S A;  4X69 A;  2KX6 A;  1HLU P;  4WEJ A;  5TJJ A;  3N8S A;  2JHE A;  3DTK A;  4PM5 A;  5IHV A;  1NJ4 A;  4PMA A;  3N4I A;  4GD6 A;  1K6S A;  3BFG A;  3Q7Z A;  5E2H A;  2BAS A;  3N8R A;  2ZC3 B;  5AQB A;  4OON A;  1L0E A;  1K38 A;  4CLC E;  4DE0 A;  3W4Q A;  2ZQ9 A;  4Q8I A;  3IXG A;  3LY3 A;  3C7V A;  4S2I A;  3LIA A;  4ARZ A;  4GN2 A;  4GS9 A;  4WBG A;  2YKH A;  1K55 A;  2PU4 A;  1DP8 A;  1P97 A;  2G2W A;  1UWP X;  2IA2 A;  5F82 A;  3MFX A;  4LRX C;  4B93 A;  5J7E A;  2XD5 A;  3TE8 A;  2DNS A;  4WM9 A;  3D9Y A;  3CIT A;  2Q9N A;  3HCY A;  3VOY A;  3KO6 A;  3T1S A;  4HP9 A;  5IS1 A;  1NYM A;  3VSL A;  1NYY A;  3RTY A;  3CZD A;  3KX0 X;  1T1C A;  4OQI A;  1BT5 A;  3ITA A;  3UE1 A;  1KGF A;  1H8M A;  3KYE A;  1YLW A;  1YMX A;  1CK3 A;  1PWC A;  1SDN A;  5EV0 A;  3ZYT A;  3K3D A;  3UPP A;  5I94 A;  1FIK A;  1MKI A;  1MWS A;  2INW A;  5KIZ A;  3V67 A;  1BLP A;  4BEN A;  3V39 A;  3IH8 A;  1BUL A;  2ZOI A;  3DWZ A;  1ONH A;  4HJ6 A;  2W3F A;  4RYE A;  2HDS A;  4G3V A;  3Q7V A;  1K4F A;  4AFI A;  4KZ8 A;  2XD1 A;  3BFD A;  2EWW A;  4N9L A;  3T4K A;  3BQA A;  3HLC A;  1K0K A;  2PAV P;  3OOV A;  5CHU A;  3P7N A;  1W5D A;  4EV4 A;  4KZ4 A;  4LV3 A;  3HJI A;  4ZJ2 A;  5EE8 A;  4NK3 A;  3FKW A;  5EUA A;  3PYP A;  4WMC D;  5FL3 A;  2L4R A;  4II7 A;  2LB9 A;  3NBL A;  3C38 A;  5J8X A;  5C5K A;  1HD8 A;  2XRN A;  3IXH A;  1VEU B;  2XF3 A;  3QP6 A;  1MKM A;  1TS6 A;  2V1Z A;  4FH2 A;  3Q07 A;  3GMW A;  3KSH A;  2KLI A;  2V8F A;  4R3B A;  3MF0 A;  3KYQ A;  3R7W A;  4MN6 A;  2A3U A;  2QZ6 A;  3IF6 A;  3IQA A;  1OTI A;  4LV1 A;  4Z1W A;  4X68 A;  1G28 A;  2BG1 A;  1ESU A;  3OCL A;  4R1G A;  4HQA A;  1Y54 A;  1H3Q A;  4P6B A;  2W3H A;  4DJ3 A;  4R0Q A;  4D60 A;  4HJ4 A;  5DF9 A;  4S2N C;  1W7F A;  3SH9 A;  4ME4 A;  3UPN A;  2Y79 A;  2G2U A;  4GNU A;  4DMZ A;  2A24 B;  2PRF A;  4CLC B;  2HPB A;  3RXW A;  3E0Y A;  2Y59 A;  5CTM A;  2YKF A;  5FQI A;  1ESI A;  2OAQ 1;  5GL9 A;  3UME A;  4WEK A;  4IVI A;  1G6A A;  3VSK A;  4F3L B;  4Y5F A;  2P74 A;  2P9V A;  3BFE A;  4P85 A;  2VLG A;  2HV1 A;  3EQV A;  3H82 B;  1S0W A;  2GJ3 A;  4QU3 A;  1TF1 A;  4L9E A;  4GB7 A;  3BEC A;  4P87 A;  4NXF A;  3EEH A;  3MXS A;  1NWZ A;  1NZU A;  1N9L A;  3HLF A;  4MN7 A;  1MWR A;  3U2A A;  4KUK A;  1D1J A;  5E2G A;  5AQ9 A;  5HDD A;  1H0M A;  2B5R A;  3NOU C;  4F94 A;  3FKV A;  2E8I A;  4H8R A;  1KGE A;  5EFW A;  4C75 A;  3CLO A;  5HPI A;  1FCO A;  2EFU A;  5EEC A;  4Y0U A;  2V1A A;  2Z2M B;  3WWX A;  1J3W A;  3SS5 A;  3LEQ A;  3S7P A;  3ZG5 A;  2Y2J A;  2RCX A;  2DRW A;  4QPR A;  3MQO A;  2VGK A;  3HBR A;  3G2Y A;  2XDM A;  4KZB A;  4KQD A;  2AVX A;  1ZG4 A;  1PI4 A;  1SDE A;  3V50 A;  1L0G A;  1LL9 A;  1L0F A;  3FV7 A;  4PM7 A;  2O9B A;  3NC8 A;  5KMW A;  3NUL A;  2K31 A;  4N1X A;  1BUE A;  3ISG A;  1FOF A;  2W0N A;  4OKP A;  5TR7 A;  2JKR I;  4P0M A;  1N9O A;  2CC1 A;  3BRM A;  5HAP A;  2OLU A;  4HH2 A;  3LO7 A;  2D01 A;  2VZW A;  4IJG A;  3SS3 A;  4EUZ A;  3FC7 A;  1K56 A;  1SKO B;  4NKP A;  1S67 L;  1YLP A;  5FAT A;  2DCF A;  4MCW A;  4PPR A;  3D72 A;  4EEU A;  5K5B A;  2XQZ A;  3A3I A;  3BLS A;  5FQM A;  3BFC A;  4ZRR A;  1BYW A;  2ZQD A;  1W8Q A;  4X6T A;  1ES2 A;  3ZCZ A;  1XJ6 A;  2Z6C A;  2J3T D;  3M2J A;  3UE0 A;  1MY8 A;  4IVK A;  4OPY A;  3WS4 A;  4Y0T A;  3H7W B;  4BQM A;  1GSV A;  1VB6 A;  2WAE A;  2GX5 A;  1A0K A;  5EVL A;  3IX3 A;  4QWO A;  4S2L A;  3ZG0 A;  4U0X A;  3BWL A;  4KQO A;  3RXX A;  4RQ9 A;  1EWZ A;  2ZQ7 A;  3T4Q A;  3MSH A;  4KQR A;  3O88 A;  3VV4 A;  4NXG A;  3S7Q A;  3WS1 A;  2EXB A;  3PR6 A;  3QP5 A;  4M3K A;  3LGO A;  3IF6 C;  2EX2 A;  3IWI A;  4MMN A;  4Q0H A;  3ZGA B;  4L9G A;  1V9Z A;  1YSQ A;  4MDZ A;  2I72 A;  2XGN A;  3LR0 A;  3SW1 A;  3GR2 A;  5FEF A;  2W27 A;  1L0D A;  2HJ9 C;  4GHI B;  2Y55 A;  4R4S A;  4QY5 A;  1K56 D;  1PYY A;  4KZ7 A;  5GHZ A;  1FR1 A;  3VE4 A;  2LB5 A;  4F3L A;  4WZ4 A;  1VQQ A;  3MFD A;  4HH3 A;  4JBF A;  2O0Y A;  3L7H A;  5LBR A;  3H82 A;  1XP4 A;  3RH8 B;  1MBL A;  1ALQ A;  5D3O A;  3BEB A;  3G35 A;  2Y2N A;  1IEL A;  3AGD A;  4IED A;  1OTE A;  4DF6 A;  2Y4A A;  5HWT A;  2O9C A;  3PBS A;  3QHY A;  1M40 A;  1MXO A;  3DTI A;  4NXE A;  4MN5 A;  2EFX A;  5DTS A;  1YQS A;  3CMZ A;  3NHQ A;  4JF4 A;  1K54 C;  5L09 A;  2R9X A;  2V1B A;  3VFF A;  3GTC A;  3O3V A;  1UGU A;  3DWK A;  2KDK A;  1E25 A;  4FSF A;  1PI5 A;  1G68 A;  4UA9 A;  3Q81 A;  2VGL M;  2ZQC A;  2QHK A;  1TD5 A;  1YPR A;  4G3W A;  4N92 A;  1NY0 A;  5A8B A;  3Q82 A;  3B42 A;  5G18 A;  5CRF A;  4LPZ A;  2ZC6 B;  4QHC A;  4WZ5 A;  2XA7 S;  3ZVW A;  4FUW A;  2ZJ9 A;  3IHA A;  4BL3 A;  2Y2I A;  3PBT A;  3CUE A;  1ZKJ A;  3S7O A;  2ZMA A;  2WAF A;  2X01 A;  3T1X A;  1HTZ A;  2J3T C;  3PTE A;  5IU1 A;  3S7N A;  4JLF A;  4YIN A;  2A2L A;  2E8J A;  2Q9M A;  3I7J A;  3D3O A;  1XGI A;  2WUQ A;  4KG2 A;  1ZC2 A;  4HY8 A;  1BLS A;  3HLG A;  2A49 A;  5FAO A;  2BTF P;  2L1M A;  4O01 A;  4RX2 A;  1BLH A;  2ZD8 A;  1F9I A;  2V20 A;  2XFT A;  4I39 A;  4EWF A;  3C4P A;  1SKO A;  1DJA A;  4LGW A;  4EBP A;  4K0X A;  3S22 A;  1I2S A;  4OOY A;  1PW1 A;  5CER A;  3CAX A;  3B33 A;  2VEA A;  4R4R A;  3E4P A;  4A5R A;  4LV2 A;  3ULF A;  2V2F F;  2D02 A;  3FG8 A;  1NRF A;  1ONG A;  4R23 A;  1NXY A;  2XRO A;  1EI5 A;  5HD3 A;  4Y3I A;  4EBL A;  1W8Y A;  1CEG A;  1TEM A;  2WAD A;  1ODV A;  1CF0 A;  4BJP A;  1J9M A;  4X25 A;  3MS6 A;  1JWZ A;  3R4K A;  1T18 A;  3G6O A;  5U47 A;  3DAV A;  4KZA A;  1D7E A;  5GLC A;  2W3E A;  3G32 A;  4MBK A;  5GLA A;  3LEZ A;  1XJ2 A;  4BD1 A;  3A0R A;  4OH0 A;  3SZT A;  1VET A;  1NLZ A;  5JYO A;  4WN5 A;  1OT6 A;  1ZTU A;  3NDE A;  3NY4 A;  2W1T B;  2XSS A;  3HJK A;  4LRY C;  3F1O B;  3F1N A;  4NEE D;  3NEC A;  2J3W A;  5FAS A;  1SZV A;  1YSP A;  2W3D A;  4GJ4 A;  2ZLY A;  3VMA A;  1PNE A;  3RJU A;  4DN0 A;  5DF7 A;  4N9K A;  2PD7 A;  4RVA A;  1G5U A;  3LUQ A;  3D4F A;  1XKZ A;  4DE3 A;  3VP0 A;  2VA0 A;  5A90 A;  1EW0 A;  4BLM A;  1WYC A;  5CGS A;  2JCH A;  2ZM8 A;  3PHY A;  4FH4 A;  3NOP C;  4GKU A;  3QP4 A;  4H6J A;  2OOL A;  3G2Z A;  3UNW A;  3UE3 A;  1IYP A;  4DXB A;  4BBU A;  1XJ3 A;  5FSR A;  3IS2 B;  4CJN A;  3W4P A;  5TBM B;  2O9A A;  2HDR A;  4GW9 A;  5M19 A;  3JYI A;  3ZQ5 A;  3E2K A;  2Y2M A;  2UWX A;  2JBF A;  2PT7 A;  1IKI A;  3G30 A;  1E3U A;  3W4O A;  2HZ5 A;  1BZA A;  3HL9 A;  1LSW A;  3NI9 A;  2ZOH A;  4C3Q A;  2PR5 A;  1XPB A;  3ICY A;  3IT9 A;  4PHT A;  4U0T A;  1XFN A;  1PZO A;  3UPO A;  4I3J A;  4FOF A;  5FAP A;  4PM8 A;  5DTT A;  5FQJ A;  4OP8 A;  1S6R A;  2ACG A;  1JNU A;  5EVI A;  3TG9 A;  5FDS A;  2JKG A;  1Y28 A;  3CG5 A;  3ZG8 B;  4JF5 A;  4GD8 A;  4E6W A;  4G3K A;  3UDF A;  4FD8 A;  2C5W B;  2IWB A;  4E3M A;  5HZH A;  3UDI A;  1JWV A;  4WZ5 C;  3LID A;  2Y2K A;  3LR4 A;  3V5M A;  3OPP A;  1BLC A;  4K08 A;  2V0W A;  3TSG A;  2WGW B;  3T12 B;  3CUE C;  4UAA A;  1X0O A;  4B9O A;  4PKY A;  3KSI A;  1FR6 A;  2ZBB A;  4OOL A;  4DDS A;  3TOI A;  2ZC7 A;  1OPX A;  3QNB A;  5HAQ A;  2H0T A;  1PFL A;  1PZP A;  1KDW A;  1T1B A;  5TGF A;  1PIO A;  1W63 M;  5J4E A;  1LT0 A;  2RL3 A;  1KVM A;  2OAP 1;  3GQZ A;  1RGZ A;  3GV9 A;  3IX4 A;  4UA6 A;  2B02 A;  4WL9 A;  1XFQ A;  3IF5 A;  3LI9 A;  2HJE A;  3OPH A;  3W2Z A;  4MBF A;  4JPM A;  2M7U A;  5BOH A;  2QKP A;  5FAQ A;  3H9W A;  4R70 A;  4GCZ A;  4OOM A;  1JWP A;  1CQA A;  1K55 C;  5FDH A;  5E43 A;  4XXR A;  2WZX A;  2HF6 A;  3EGX C;  1KOU A;  3LR5 A;  4OPQ A;  1S4R A;  2J8Y A;  1ES5 A;  4X53 A;  4RA7 A;  5EVE A;  2Y2Q A;  1STZ A;  4B4Z A;  5AQ7 A;  3F1O A;  3T4T A;  1WA9 A;  2Y91 A;  5GLD A;  4JXW A;  1D06 A;  1GA9 A;  2K7S A;  3GDI A;  2JKF A;  4EQ1 A;  4LEN A;  5HSQ A;  1PWG A;  1OME A;  2EX9 A;  5J3W A;  2PBD P;  4X55 A;  2L0W A;  3EEA A;  4PKY G;  1GHM A;  4P6Z M;  4DE1 A;  1K57 A;  3IX8 A;  3UY6 A;  4X56 A;  2MJ6 A;  1XGJ A;  3TJZ C;  3W8K A;  5CHM A;  3OCN A;  1N4O A;  4PAU A;  2PU2 A;  5DKK A;  1DP9 A;  4ETZ A;  5FQQ A;  1L2S A;  1MWU A;  1H5X A;  2PHY A;  1F2K A;  1GHP A;  2CMN A;  4K0W A;  1XXM A;  3NDG A;  1PRQ A;  1GSX A;  2VV7 A;  3O86 A;  5F69 A;  5CEC A;  3BY9 A;  1LHY A;  2X02 A;  2JKR M;  4DKI A;  3KSF A;  1VEU A;  3HUN A;  2EX8 A;  4L0L A;  2VJW A;  4IUH A;  4ARZ B;  5DFY A;  1V9Y A;  2QJ5 A;  3MQQ A;  3OBF A;  1RP5 A;  1VM1 A;  1C3B A;  4DRT A;  4Z9Q A;  4CQH A;  3M2K A;  5CGW A;  1LL5 A;  3HLB A;  3A3F A;  3VE3 A;  1HZO A;  3MZD A;  4QB8 A;  1P9R A;  1Z6F A;  4MNR A;  3UB6 A;  3E4Q A;  3OPR A;  1KE4 A;  1KVL A;  4E3O A;  3NIA A;  5EPH A;  1TVF A;  3AGF A;  3KSG A;  5EVI C;  1IYQ A;  2Y2O A;  1FIL A;  4LRZ E;  4XT2 B;  3N8L A;  1H8Z A;  2A24 A;  4Q0I A;  4R6L A;  2WGV A;  4CLC A;  2W3G A;  2VGJ A;  3IXB A;  1N9N A;  3LYX A;  2C6W B;  4OQG A;  2B95 A;  4OLD A;  3A0S A;  4HOI A;  2WYX A;  4EET B;  3FYZ A;  3JVU A;  1JTD A;  1LLB A;  2QMI A;  3BM6 A;  2FFF B;  4KUO A;  2WKE A;  1HVB A;  5L10 A;  2K2N A;  5MC7 A;  1DY6 A;  4L9F A;  3HLE A;  3HRE A;  5EOO A;  3GRJ A;  5A92 A;  1BTL A;  1CEF A;  3BFF A;  3Q7V B;  2PYR A;  3C7U A;  1LI0 A;  4JXG A;  4Y17 A;  3WS0 A;  5G4Y A;  3ZHH A;  3E4O A;  4Y7P A;  4O8G A;  3VOL A;  3IBJ A;  1QMF A;  2OV5 A;  4HI4 A;  5E2E A;  2VK3 A;  2XA7 M;  2XLN A;  3BYD A;  5HAI A;  3T50 A;  3P01 A;  4UA7 A;  1K25 A;  2ZQA A;  4GZB A;  4UQI M;  2GNX A;  4ZTK A;  4FTX A;  5F1F A;  3MBZ A;  4RX3 A;  3IWO A;  3UO9 A;  4KZ5 A;  4E3I A;  1ERQ A;  1XA1 A;  3SS4 A;  2Y2H A;  2HDQ A;  2XH9 A;  4MLL A;  3EQU A;  1WYB A;  4LV0 A;  4B88 A;  2G7U A;  1LI9 A;  4E3K A;  1NZO A;  4JF6 A;  5HD5 A;  5TFQ A;  3R7W B;  3ZNT A;  3IF6 B;  3EOI A;  5F68 A;  4S2K A;  1KE3 A;  5FEG A;  1AWI A;  5DTK A;  1S66 L;  3LR3 A;  2PDR A;  1YLY A;  1CJF A;  3AGE A;  1OJG A;  5E2F A;  3B3X A;  3QP8 A;  4YOF A;  1GA0 A;  2VGL S;  1CI8 A;  4DE2 A;  3CWF A;  3GVB A;  5FQK A;  2P7J A;  4WF0 A;  3Q1F A;  1I5Q A;  4M4X A;  4LCL A;  3FZC A;  3CI6 A;  1K57 C;  5F5Y A;  2EA9 A;  1IFQ A;  2GZA A;  2P9V B;  2Z6D A;  4KEN B;  4BD0 A;  2WGI A;  3C4O A;  4R3A A;  2XEP A;  5L8M A;  1KDS A;  1MZU A;  1WE4 A;  4NET A;  3SH7 A;  2BLS A;  5HAR A;  2NUP C;  4CPK A;  3ZG7 B;  4KZ6 A;  4ETX A;  3WS2 A;  5FI7 A;  3M6H A;  1DP6 A;  3H7W A;  5HW3 A;  5GHX A;  4KZ3 A;  1YLT A;  2V9A A;  4OQ0 A;  1W63 Q;  2ZM2 A;  3PBR A;  3E2L A;  1NRJ A;  3LFV A;  4Y2F A;  5G4Z A;  3VP2 A;  3GSG A;  3OZH A;  4KG5 A;  2W1R A;  1PWD A;  3IBR A;  3S1Y A;  2HP5 A;  1VHM A;  2P08 A;  1FSY A;  1JVJ A;  5DJT A;  4UEY A;  4EUV A;  2NUT C;  4HHD A;  4WMC A;  1TS0 A;  3LIB A;  2GDN A;  4XT2 A;  1YLZ A;  1OT9 A;  4GHI A;  3MKF A;  3LIE A;  3F1P B;  5IT5 A;  2H5S A;  4S2P A;  1YLJ A; 
#chains in the Genus database with same CATH homology
 2RL3 A;  2WKI A;  2ZQD A;  1DJC A;  1W8Q A;  4X6T A;  3DTM A;  1ES2 A;  3ZCZ A;  1KVM A;  1K4E A;  4JXS A;  4IBR A;  3GQZ A;  1RCJ A;  1RGZ A;  3M2J A;  3UE0 A;  1N9B A;  1MY8 A;  4IVK A;  4OPY A;  4S2N A;  3WS4 A;  3GV9 A;  4UA6 A;  3LCE A;  4Y0T A;  5EVI B;  1GCE A;  4ZBE A;  4BQM A;  3IF5 A;  3OPH A;  3A3J A;  2WAE A;  3ITB A;  4MBF A;  4JPM A;  5BOH A;  1GHI A;  4MBH A;  5EVL A;  4HES A;  3MZE A;  5FAQ A;  5M1A A;  4YFM A;  4S2L A;  3ZG0 A;  3ZFZ A;  4U0X A;  5F1G A;  3PAG A;  3QNC A;  1O07 A;  2XR0 A;  4KQO A;  3RXX A;  2J9P A;  3FWL A;  1EWZ A;  4OOM A;  2ZQ7 A;  4ID4 A;  4KQR A;  3O88 A;  4R3J A;  1JWP A;  1TDL A;  5CTN A;  3DW0 A;  3WS1 A;  2ZC4 B;  2EXB A;  3VOZ A;  4M3K A;  1K55 C;  1YM1 A;  5FDH A;  5A93 A;  5FQ9 A;  1E4D A;  3N7W A;  3IF6 C;  5E43 A;  2XFS A;  2EX2 A;  4XXR A;  1ERO A;  3IWI A;  4E3J A;  2WZX A;  3ZGA B;  1IYO A;  4X69 A;  1W79 A;  1XX2 A;  1ERM A;  2I72 A;  2XGN A;  4WEJ A;  4OPQ A;  4KQQ A;  3N8S A;  3GR2 A;  1FCM A;  1L0D A;  2J8Y A;  4PM5 A;  2HP9 A;  1ES5 A;  2WKH A;  2Y55 A;  4R4S A;  4X53 A;  4QY5 A;  5IHV A;  1NJ4 A;  1K56 D;  1PYY A;  4PMA A;  3ZDJ A;  4KZ7 A;  3N4I A;  4GD6 A;  4RA7 A;  1SHV A;  5GHZ A;  1K6S A;  3BFG A;  3Q7Z A;  4S2M A;  1FR1 A;  3CJM A;  2Y2Q A;  5E2H A;  4OLG A;  2R9W A;  3N8R A;  2ZC3 B;  3VP4 A;  5AQB A;  4B4Z A;  4OON A;  3BLM A;  5AQ7 A;  4WZ4 A;  1L0E A;  1K38 A;  1VQQ A;  2Y91 A;  3MFD A;  3W4Q A;  4DE0 A;  2ZQ9 A;  2HP6 A;  4JKT A;  3IXG A;  3LY3 A;  4Q8I A;  3C7V A;  5GLD A;  4JXW A;  4S2I A;  3A3E A;  4JBF A;  1GA9 A;  3V3S A;  4OP5 A;  5M18 A;  1XP4 A;  1MBL A;  4GN2 A;  1ALQ A;  2QPN A;  5D3O A;  4LEN A;  3BEB A;  3G35 A;  5CGX A;  1PWG A;  1OME A;  4WBG A;  2EX9 A;  4FCF A;  2Y2N A;  1K55 A;  4X55 A;  1IEL A;  3ZNY A;  3AGD A;  4IED A;  4DF6 A;  2PU4 A;  1M6K A;  2Y4A A;  3MKE A;  2G2W A;  1GHM A;  3PBS A;  5F82 A;  4DE1 A;  3S4X A;  3QHY A;  1M40 A;  1MXO A;  1K57 A;  4GOG A;  3UY6 A;  2XD5 A;  2H10 A;  2EFX A;  2DNS A;  4OQH A;  4WM9 A;  5DTS A;  3HLW A;  1YQS A;  3CMZ A;  4X56 A;  3WS5 A;  1XGJ A;  4JF4 A;  1K54 C;  2Q9N A;  2R9X A;  1FQG A;  3W8K A;  5CHM A;  3OCN A;  3N6I A;  1N4O A;  3VOY A;  4D2O A;  3VFF A;  3GTC A;  3O3V A;  2PU2 A;  1KE0 A;  1NYM A;  3VSL A;  1NYY A;  5FQQ A;  3CZD A;  1L2S A;  1MWU A;  1H5X A;  3ZG9 B;  3NCK A;  3DWK A;  1GHP A;  4OQI A;  1E25 A;  1BT5 A;  3ITA A;  4FSF A;  2Z2L B;  3UE1 A;  1KGF A;  1PI5 A;  1G68 A;  1DJB A;  1YLW A;  1YMX A;  1CK3 A;  4UA9 A;  1PWC A;  4K0W A;  3Q81 A;  1XXM A;  1SDN A;  3NDG A;  2ZQC A;  1E3U D;  4N92 A;  3UPP A;  5I94 A;  1FCN A;  1MKI A;  1NY0 A;  3O86 A;  5CEC A;  1MWS A;  1LHY A;  2X02 A;  5KZH A;  4DKI A;  3Q82 A;  1JTG A;  3HUN A;  5G18 A;  5CRF A;  1BLP A;  4QY6 A;  4BEN A;  2EX8 A;  2ZC6 B;  4L0L A;  4QHC A;  3V39 A;  3SOI A;  3IH8 A;  4ZJ3 A;  1BUL A;  4WZ5 A;  3DWZ A;  4OVD A;  1RP5 A;  4S2J A;  3ZVW A;  1ONH A;  1C3B A;  1VM1 A;  4DRT A;  2ZJ9 A;  3IHA A;  4HEF A;  4Z9Q A;  4BL3 A;  3M2K A;  5CGW A;  2Y2I A;  3HUO A;  4RYE A;  1LL5 A;  3HLB A;  3A3F A;  3PBT A;  1HZO A;  3MZD A;  4QB8 A;  2HDS A;  5DF8 A;  1ZKJ A;  2ZMA A;  5EVI D;  2WAF A;  2X01 A;  1K54 A;  2IWD A;  3IHB A;  3M6B A;  1HTZ A;  3PTE A;  3Q7V A;  4IBX A;  1Z6F A;  1K4F A;  4JLF A;  4KZ8 A;  4MNR A;  2XD1 A;  5FI6 A;  1PW8 A;  3UDX A;  3BFD A;  3P98 A;  4N9L A;  4YIN A;  3OPR A;  3HLC A;  4ZAM A;  2Q9M A;  1KE4 A;  1KVL A;  3I7J A;  4E3O A;  5CHU A;  3NIA A;  5EPH A;  1W5D A;  1TVF A;  3AGF A;  4EV4 A;  1XGI A;  2WUQ A;  3LY4 A;  3MXR A;  1ZC2 A;  4KG2 A;  4KZ4 A;  4LV3 A;  5EVI C;  1BLS A;  3HLG A;  3O87 A;  4UHU A;  1IYQ A;  2A49 A;  2WK0 A;  2Y2O A;  5FAO A;  3IXD A;  3PBQ A;  4RX2 A;  4ZJ2 A;  4JXV A;  5CEB A;  5EE8 A;  4NK3 A;  3P09 A;  3FKW A;  1BLH A;  3A3D A;  3N8L A;  1H8Z A;  5EUA A;  2WGV A;  2ZD8 A;  2VGJ A;  2V20 A;  3IXB A;  5AQA A;  2C6W B;  2XFT A;  4WMC D;  4OQG A;  4OLD A;  4EWF A;  3G31 A;  3C4P A;  3NBL A;  5J8X A;  1DJA A;  4S2O A;  4EBP A;  5KSH A;  2OSU A;  1ES3 A;  2WYX A;  5FI2 A;  3V3R A;  4E3L A;  1HD8 A;  4K0X A;  3S22 A;  1I2S A;  3FYZ A;  3IXH A;  2XF3 A;  4OOY A;  4ZJ1 A;  5L2F A;  2V1Z A;  4FH2 A;  1PW1 A;  3Q07 A;  1JTD A;  1LLB A;  4R4R A;  2QMI A;  3BM6 A;  3GMW A;  5CER A;  4OPR A;  4A5R A;  2FFF B;  4OPZ A;  1YMS A;  3PBO A;  1ZG6 A;  4LV2 A;  2WKE A;  1HVB A;  4R3B A;  4E6X A;  2V2F F;  1RGY A;  1NRF A;  4WYY A;  1ONG A;  1DY6 A;  2A3U A;  2Y2G A;  4R23 A;  2QZ6 A;  3IF6 A;  3IQA A;  1NXY A;  4LV1 A;  1EI5 A;  1FSW A;  3HLE A;  3HRE A;  4EBL A;  5EOO A;  3GRJ A;  1W8Y A;  1CEG A;  2ZC5 B;  1BTL A;  1CEF A;  3BFF A;  3Q7V B;  4X68 A;  4EQI A;  5A92 A;  3C7U A;  4HBT A;  1TEM A;  2WAD A;  1LI0 A;  4JXG A;  3WS0 A;  2BG1 A;  3ZHH A;  4Y7P A;  1ESU A;  3OCL A;  4R1G A;  4BJP A;  1J9M A;  1JWZ A;  2XK1 A;  1Y54 A;  2Y2P A;  1QMF A;  4BL2 A;  4P6B A;  2OV5 A;  5GHY A;  4ZDX A;  4R0Q A;  5DF9 A;  4S2N C;  3IWQ A;  5E2E A;  1W7F A;  3SH9 A;  4U3T A;  2FFY A;  2XLN A;  5U47 A;  4WEL A;  4KZA A;  3BYD A;  5HAI A;  5GLC A;  3G34 A;  4HBU A;  3UPN A;  3G32 A;  4MBK A;  5GLA A;  3LEZ A;  4BD1 A;  2G2U A;  4GNU A;  4UA7 A;  2HPB A;  3RXW A;  1K25 A;  2HDU A;  4OH0 A;  2ZQA A;  4GZB A;  2Y59 A;  5CTM A;  5FQI A;  4EBN A;  5JYO A;  4ZTK A;  4GDN A;  1ESI A;  5GL9 A;  3NDE A;  3NY4 A;  4IVI A;  4WEK A;  5F1F A;  1G6A A;  1MPL A;  3MBZ A;  4KG6 A;  4RX3 A;  3IWO A;  3VSK A;  3UO9 A;  3HVF A;  2P74 A;  4KZ5 A;  2P9V A;  3C5A A;  1ERQ A;  4E3I A;  5FAS A;  3BFE A;  1XA1 A;  4P85 A;  2J9O A;  3SS4 A;  5HX9 A;  2Y2H A;  2HDQ A;  3EQV A;  2XH9 A;  4MLL A;  3SH8 A;  1S0W A;  4C6Y A;  2ZLY A;  1I2W A;  4QU3 A;  3VMA A;  3EQU A;  1WYB A;  4LV0 A;  1IKG A;  1H8Y A;  1SCW A;  4GB7 A;  3BEC A;  1U60 A;  3PAE A;  1LI9 A;  1YT4 A;  4P87 A;  3RJU A;  4B88 A;  5DF7 A;  4N9K A;  5DVA A;  5F83 A;  4RVA A;  4E3K A;  1NZO A;  3D4F A;  4JF6 A;  5TFQ A;  1XKZ A;  3MXS A;  3VP3 A;  3WRT A;  4DE3 A;  3VP0 A;  3ZNT A;  1NZU A;  3IF6 B;  5A90 A;  4S2K A;  4BLM A;  1KE3 A;  1WYC A;  3HLF A;  5CGS A;  2JCH A;  2ZM8 A;  4FH4 A;  5A91 A;  1MWR A;  3WRZ A;  5CED A;  4GKU A;  5DTK A;  2ZM0 A;  4E3N A;  5E2G A;  5AQ9 A;  3HLD A;  2ZQ8 A;  2EX6 A;  2J7V A;  3G2Z A;  2B5R A;  1YLY A;  3UNW A;  1AXB A;  3MZF A;  3UE3 A;  1IYP A;  4DXB A;  4N1H A;  1Q2P A;  3AGE A;  5E2F A;  5FSR A;  3VFH A;  3VP1 A;  2X71 A;  4F94 A;  3B3X A;  3FKV A;  2E8I A;  1GA0 A;  4QJG A;  1CI8 A;  4CJN A;  3GVB A;  4DE2 A;  3W4P A;  4H8R A;  2Y2L A;  1KGE A;  5HL1 A;  5FQK A;  2HDR A;  2OLV A;  2WGW A;  4B4X A;  5M19 A;  3PBN A;  4C75 A;  5FA7 A;  3JYI A;  3ZVT A;  3E2K A;  2Y2M A;  3Q1F A;  5KSC A;  1FCO A;  1QME A;  2UWX A;  2JBF A;  2EFU A;  1I5Q A;  1ES4 A;  4PM9 A;  5EEC A;  4LCL A;  3FZC A;  1IKI A;  1K57 C;  3G30 A;  4QD4 A;  4Y0U A;  2WZZ A;  1E3U A;  3W4O A;  3G4P A;  4GDB A;  2Z2M B;  1BZA A;  2P9V B;  3HL9 A;  3WWX A;  4KEN B;  5CXW A;  4BD0 A;  2WGI A;  3C4O A;  3NI9 A;  3SS5 A;  3ZG5 A;  2XEP A;  1KDS A;  2Y2J A;  2RCX A;  4C3Q A;  1WE4 A;  1XPB A;  2DRW A;  4NET A;  3SH7 A;  2BLS A;  2VGK A;  3HBR A;  5HAR A;  3IT9 A;  1XA7 A;  3G2Y A;  2XDM A;  4KZB A;  4U0T A;  4CPK A;  4Y0O A;  1PZO A;  3UPO A;  3ZG7 B;  4KZ6 A;  1ZG4 A;  1PI4 A;  3WS2 A;  1SDE A;  5GLB A;  3V50 A;  5FAP A;  4PM8 A;  3M6H A;  1LL9 A;  1L0F A;  3FV7 A;  5DTT A;  5FI7 A;  1L0G A;  5FQJ A;  4OP8 A;  4PM7 A;  1S6R A;  3OPL A;  5EVI A;  2IWC A;  3TG9 A;  3NC8 A;  5HW3 A;  5KMW A;  4N1X A;  5GHX A;  4DDY A;  4KZ3 A;  1BUE A;  1YLT A;  5CHJ A;  4XUZ A;  5HFO A;  4OQ0 A;  2ZM2 A;  3CG5 A;  3PBR A;  3ZG8 B;  1CI9 A;  3ISG A;  1FOF A;  4GD8 A;  3E2L A;  4JF5 A;  4E6W A;  4OKP A;  5TR7 A;  3VP2 A;  3UDF A;  3GSG A;  3OZH A;  2C5W B;  4FD8 A;  4KG5 A;  4P0M A;  2IWB A;  4E3M A;  3UDI A;  2CC1 A;  1PWD A;  1JWV A;  4WZ5 C;  2Y2K A;  2JE5 A;  3V5M A;  3OPP A;  3S1Y A;  2HP5 A;  1BLC A;  3UN7 A;  3BRM A;  5HAP A;  3TSG A;  2OLU A;  4LCM A;  2WGW B;  4PM6 A;  1Q2Q A;  3LO7 A;  4UAA A;  1FSY A;  3OC2 A;  3SS3 A;  1TDG A;  1JVJ A;  4KZ9 A;  1O7E A;  4MEZ A;  1KGG A;  4EUZ A;  1FR6 A;  2H0Y A;  2EXA A;  4OOL A;  1IEM A;  4DDS A;  4DXC A;  1K56 A;  3TOI A;  1K6R A;  2ZC7 A;  4WMC A;  1YLP A;  5FAT A;  2DCF A;  3QNB A;  4XUX A;  1IYS A;  2GDN A;  1SKF A;  3IH9 A;  1YLZ A;  5HAQ A;  2H0T A;  3MKF A;  1PZP A;  3HUM A;  5EOE A;  4K91 A;  1KDW A;  1BSG A;  4PPR A;  2XQZ A;  4O7D A;  2PBY A;  3A3I A;  3BLS A;  5FQM A;  3BFC A;  5JYP A;  5TGF A;  2JC7 A;  2H5S A;  1MWT A;  4S2P A;  1PIO A;  1YLJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...