5L2FA

High resolution structure of acinetobacter baumannii beta-lactamase oxa-51 i129l/k83d bound to doripenem
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
239
structure length
239
Chain Sequence
EKAEKIKNLFNEVHTTGVLVIQQGQTQQSYGNDLARASTEYVPASTFDMLNALIGLEHHKATTTEVFKWDGQKRLFPEWEKDMTLGDAMKASALPVYQDLARRIGLELMSKEVKRVGYGNADIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSPKVQDEVQSMLFIEEKNGNKIYAKSGWGWDVDPQVGWLTGWVVQPQGNIVAFSLNLEMKKGIPSSVRKEITYKSLEQLGIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/antibiotic
molecule keywords Beta-lactamase
publication title The structure of a doripenem-bound OXA-51 class D beta-lactamase variant with enhanced carbapenemase activity.
pubmed doi rcsb
source organism Acinetobacter baumannii
total genus 80
structure length 239
sequence length 239
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-08-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5l2fA00
3IH8A 3ZHHA 4LCMA 3A3DA 2PBYA 1W8QA 1MKIA 5FDHA 2HDUA 2X01A 3S22A 3TSGA 3ZVTA 4OQGA 5EVID 3PTEA 4JXGA 2XD1A 5GLBA 3UNWA 3VP4A 3BFCA 4LV3A 2FFFB 4PM7A 1IKIA 2JCHA 4ZJ2A 4UA6A 4PM5A 3OPLA 1ES3A 2J7VA 3BLSA 5CHMA 3IXGA 2A3UA 4WM9A 3Q7ZA 1GHPA 3OPHA 3HLWA 4GDBA 3UDIA 2BLSA 4S2KA 2OLUA 2WGVA 2JE5A 3O87A 1NRFA 1LHYA 4JXSA 5E2EA 5KMWA 1Y54A 2RL3A 3UO9A 2ZJ9A 5CERA 2IWCA 3A3EA 4OVDA 4EV4A 2UWXA 3IT9A 1PW8A 2WGWB 4N9KA 5E43A 1ESUA 3M6HA 1BLCA 1XPBA 3HUOA 5DF9A 1I2WA 1JTDA 3ZDJA 2V2FF 2QPNA 3C7UA 3D4FA 3SH9A 4XUXA 1ES2A 1RGYA 1E25A 1CK3A 5FQKA 4EBLA 3I7JA 4Y0TA 2EXAA 2A49A 4P0MA 4OP8A 1JTGA 1FCNA 4WMCA 1XXMA 2WYXA 2BG1A 4X68A 2I72A 3ITAA 3BFDA 2HPBA 2OSUA 1YLJA 2XFTA 4JXVA 4LV1A 4GD6A 3FKVA 4IVKA 2WGWA 1NZOA 1TVFA 3DWZA 3IHBA 4DKIA 4K0WA 1FCMA 2HDSA 2P74A 1K57A 1K57C 2WGIA 3FV7A 4WZ4A 5A93A 5JYOA 1EROA 1CI9A 2WADA 2Y2GA 4HEFA 1FR1A 3ZVWA 4EBNA 3FKWA 3M6BA 2Y2LA 3IXBA 1JVJA 1BLSA 4BLMA 4H8RA 5CTMA 2PU4A 2HDRA 2HP6A 3C4PA 5I94A 3MKEA 2H10A 4MEZA 4OPYA 3ZG8B 4QD4A 3HLFA 3VP1A 1BLHA 4E3IA 5A91A 1YLPA 4KG6A 4S2IA 4MNRA 4GKUA 3Q7VA 2XLNA 3VOZA 2ZLYA 3N7WA 3TG9A 4OLGA 5HARA 1ONHA 3VSKA 5AQAA 5KZHA 1FOFA 2OLVA 4R3BA 1PYYA 3LCEA 3S4XA 1MBLA 4GDNA 3N6IA 2ZQ9A 3UE3A 5KSHA 1GA0A 2PU2A 2Y59A 3Q81A 3G2YA 3Q07A 4E3NA 3MZFA 1MPLA 4OQHA 4N1HA 2WKIA 2IWBA 3UDXA 4S2OA 5FATA 5CGSA 2Z2LB 3SH8A 3ZG0A 2WKEA 4OPQA 5GLCA 2ZM0A 1EWZA 4KZ5A 4ZTKA 5HFOA 1IYQA 1SDEA 1SCWA 4KZ8A 1YT4A 3ZCZA 3A3FA 2Y2PA 3IF6B 2Q9MA 4RX3A 4GZBA 2XR0A 5F1FA 2VGJA 3WRZA 4WMCD 2WAFA 2EX2A 4S2NC 4F94A 2JBFA 5TR7A 4BENA 1YLTA 3VOYA 1IELA 4EWFA 3VP2A 1ES4A 4WEJA 5CHUA 5FI2A 4MBKA 1K6SA 4OH0A 2C5WB 4KQOA 4PPRA 2EX8A 2WZZA 4RVAA 5FI7A 4N9LA 1ALQA 3W4OA 4E3OA 4DXBA 1BTLA 3BFEA 3NDEA 2XGNA 2WKHA 2DNSA 3LO7A 1Z6FA 4OOMA 1CI8A 3SS5A 4ZJ1A 4R0QA 1MY8A 3PBNA 3OCNA 1KGEA 1M6KA 2XD5A 4IBRA 2R9WA 1BT5A 3WS4A 4OPRA 4QJGA 3AGDA 4X6TA 1S0WA 2ZC5B 4UA7A 4FSFA 1I2SA 3UY6A 3AGEA 2X02A 1K25A 1LL5A 4OOLA 5FAOA 4LENA 1ES5A 4PM9A 3W4PA 2EFXA 4KZAA 4ZDXA 4JF5A 5FAQA 4DE1A 5E2GA 4E6XA 4OLDA 4P87A 5EE8A 1BZAA 5EOOA 3GR2A 2H5SA 3SS3A 4XUZA 4WEKA 5FA7A 3V3RA 3IWQA 1HD8A 2E8IA 3GQZA 1K4FA 1NY0A 4S2JA 1W5DA 4NETA 1NZUA 4C3QA 3N8RA 2XF3A 4MLLA 3DWKA 4X69A 5L2FA 2XEPA 3HLGA 4X53A 5DTTA 4ZBEA 1XGIA 4MBFA 3UE0A 3WS5A 4DF6A 1CEGA 4FD8A 1VQQA 4JKTA 1YMSA 1KVLA 3V3SA 2ZC4B 3UPPA 3HLBA 4KG2A 1XGJA 4K0XA 5TFQA 5AQ9A 1DY6A 1ZC2A 3VFHA 4QHCA 3W4QA 1YLZA 5J8XA 1NXYA 1NYYA 5GL9A 2DCFA 1S6RA 3GV9A 2WZXA 2XFSA 1RCJA 4OQ0A 3NIAA 5EPHA 3IWOA 4BD1A 1MWSA 5CXWA 1G6AA 2FFYA 3VP0A 3NCKA 5GHXA 4S2LA 5EECA 1W79A 3Q7VB 5FQIA 5TGFA 3C4OA 4KZ6A 1YLYA 4S2PA 5E2FA 5KSCA 3HLDA 2EX9A 1PI4A 4ZAMA 5GHZA 1IYOA 1JWVA 5M18A 1H8ZA 4Y0UA 1QMEA 2ZQAA 3BEBA 2Y2NA 3M2KA 5FSRA 4BQMA 1WYCA 4WBGA 3A3JA 4OQIA 4QB8A 4KG5A 1H8YA 3UN7A 1FR6A 3B3XA 5IHVA 1GHMA 3M2JA 4IVIA 2Z2MB 1DJAA 1O07A 4N92A 3MXRA 4ZJ3A 4DE0A 5CEBA 4UA9A 3LEZA 4GB7A 2Y2MA 3W8KA 3G31A 3IHAA 5A90A 3GRJA 3UPOA 4GNUA 3PBOA 1QMFA 5CECA 1KGFA 1G68A 2H0TA 3BYDA 4EUZA 5HAIA 3GTCA 1U60A 3BRMA 1WYBA 4ID4A 4NK3A 4QY6A 4R1GA 5FQ9A 1XA1A 2Y55A 3VSLA 4K91A 4GN2A 1SDNA 3HLCA 2HP9A 5EVIC 5EVIA 3BFGA 4B4ZA 5HAQA 3NBLA 3G34A 1L0EA 3WRTA 1BUEA 4LV0A 5CGWA 1J9MA 5EUAA 5GLDA 4BD0A 3N4IA 1MXOA 1E3UA 2WUQA 2X71A 3FWLA 4C6YA 4Q8IA 4O7DA 1GCEA 3AGFA 4IEDA 1YMXA 4RA7A 3N8LA 5GHYA 1GHIA 3UDFA 1ZG4A 4S2NA 1N9BA 1XX2A 2Y2IA 3MKFA 5DF8A 3LY4A 4JPMA 2XDMA 3Q82A 4OP5A 5F1GA 3ISGA 4WZ5A 2Y91A 4WZ5C 3VP3A 1XA7A 3CMZA 4X55A 3UPNA 1YLWA 4BJPA 4Z9QA 4S2MA 5DTSA 3JYIA 5HAPA 1Q2PA 4DE3A 1JWZA 1TDGA 4RYEA 1ERMA 5DVAA 2G2WA 4BL2A 1BULA 3C5AA 5CRFA 1KDSA 4HBUA 3GVBA 2ZC6B 4HESA 3LY3A 2Y2KA 3HUNA 5BOHA 4DDYA 2Y2JA 4R4SA 4CJNA 4LV2A 3ZG9B 3PBSA 1L0FA 1K54A 1K54C 1TEMA 4WYYA 3ZG5A 5M1AA 3OCLA 2DRWA 1FSYA 2XQZA 3NC8A 4IBXA 4L0LA 1L0GA 3WS0A 1O7EA 5EOEA 3NY4A 3WS2A 5U47A 3DW0A 3PAGA 1NJ4A 5M19A 2WAEA 4LCLA 1XP4A 2Y2QA 3G30A 2ZC3B 2ZM8A 4OPZA 3IH9A 1ZKJA 1XKZA 5FI6A 4P6BA 1AXBA 5FQQA 2R9XA 2B5RA 1DJBA 1IKGA 1K38A 1SKFA 5FQMA 2ZQDA 1PIOA 2Y2HA 4U0XA 3RXWA 1LI0A 1KE3A 3CZDA 2HDQA 4DXCA 3G2ZA 4U0TA 3IXHA 3OZHA 1E3UD 1KGGA 2H0YA 3CJMA 1E4DA 1JWPA 3IF5A 2JC7A 4Y0OA 3MFDA 2ZQCA 3SOIA 1LLBA 3QHYA 4R23A 4WELA 4KZ4A 3ZGAB 4EQIA 3HL9A 2P9VB 4M3KA 3CG5A 1L0DA 4P85A 4PM8A 1BSGA 1L2SA 3HVFA 4FCFA 4UAAA 3UE1A 3G32A 1HTZA 1EI5A 3SH7A 1RP5A 2J8YA 3PBTA 4DRTA 1LL9A 3BM6A 1RGZA 3QNCA 4JF4A 1WE4A 3MZEA 4U3TA 2V20A 3O86A 3DTMA 3P98A 5A92A 5FASA 2WK0A 5JYPA 5FAPA 1MWRA 4PMAA 4UHUA 3ITBA 4E3MA 2P9VA 3G35A 3ZNYA 1KE0A 3PAEA 2XH9A 1MWTA 3PBQA 1H5XA 3N8SA 5G18A 2J9PA 1HZOA 3FZCA 1K56A 4FH4A 5CTNA 4JF6A 5EVIB 1W7FA 2Y4AA 2Q9NA 4GD8A 5F82A 4YINA 3E2LA 4R4RA 5HW3A 4X56A 3V50A 3IWIA 1PW1A 3GMWA 5HX9A 4BL3A 1PWDA 3MBZA 5FQJA 3HUMA 3BLMA 3VMAA 4OKPA 2RCXA 1SHVA 3IQAA 3O3VA 4E3LA 4OOYA 5CHJA 3A3IA 1C3BA 1FCOA 2C6WB 3C7VA 3NI9A 3V5MA 4Y7PA 5CEDA 3P09A 4JBFA 3IXDA 4KZ3A 1BLPA 1FSWA 3TOIA 4E3KA 1YQSA 1VM1A 4C75A 2XK1A 1MWUA 5DF7A 4JLFA 1ESIA 4R3JA 4B4XA 2G2UA 5F83A 1IEMA 1M40A 3VFFA 2VGKA 1KVMA 1K6RA 2HP5A 1K55A 1K55C 1NYMA 4KQRA 3ZG7B 1Q2QA 2EX6A 4XXRA 2GDNA 3E2KA 2ZQ8A 4KENB 1PI5A 4KQQA 5GLAA 4JXWA 5AQ7A 2QZ6A 3OC2A 2ZM2A 2ZD8A 5EVLA 3V39A 4E6WA 4MBHA 4A5RA 4PM6A 4D2OA 3HLEA 3RJUA 1GA9A 4FH2A 3BFFA 3FYZA 3Q1FA 3PBRA 5DTKA 3WS1A 3ZFZA 4DDSA 3OPRA 3BECA 4B88A 4HBTA 1I5QA 2CC1A 4RX2A 2V1ZA 4DE2A 1IYSA 1TDLA 2EXBA 2IWDA 4EBPA 4N1XA 2ZC7A 3O88A 1PWGA 4OONA 4E3JA 1ZG6A 1N4OA 3GSGA 4QU3A 1PWCA 3HBRA 3SS4A 1DJCA 4QY5A 1K56D 2J9OA 3ZNTA 1IYPA 1ERQA 3WWXA 1PZOA 2ZQ7A 3EQVA 5AQBA 4CPKA 5CGXA 2OV5A 3RXXA 3G4PA 3MXSA 1PZPA 3HREA 3QNBA 1CEFA 2ZMAA 3MZDA 4GOGA 4KZBA 1HVBA 4KZ9A 5D3OA 2QMIA 5E2HA 1KE4A 3OPPA 1KDWA 1LI9A 1YM1A 3EQUA 4KZ7A 1K4EA 3NDGA 3S1YA 1FQGA 4YFMA 1W8YA 5HL1A 3IF6A 3IF6C 2Y2OA 2EFUA 1ONGA 1OMEA
chains in the Genus database with same CATH superfamily
3ZHHA 1OTEA 3A3DA 3MMHA 2X01A 1S1YA 4OQGA 4WF0A 5GLBA 4LV3A 4PM7A 1IKIA 4CLCE 4HIAA 3BLSA 3Q7ZA 3OPHA 3HLWA 3UDIA 3R4KA 4S2KA 5HD5A 5E2EA 5KMWA 5CERA 1GSXA 5E43A 1ESUA 2M7UA 1BLCA 2ZL1A 1UGUA 3ZDJA 2QPNA 1P97A 3SH9A 1E25A 1CK3A 1JTGA 2Q0OA 1YLJA 2XFTA 2XA7M 4GHIA 2WGWA 1DRMA 1NZOA 3IHBA 1FCMA 2HDSA 3FV7A 2J80A 4HEFA 3F1PB 4BLMA 5CTMA 2CMNA 3S7PA 5HWTA 3QP1A 2HDRA 2WKQA 2BASA 4HH2A 2JKRI 4IUHA 4CQHA 1J3WA 4S2IA 4GKUA 2XLNA 3VOZA 3TG9A 2KX6A 3VSKA 4F3LB 5AQAA 3S4XA 4G3KA 2Y59A 3Q81A 5K5BA 1XFQA 1MPLA 4N1HA 3D9YA 5FATA 3SH8A 2VV8A 1N9LA 4Z1WA 2VV6A 1SDEA 2O9AA 4KZ8A 3ZCZA 4WL9A 3A3FA 3L7HA 5AVFA 2EX2A 4F94A 1YLTA 3VOYA 1IELA 1OJGA 2C5WB 5DFXA 2WZZA 4GLQA 1ALQA 4E3OA 4DXBA 3LO7A 1Z6FA 2XRNA 1CI8A 3VOLA 2WKPA 4R0QA 3EGXC 1KGEA 2HZ5A 3MJQA 2R9WA 1BT5A 3H7WB 3KSGA 4X6TA 1S0WA 1T1AA 1LL5A 2UV0E 4LRYC 5FEGA 1X0OA 3OLOA 5E2GA 4OLDA 5EE8A 3GR2A 3LIFA 4XUZA 4WEKA 5FA7A 4HP9A 3GQZA 1K4FA 4S2JA 1WA9A 3N8RA 2JHEA 2VA0A 5IT5A 2XROA 4JKTA 5G4YA 4EEUA 3VFHA 4QHCA 2QWSA 5GL9A 1S6RA 3UB7A 3GV9A 2WZXA 2DMWA 4BD1A 2PR6A 5L8MA 5EECA 5L09A 2J3TC 4KZ6A 3HLDA 5GHZA 1PI4A 3UMDA 1IYOA 1PNEA 5FSRA 1WYCA 3A3JA 2V9AA 3UN7A 3B3XA 3ZYTA 4IVIA 4N92A 1TD5A 4UA9A 4GB7A 3IHAA 5J7EA 4LLOB 3NHQA 5CECA 1G68A 4R1GA 1U60A 2O0YA 1YSQA 3CLOA 3BQ8A 4K91A 5EVIA 3HLCA 4B4ZA 5HAQA 2O9CA 5EUAA 5GLDA 2WUQA 3LYXA 4C6YA 4Q8IA 1GCEA 3AGFA 2GNXA 4RA7A 1ZG4A 1N9BA 3HCYA 2Y2IA 3T4KA 3LY4A 2XDMA 4Y15A 4OP5A 1T1BA 3VP3A 1CF0A 1XA7A 3T1XA 1JWZA 1TDGA 4RYEA 1ERMA 2JKRM 3GVBA 3L9KA 3LY3A 4DDYA 2Y2JA 2LB5A 3ZG9B 3PBSA 1TEMA 2JN7A 4O01A 3S7QA 3ZG5A 1TF1A 3OCLA 2XQZA 2MJ6A 1T1CA 1O7EA 5EOEA 3MQ0A 3BY9A 2HV1A 3IH9A 2JKFA 4P6BA 1IKGA 1SKFA 2VEAA 3KO6A 3LIDA 3UB6A 4NXEA 2VLGA 4U0XA 1LI0A 3G2ZA 4MCWA 5HDCA 3MFDA 2G7UA 2ZQCA 3SOIA 1LLBA 1TS0A 5HL6A 1BSGA 3EOIA 3HVFA 4EW7A 3LR4A 1EI5A 2GZAA 5FDSA 3QNCA 4JF4A 3MZEA 2V20A 3O86A 3BY8A 5A92A 5JYPA 2XSSA 2L1MA 5F5YA 5HSQA 2XH9A 3PBQA 2J9PA 3FZCA 4FH4A 1OT6A 5IS1A 4R4RA 3EWKA 3V50A 3IWIA 1PW1A 1VETA 3GMWA 5HX9A 1PWDA 3MBZA 4CLCB 3HUMA 3O3VA 5CHJA 3CUEA 1FCOA 2VGLM 2V0UA 4R38A 2OWJA 4E3KA 1VM1A 2XK1A 2VV7A 4NXFA 4I3IA 5F83A 3VFFA 3LR3A 4CLCC 1Q2QA 3C2WA 2GX5A 3E2KA 2VZWA 5GLAA 4QWOA 5AQ7A 3EGDC 3CAXA 4BMWA 4FH2A 5DTKA 3OPRA 3H82B 2VJWA 2Z6DA 1IYSA 2B95A 3O88A 2QJ5A 4OONA 3GSGA 3HBRA 4MDZA 3T12B 2ZQ7A 3JVUA 3MXSA 1PZPA 3HREA 4GOGA 1HVBA 4Q0IA 3OPPA 1SKOB 1LI9A 1W8YA 2EFUA 4UQIS 1N9NA 2PBYA 4DMZA 1MKIA 3PTEA 2PAVP 2FFFB 2H28A 4ETXA 4EUVA 4UA6A 2D02A 4HJ6A 4PM5A 4EU0A 3IXGA 4WM9A 2W3EA 2OLUA 2PHYA 3NOUC 4PKYG 5J4EA 1L3LA 1Y54A 3UMEA 2ZJ9A 2PBDP 3EEHA 2L4RA 4JGPA 5EVEA 1XPBA 2PT7A 3HUOA 1STZA 1RGYA 2OAQ1 2KLIA 5FQKA 4EBLA 3C38A 4Y0TA 3LIAA 2A49A 1FCNA 3TW8A 2V0WA 3E0YA 3BFDA 4LV1A 4GD6A 3H9WA 1TVFA 2GJ3A 4WZ4A 1K57C 1EROA 2WADA 4EBNA 3FKWA 4I3AA 4ETZA 3JVVA 4XT2A 2HP6A 4HHDA 3MKEA 2H10A 4MEZA 4OPYA 3HLFA 5HDSA 4MNRA 3CPTB 3N7WA 1XJ4A 1ONHA 4Y3IA 1DP8A 4R3BA 3LCEA 2ZQ9A 4HI4A 5KSHA 3Q07A 3MZFA 2WKIA 3UDXA 3ZG0A 1OTDA 2WKEA 5TBMB 1EWZA 2QHKA 1CJFA 1IYQA 3UB8A 3IF6B 5F1FA 2VGJA 1N9OA 2JBFA 5TR7A 4EWFA 3GECA 1ES4A 4WEJA 1K6SA 2WKHA 4OOMA 4H6JB 1MY8A 2V1BA 1S66L 1GSVA 3S7NA 4OPRA 3AGDA 3UY6A 3AGEA 5FAOA 4LENA 1ES5A 3QP6A 3W4PA 4KZAA 4ZDXA 4JF5A 5FAQA 4E6XA 2H5SA 3SS3A 1NY0A 3MQQA 4JGOA 2NUTC 3QP2A 3S7OA 2OOLA 5L2FA 2V1AA 4X53A 4EXOA 1KVLA 2ZC4B 3UPPA 1ZHHB 2W3HA 1MC0A 1YSPA 3LIEA 2W1TA 5J8XA 1NXYA 2P7JA 2XFSA 3NIAA 4O0PA 2FFYA 5GHXA 2HJ9C 4ARZB 4S2LA 3C4OA 5E2FA 2K7SA 3DTIA 1H8ZA 3KYEA 2ZOIA 1S67L 4GS9B 3O5YA 4WBGA 4KG5A 1H8YA 2OWHA 2PYPA 1GHMA 3M2JA 1O07A 3DBAA 4ZJ3A 5CEBA 1G5UA 3W8KA 4PKYA 5A90A 3UPOA 4KQDA 2W0NA 2H0TA 4BBTA 5HAIA 1P9WA 4NK3A 4ID4A 1G6OA 5TJJA 4B9OA 4O8GA 1XA1A 3LI9A 5EV0A 2HP9A 1H3QA 2A24B 1BUEA 3B47A 3N4IA 1MXOA 1E3UA 4JGRA 3RH8B 4O7DA 2EA9A 5GHYA 3UDFA 3MKFA 1IFQA 2D01A 4ZRRA 3IX4A 4WZ5A 3UPNA 1YLWA 4S2MA 3JYIA 1Q2PA 3MQOA 5AVEA 3K2NA 4DE3A 1D1JA 1DP6A 3DTEA 4HESA 3IX8A 5BOHA 4R4SA 4IUKA 4WN5A 1K54A 4IBXA 5IU1A 3PYPA 1T19A 4KUKA 4LCLA 2Y2QA 1TS6A 3F1OB 3BW6A 3QP8A 2W3DA 4Y13A 2R9XA 1LL8A 1DJBA 2P08A 2ZQDA 1KE3A 1F5MA 2HDQA 3CZDA 3GDIA 3IXHA 3OZHA 1E3UD 1KGGA 1JWPA 3IF5A 2JC7A 1SKOA 4KZ4A 4EQIA 3HL9A 2P9VB 4P85A 3CG5A 4PM8A 3MS6A 3F1NB 4UAAA 2ZOHA 3R7WB 3SH7A 3PBTA 4Q0HA 1RGZA 3DTMA 3P98A 2WK0A 4HQAA 1FIKA 4PMAA 4E3MA 5G18A 4Y5FA 5CTNA 4GD8A 3E2LA 5HW3A 5FL3A 4EQ1A 4GW9A 5FQJA 3BLMA 3P7NA 4OKPA 1SHVA 4E3LA 4OOYA 3A3IA 2JKGA 3C7VA 3NI9A 5HDDA 5MC7A 1BLPA 4C75A 4R3JA 4B4XA 2G2UA 1IEMA 2PD7A 2VGKA 3ICYA 3TJZC 1K55A 4HOIA 3LR0A 4XXRA 2ZQ8A 4KQQA 5HD3A 4JXWA 3SZTA 2ZD8A 5EVLA 3HJIA 3BFFA 5F6AA 1CQAA 3WS1A 4DDSA 4HBTA 1OT9A 2V1ZA 2IWDA 1VHMA 1N4OA 3SS4A 1DJCA 3MXQA 3ZNTA 3EQVA 5AQBA 5TBMA 5L07A 3RXXA 3G4PA 3QNBA 2VX8A 3PHYA 3EQUA 1K4EA 1Z09A 3S1YA 1FQGA 4HJ3A 4D60A 3IF6A 4OQ0A 1ONGA 4LCMA 1W8QA 5FDHA 3TSGA 2HDUA 3ZVTA 2Y8HA 5EVID 3UNWA 3MSHA 2ZL1B 2JCHA 4ZJ2A 3OPLA 1ES3A 2J7VA 5CHMA 3CWFA 2BLSA 3PR6A 2JE5A 4H6JA 5DJTA 3UO9A 4EV4A 2IWCA 2Z6CA 2UWXA 4GHIB 2O99A 3IT9A 4N9KA 2WGWB 2W1RA 5DF9A 3G6OA 2V2FF 3C7UA 1ES2A 4L9GA 2EXAA 4EEPA 4I3JA 1XXMA 2WYXA 2I72A 2HPBA 5HWVA 3FPVA 4JXVA 3FKVA 4IVKA 3DWZA 4K0WA 5A93A 5JYOA 1Y4OA 3HJKA 1CI9A 1FR1A 3ZVWA 3TRCA 3M6BA 4X1MA 1JVJA 4H8RA 2K2NA 4EETB 4L9FA 3C4PA 3VE3A 4QD4A 1BLHA 4E3IA 1YLPA 4KG6A 2INWA 3B33A 4HP4A 4OLGA 2ZBBA 3F1PA 5KZHA 1PYYA 3NOPC 3N6IA 2PU2A 4E3NA 3LGOA 3KSFA 4OQHA 2IWBA 5CGSA 2Z2LB 2M1CA 4OPQA 5GLCA 4KZ5A 4ZTKA 4UQIM 4F3LA 3FC7A 1SCWA 1YT4A 4B93A 4GZBA 2XR0A 3WRZA 1OJ5A 1SZVA 1LT0A 3VP2A 3LUQA 5CHUA 4KQOA 3KX0X 4PPRA 5FI7A 4N9LA 4LPZA 3W4OA 1BTLA 3NDEA 2DNSA 4WUJA 4X25A 3SS5A 3FG8A 4LFUA 4ZJ1A 3OCNA 4IBRA 4ESPA 3WS4A 1P9RA 4LGWA 4QJGA 4UA7A 1I2SA 5FEFA 3E98A 4OOLA 2W27A 2IA2A 3NULA 4DE1A 3W2ZA 3IBRA 3IWQA 2E8IA 3H7WA 2W3FA 1W5DA 4C3QA 4LRZE 4NXGA 2XF3A 4NKPA 4DJ3A 5DTTA 4ZBEA 1XGIA 4MBFA 3UE0A 3WS5A 4DF6A 1CEGA 1VQQA 3MFXA 3V3SA 2VKSA 4KG2A 5TFQA 1DY6A 4M4XA 2VK3A 1NYYA 3VV4A 2DCFA 5EPHA 5CXWA 2B02A 3SW1A 1W79A 3Q7VB 3T50A 1OPXA 1YLYA 4S2PA 5LBRA 2EX9A 1JWVA 2OAP1 1TS7A 4Y0UA 3M2KA 1FR6A 5IHVA 1ZTUA 1NLZA 1DJAA 2BTFP 2Y2MA 2LB9A 3GRJA 3PBOA 1QMFA 2KDKA 1KGFA 3BYDA 3GTCA 3BRMA 1WYBA 1S4SA 5KIZA 4R70A 4GN2A 1SDNA 3E4PA 5EVIC 4BBUA 3T4OA 4I39A 3NBLA 1GSWA 4II7A 5CGWA 3FWLA 3E4OA 1V9ZA 3T4JA 1H0MA 4IEDA 4S2NA 3C8CA 4R3AA 5DF8A 4FOFA 4JPMA 3Q82A 1S1ZA 3ISGA 4X55A 4BJPA 4Z9QA 5DTSA 3FPWA 4NEED 2ZMFA 1MKMA 4BL2A 3BQAA 3UB9A 5CRFA 4HBUA 2ZC6B 1JNUA 3NECA 4LV2A 1FILA 4WYYA 5M1AA 2DRWA 3LICA 3NC8A 4L0LA 3WS0A 3V67A 2FZ0A 3DW0A 3PAGA 4P6ZS 1NJ4A 4IJGA 1VEUB 3G30A 2ZC3B 3LIBA 5FI6A 1AXBA 1PRQA 4DJ2A 2B5RA 1K38A 5F68A 5FQMA 1PIOA 2Y2HA 4PHTA 4WLAA 3RXWA 4DXCA 4U0TA 5DFYA 1E4DA 4R23A 3KYZA 1MZUA 1XFNA 3UE1A 3G32A 1ODVA 1HTZA 4K08A 1RP5A 3UB5P 4I38A 4DRTA 3BM6A 1VETB 5HPFA 4U3TA 4QPRA 5FASA 1H8MA 3G35A 1KE0A 3PAEA 3N8SA 1HZOA 4MN7A 1K56A 4JF6A 1W7FA 2Q9NA 4YINA 4R6LA 4X56A 2FH5A 3IS2B 4BL3A 5AJGA 2HGVA 3VMAA 3IQAA 1C3BA 3CUEC 1XJ2A 2C6WB 2PD8A 4Y7PA 5A8BA 3IXDA 4KZ3A 3TOIA 2O9BA 4JLFA 1ESIA 4E04A 2EWVA 2XA7S 1NYMA 4CLCA 2EX6A 5DKLA 3TE8A 4HNBA 1PI5A 4IHQA 1VB6A 2ZM2A 3OC2A 3V39A 4MBHA 3T4QA 4PM6A 4D2OA 3HLEA 3RJUA 1GA9A 1PFLA 3Q1FA 3PBRA 1YKDA 4NXBA 1I5QA 3K3DA 3RTYA 1LSWA 2EXBA 4EBPA 4N1XA 1PWGA 4E3JA 1ZG6A 3MF0A 4QU3A 1PWCA 2E8JA 4QY5A 1K56D 1IYPA 1PZOA 1DP9A 4CPKA 3QP5A 3MZDA 4KZBA 4KZ9A 3JPUA 5D3OA 2QMIA 3H82A 1KE4A 3T4SA 1KDWA 2K31A 1YM1A 4DN0A 4KZ7A 3NDGA 4YFMA 1OMEA 5F1GA 3IH8A 1YPRA 5EM1A 3S22A 1T18A 2AVXA 4JXGA 2XD1A 3VP4A 3BFCA 1HLUP 4EERA 2A3UA 4CLCD 1F9IA 1GHPA 4GDBA 2Y79A 2WGVA 3O87A 1NRFA 4MN6A 1LHYA 3A0SA 4JXSA 1NWZA 4KUOA 2RL3A 3A3EA 4OVDA 3T4TA 1PW8A 2J3WA 3M6HA 1I2WA 1JTDA 3D4FA 4XUXA 3NJAA 3I7JA 1LSVA 2A2LA 4P0MA 3D72A 4OP8A 4XT2B 2QKPA 1OTIA 4WMCA 4X68A 2BG1A 4HY8A 4FTXA 3ITAA 2OSUA 5EFWA 1Y28A 4Y17A 4Q0JA 1D06A 3LEQA 4DKIA 2P74A 2WGIA 1K57A 1EW0A 3T1SA 3LFVA 2Y2GA 5CX7A 2Y2LA 3IXBA 2V8FA 1BLSA 3VE4A 1LSXA 2PU4A 4FUWA 1UWPX 3CI6A 2ZMVA 5I94A 3MR0A 3ZG8B 1AWIA 4YNRA 3VP1A 5A91A 5HZHA 3Q7VA 2ZLYA 5HARA 1FOFA 2OLVA 3QP4A 3KYQA 1MBLA 4GDNA 3UE3A 1GA0A 5HWWA 3G2YA 5DJUA 3E4QA 4S2OA 2ZM0A 5HFOA 3CPTA 4LRXC 5F69A 2Y2PA 2Q9MA 4RX3A 3T4LA 4HH3A 2WAFA 4WMCD 4S2NC 4G3WA 1V9YA 4BENA 3EEAA 1ACFA 5FI2A 4MBKA 4OH0A 3KSHA 2EX8A 4RVAA 4I5SA 3BFEA 3U4LP 2XGNA 2V8CA 1NLYA 3IBJA 3PBNA 1M6KA 2XD5A 3ZQ5A 5L10A 2ZC5B 4FSFA 2X02A 1S4RA 1K25A 1TS8A 4EESA 4PM9A 1BYWA 2EFXA 5J3WA 4P87A 1BZAA 2I9VA 2W1TB 5EOOA 3V3RA 1HD8A 4NETA 1NZUA 2EWWA 3T1RA 4X69A 4MLLA 3DAVA 3DWKA 4JGQA 2XEPA 3HLGA 4FD8A 5I5LA 1YMSA 3HLBA 1XGJA 4K0XA 5AQ9A 1ZC2A 3LI8A 3W4QA 1VEUA 1YLZA 3D3OA 3BWLA 1RCJA 3C30A 3LR5A 3BJNA 3IWOA 1MWSA 1G6AA 3VP0A 3NCKA 4AFIA 5FQIA 5TGFA 5KSCA 3CITA 3B42A 4ZAMA 1OTBA 5M18A 2YKFA 1P0ZA 1QMEA 2ZQAA 3BEBA 2Y2NA 4GCZA 4BQMA 4QB8A 4OQIA 2P04A 2JKTI 2Z2MB 3MXRA 4DE0A 4ARZA 3LEZA 3G31A 5C5KA 4GNUA 4BBVA 4EUZA 4QY6A 4GS9A 5FQ9A 1KOUA 2Y55A 3VSLA 3UE6A 3BFGA 3G34A 1L0EA 3WRTA 4LV0A 3IS2A 1J9MA 3PXPA 4BD0A 2X71A 1D7EA 1XJ3A 1YMXA 3N8LA 3P01A 2QJ7A 5HPIA 1GHIA 1XX2A 1G28A 4MMNA 3NOTC 3DTKA 2Y91A 4WZ5C 3CMZA 2VGLS 1XJ6A 1W63M 2A24A 2HF6A 5HAPA 2B18A 5DVAA 2G2WA 1BULA 3C5AA 1KDSA 5DKKA 3K3CA 2Y2KA 3HUNA 4CJNA 1L0FA 4YWZA 1K54C 1FSYA 1K0KA 5G4ZA 1L0GA 3NY4A 3WS2A 3ULFA 5U47A 5M19A 2WAEA 1XP4A 2QYBA 4G3VA 2YKHA 4ME4A 2ZM8A 4OPZA 1ZKJA 3U2AA 1XKZA 5FQQA 2PRFA 2PYRA 3OBFA 2H0YA 3CJMA 4Y0OA 3QHYA 4WELA 1F98A 3ZGAB 4M3KA 1L0DA 1NRJA 1L2SA 4FCFA 2W3GA 3F1OA 1F2KA 2NUPC 2J8YA 1LL9A 2HJEA 1WE4A 1A0KA 3RFBA 3OOVA 4RQ9A 4X1LA 5FAPA 1MWRA 4UHUA 3ITBA 2P9VA 3ZNYA 1MWTA 1UWNX 1H5XA 4YOFA 3F1NA 2WKRA 5EVIB 3R7WA 2Y4AA 5F82A 1YAXA 2L0WA 4HJ4A 2RCXA 3V5MA 5CEDA 3T1QB 3P09A 4JBFA 3IX3A 1FSWA 1YQSA 1MWUA 5DF7A 1M40A 1KVMA 1K6RA 2HP5A 1K55C 4KQRA 4L9EA 3ZG7B 2PDRA 2GDNA 3A0VA 4KENB 2KOIA 2QZ6A 3KSIA 4E6WA 2M7VA 4A5RA 4P6ZM 4UEYA 3FYZA 1IOUA 2J3TD 3ZFZA 3BECA 4B88A 2CC1A 4GJ4A 4RX2A 2JKTM 2ACGA 4DE2A 2PR5A 1TDLA 2R78A 2ZC7A 4BWIA 4PAUA 2J9OA 1ERQA 4MN5A 3WWXA 4Y2FA 3CHWP 3A0RA 5CGXA 2OV5A 1CEFA 2ZMAA 1OTAA 5E2HA 5EM0A 1W63Q 5HL1A 3IF6C 2Y2OA 4NG2A
chains in the Genus database with same CATH topology
3IH8A 3ZHHA 4LCMA 3A3DA 2PBYA 1W8QA 1MKIA 5FDHA 2HDUA 2X01A 3S22A 3TSGA 3ZVTA 4OQGA 5EVID 3PTEA 4JXGA 2XD1A 5GLBA 3UNWA 3VP4A 3BFCA 4LV3A 2FFFB 4PM7A 1IKIA 2JCHA 4ZJ2A 4UA6A 4PM5A 3OPLA 1ES3A 2J7VA 3BLSA 5CHMA 3IXGA 2A3UA 4WM9A 3Q7ZA 1GHPA 3OPHA 3HLWA 4GDBA 3UDIA 2BLSA 4S2KA 2OLUA 2WGVA 2JE5A 3O87A 1NRFA 1LHYA 4JXSA 5E2EA 5KMWA 1Y54A 2RL3A 3UO9A 2ZJ9A 5CERA 2IWCA 3A3EA 4OVDA 4EV4A 2UWXA 3IT9A 1PW8A 2WGWB 4N9KA 5E43A 1ESUA 3M6HA 1BLCA 1XPBA 3HUOA 5DF9A 1I2WA 1JTDA 3ZDJA 2V2FF 2QPNA 3C7UA 3D4FA 3SH9A 4XUXA 1ES2A 1RGYA 1E25A 1CK3A 5FQKA 4EBLA 3I7JA 4Y0TA 2EXAA 2A49A 4P0MA 4OP8A 1JTGA 1FCNA 4WMCA 1XXMA 2WYXA 2BG1A 4X68A 2I72A 3ITAA 3BFDA 2HPBA 2OSUA 1YLJA 2XFTA 4JXVA 4LV1A 4GD6A 3FKVA 4IVKA 2WGWA 1NZOA 1TVFA 3DWZA 3IHBA 4DKIA 4K0WA 1FCMA 2HDSA 2P74A 1K57A 1K57C 2WGIA 3FV7A 4WZ4A 5A93A 5JYOA 1EROA 1CI9A 2WADA 2Y2GA 4HEFA 1FR1A 3ZVWA 4EBNA 3FKWA 3M6BA 2Y2LA 3IXBA 1JVJA 1BLSA 4BLMA 4H8RA 5CTMA 2PU4A 2HDRA 2HP6A 3C4PA 5I94A 3MKEA 2H10A 4MEZA 4OPYA 3ZG8B 4QD4A 3HLFA 3VP1A 1BLHA 4E3IA 5A91A 1YLPA 4KG6A 4S2IA 4MNRA 4GKUA 3Q7VA 2XLNA 3VOZA 2ZLYA 3N7WA 3TG9A 4OLGA 5HARA 1ONHA 3VSKA 5AQAA 5KZHA 1FOFA 2OLVA 4R3BA 1PYYA 3LCEA 3S4XA 1MBLA 4GDNA 3N6IA 2ZQ9A 3UE3A 5KSHA 1GA0A 2PU2A 2Y59A 3Q81A 3G2YA 3Q07A 4E3NA 3MZFA 1MPLA 4OQHA 4N1HA 2WKIA 2IWBA 3UDXA 4S2OA 5FATA 5CGSA 2Z2LB 3SH8A 3ZG0A 2WKEA 4OPQA 5GLCA 2ZM0A 1EWZA 4KZ5A 4ZTKA 5HFOA 1IYQA 1SDEA 1SCWA 4KZ8A 1YT4A 3ZCZA 3A3FA 2Y2PA 3IF6B 2Q9MA 4RX3A 4GZBA 2XR0A 5F1FA 2VGJA 3WRZA 4WMCD 2WAFA 2EX2A 4S2NC 4F94A 2JBFA 5TR7A 4BENA 1YLTA 3VOYA 1IELA 4EWFA 3VP2A 1ES4A 4WEJA 5CHUA 5FI2A 4MBKA 1K6SA 4OH0A 2C5WB 4KQOA 4PPRA 2EX8A 2WZZA 4RVAA 5FI7A 4N9LA 1ALQA 3W4OA 4E3OA 4DXBA 1BTLA 3BFEA 3NDEA 2XGNA 2WKHA 2DNSA 3LO7A 1Z6FA 4OOMA 1CI8A 3SS5A 4ZJ1A 4R0QA 1MY8A 3PBNA 3OCNA 1KGEA 1M6KA 2XD5A 4IBRA 2R9WA 1BT5A 3WS4A 4OPRA 4QJGA 3AGDA 4X6TA 1S0WA 2ZC5B 4UA7A 4FSFA 1I2SA 3UY6A 3AGEA 2X02A 1K25A 1LL5A 4OOLA 5FAOA 4LENA 1ES5A 4PM9A 3W4PA 2EFXA 4KZAA 4ZDXA 4JF5A 5FAQA 4DE1A 5E2GA 4E6XA 4OLDA 4P87A 5EE8A 1BZAA 5EOOA 3GR2A 2H5SA 3SS3A 4XUZA 4WEKA 5FA7A 3V3RA 3IWQA 1HD8A 2E8IA 3GQZA 1K4FA 1NY0A 4S2JA 1W5DA 4NETA 1NZUA 4C3QA 3N8RA 2XF3A 4MLLA 3DWKA 4X69A 5L2FA 2XEPA 3HLGA 4X53A 5DTTA 4ZBEA 1XGIA 4MBFA 3UE0A 3WS5A 4DF6A 1CEGA 4FD8A 1VQQA 4JKTA 1YMSA 1KVLA 3V3SA 2ZC4B 3UPPA 3HLBA 4KG2A 1XGJA 4K0XA 5TFQA 5AQ9A 1DY6A 1ZC2A 3VFHA 4QHCA 3W4QA 1YLZA 5J8XA 1NXYA 1NYYA 5GL9A 2DCFA 1S6RA 3GV9A 2WZXA 2XFSA 1RCJA 4OQ0A 3NIAA 5EPHA 3IWOA 4BD1A 1MWSA 5CXWA 1G6AA 2FFYA 3VP0A 3NCKA 5GHXA 4S2LA 5EECA 1W79A 3Q7VB 5FQIA 5TGFA 3C4OA 4KZ6A 1YLYA 4S2PA 5E2FA 5KSCA 3HLDA 2EX9A 1PI4A 4ZAMA 5GHZA 1IYOA 1JWVA 5M18A 1H8ZA 4Y0UA 1QMEA 2ZQAA 3BEBA 2Y2NA 3M2KA 5FSRA 4BQMA 1WYCA 4WBGA 3A3JA 4OQIA 4QB8A 4KG5A 1H8YA 3UN7A 1FR6A 3B3XA 5IHVA 1GHMA 3M2JA 4IVIA 2Z2MB 1DJAA 1O07A 4N92A 3MXRA 4ZJ3A 4DE0A 5CEBA 4UA9A 3LEZA 4GB7A 2Y2MA 3W8KA 3G31A 3IHAA 5A90A 3GRJA 3UPOA 4GNUA 3PBOA 1QMFA 5CECA 1KGFA 1G68A 2H0TA 3BYDA 4EUZA 5HAIA 3GTCA 1U60A 3BRMA 1WYBA 4ID4A 4NK3A 4QY6A 4R1GA 5FQ9A 1XA1A 2Y55A 3VSLA 4K91A 4GN2A 1SDNA 3HLCA 2HP9A 5EVIC 5EVIA 3BFGA 4B4ZA 5HAQA 3NBLA 3G34A 1L0EA 3WRTA 1BUEA 4LV0A 5CGWA 1J9MA 5EUAA 5GLDA 4BD0A 3N4IA 1MXOA 1E3UA 2WUQA 2X71A 3FWLA 4C6YA 4Q8IA 4O7DA 1GCEA 3AGFA 4IEDA 1YMXA 4RA7A 3N8LA 5GHYA 1GHIA 3UDFA 1ZG4A 4S2NA 1N9BA 1XX2A 2Y2IA 3MKFA 5DF8A 3LY4A 4JPMA 2XDMA 3Q82A 4OP5A 5F1GA 3ISGA 4WZ5A 2Y91A 4WZ5C 3VP3A 1XA7A 3CMZA 4X55A 3UPNA 1YLWA 4BJPA 4Z9QA 4S2MA 5DTSA 3JYIA 5HAPA 1Q2PA 4DE3A 1JWZA 1TDGA 4RYEA 1ERMA 5DVAA 2G2WA 4BL2A 1BULA 3C5AA 5CRFA 1KDSA 4HBUA 3GVBA 2ZC6B 4HESA 3LY3A 2Y2KA 3HUNA 5BOHA 4DDYA 2Y2JA 4R4SA 4CJNA 4LV2A 3ZG9B 3PBSA 1L0FA 1K54A 1K54C 1TEMA 4WYYA 3ZG5A 5M1AA 3OCLA 2DRWA 1FSYA 2XQZA 3NC8A 4IBXA 4L0LA 1L0GA 3WS0A 1O7EA 5EOEA 3NY4A 3WS2A 5U47A 3DW0A 3PAGA 1NJ4A 5M19A 2WAEA 4LCLA 1XP4A 2Y2QA 3G30A 2ZC3B 2ZM8A 4OPZA 3IH9A 1ZKJA 1XKZA 5FI6A 4P6BA 1AXBA 5FQQA 2R9XA 2B5RA 1DJBA 1IKGA 1K38A 1SKFA 5FQMA 2ZQDA 1PIOA 2Y2HA 4U0XA 3RXWA 1LI0A 1KE3A 3CZDA 2HDQA 4DXCA 3G2ZA 4U0TA 3IXHA 3OZHA 1E3UD 1KGGA 2H0YA 3CJMA 1E4DA 1JWPA 3IF5A 2JC7A 4Y0OA 3MFDA 2ZQCA 3SOIA 1LLBA 3QHYA 4R23A 4WELA 4KZ4A 3ZGAB 4EQIA 3HL9A 2P9VB 4M3KA 3CG5A 1L0DA 4P85A 4PM8A 1BSGA 1L2SA 3HVFA 4FCFA 4UAAA 3UE1A 3G32A 1HTZA 1EI5A 3SH7A 1RP5A 2J8YA 3PBTA 4DRTA 1LL9A 3BM6A 1RGZA 3QNCA 4JF4A 1WE4A 3MZEA 4U3TA 2V20A 3O86A 3DTMA 3P98A 5A92A 5FASA 2WK0A 5JYPA 5FAPA 1MWRA 4PMAA 4UHUA 3ITBA 4E3MA 2P9VA 3G35A 3ZNYA 1KE0A 3PAEA 2XH9A 1MWTA 3PBQA 1H5XA 3N8SA 5G18A 2J9PA 1HZOA 3FZCA 1K56A 4FH4A 5CTNA 4JF6A 5EVIB 1W7FA 2Y4AA 2Q9NA 4GD8A 5F82A 4YINA 3E2LA 4R4RA 5HW3A 4X56A 3V50A 3IWIA 1PW1A 3GMWA 5HX9A 4BL3A 1PWDA 3MBZA 5FQJA 3HUMA 3BLMA 3VMAA 4OKPA 2RCXA 1SHVA 3IQAA 3O3VA 4E3LA 4OOYA 5CHJA 3A3IA 1C3BA 1FCOA 2C6WB 3C7VA 3NI9A 3V5MA 4Y7PA 5CEDA 3P09A 4JBFA 3IXDA 4KZ3A 1BLPA 1FSWA 3TOIA 4E3KA 1YQSA 1VM1A 4C75A 2XK1A 1MWUA 5DF7A 4JLFA 1ESIA 4R3JA 4B4XA 2G2UA 5F83A 1IEMA 1M40A 3VFFA 2VGKA 1KVMA 1K6RA 2HP5A 1K55A 1K55C 1NYMA 4KQRA 3ZG7B 1Q2QA 2EX6A 4XXRA 2GDNA 3E2KA 2ZQ8A 4KENB 1PI5A 4KQQA 5GLAA 4JXWA 5AQ7A 2QZ6A 3OC2A 2ZM2A 2ZD8A 5EVLA 3V39A 4E6WA 4MBHA 4A5RA 4PM6A 4D2OA 3HLEA 3RJUA 1GA9A 4FH2A 3BFFA 3FYZA 3Q1FA 3PBRA 5DTKA 3WS1A 3ZFZA 4DDSA 3OPRA 3BECA 4B88A 4HBTA 1I5QA 2CC1A 4RX2A 2V1ZA 4DE2A 1IYSA 1TDLA 2EXBA 2IWDA 4EBPA 4N1XA 2ZC7A 3O88A 1PWGA 4OONA 4E3JA 1ZG6A 1N4OA 3GSGA 4QU3A 1PWCA 3HBRA 3SS4A 1DJCA 4QY5A 1K56D 2J9OA 3ZNTA 1IYPA 1ERQA 3WWXA 1PZOA 2ZQ7A 3EQVA 5AQBA 4CPKA 5CGXA 2OV5A 3RXXA 3G4PA 3MXSA 1PZPA 3HREA 3QNBA 1CEFA 2ZMAA 3MZDA 4GOGA 4KZBA 1HVBA 4KZ9A 5D3OA 2QMIA 5E2HA 1KE4A 3OPPA 1KDWA 1LI9A 1YM1A 3EQUA 4KZ7A 1K4EA 3NDGA 3S1YA 1FQGA 4YFMA 1W8YA 5HL1A 3IF6A 3IF6C 2Y2OA 2EFUA 1ONGA 1OMEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IH8 A;  3ZHH A;  4LCM A;  3A3D A;  2PBY A;  1W8Q A;  1MKI A;  5FDH A;  2HDU A;  2X01 A;  3S22 A;  3TSG A;  3ZVT A;  4OQG A;  5EVI D;  3PTE A;  4JXG A;  2XD1 A;  5GLB A;  3UNW A;  3VP4 A;  3BFC A;  4LV3 A;  2FFF B;  4PM7 A;  1IKI A;  2JCH A;  4ZJ2 A;  4UA6 A;  4PM5 A;  3OPL A;  1ES3 A;  2J7V A;  3BLS A;  5CHM A;  3IXG A;  2A3U A;  4WM9 A;  3Q7Z A;  1GHP A;  3OPH A;  3HLW A;  4GDB A;  3UDI A;  2BLS A;  4S2K A;  2OLU A;  2WGV A;  2JE5 A;  3O87 A;  1NRF A;  1LHY A;  4JXS A;  5E2E A;  5KMW A;  1Y54 A;  2RL3 A;  3UO9 A;  2ZJ9 A;  5CER A;  2IWC A;  3A3E A;  4OVD A;  4EV4 A;  2UWX A;  3IT9 A;  1PW8 A;  2WGW B;  4N9K A;  5E43 A;  1ESU A;  3M6H A;  1BLC A;  1XPB A;  3HUO A;  5DF9 A;  1I2W A;  1JTD A;  3ZDJ A;  2V2F F;  2QPN A;  3C7U A;  3D4F A;  3SH9 A;  4XUX A;  1ES2 A;  1RGY A;  1E25 A;  1CK3 A;  5FQK A;  4EBL A;  3I7J A;  4Y0T A;  2EXA A;  2A49 A;  4P0M A;  4OP8 A;  1JTG A;  1FCN A;  4WMC A;  1XXM A;  2WYX A;  2BG1 A;  4X68 A;  2I72 A;  3ITA A;  3BFD A;  2HPB A;  2OSU A;  1YLJ A;  2XFT A;  4JXV A;  4LV1 A;  4GD6 A;  3FKV A;  4IVK A;  2WGW A;  1NZO A;  1TVF A;  3DWZ A;  3IHB A;  4DKI A;  4K0W A;  1FCM A;  2HDS A;  2P74 A;  1K57 A;  1K57 C;  2WGI A;  3FV7 A;  4WZ4 A;  5A93 A;  5JYO A;  1ERO A;  1CI9 A;  2WAD A;  2Y2G A;  4HEF A;  1FR1 A;  3ZVW A;  4EBN A;  3FKW A;  3M6B A;  2Y2L A;  3IXB A;  1JVJ A;  1BLS A;  4BLM A;  4H8R A;  5CTM A;  2PU4 A;  2HDR A;  2HP6 A;  3C4P A;  5I94 A;  3MKE A;  2H10 A;  4MEZ A;  4OPY A;  3ZG8 B;  4QD4 A;  3HLF A;  3VP1 A;  1BLH A;  4E3I A;  5A91 A;  1YLP A;  4KG6 A;  4S2I A;  4MNR A;  4GKU A;  3Q7V A;  2XLN A;  3VOZ A;  2ZLY A;  3N7W A;  3TG9 A;  4OLG A;  5HAR A;  1ONH A;  3VSK A;  5AQA A;  5KZH A;  1FOF A;  2OLV A;  4R3B A;  1PYY A;  3LCE A;  3S4X A;  1MBL A;  4GDN A;  3N6I A;  2ZQ9 A;  3UE3 A;  5KSH A;  1GA0 A;  2PU2 A;  2Y59 A;  3Q81 A;  3G2Y A;  3Q07 A;  4E3N A;  3MZF A;  1MPL A;  4OQH A;  4N1H A;  2WKI A;  2IWB A;  3UDX A;  4S2O A;  5FAT A;  5CGS A;  2Z2L B;  3SH8 A;  3ZG0 A;  2WKE A;  4OPQ A;  5GLC A;  2ZM0 A;  1EWZ A;  4KZ5 A;  4ZTK A;  5HFO A;  1IYQ A;  1SDE A;  1SCW A;  4KZ8 A;  1YT4 A;  3ZCZ A;  3A3F A;  2Y2P A;  3IF6 B;  2Q9M A;  4RX3 A;  4GZB A;  2XR0 A;  5F1F A;  2VGJ A;  3WRZ A;  4WMC D;  2WAF A;  2EX2 A;  4S2N C;  4F94 A;  2JBF A;  5TR7 A;  4BEN A;  1YLT A;  3VOY A;  1IEL A;  4EWF A;  3VP2 A;  1ES4 A;  4WEJ A;  5CHU A;  5FI2 A;  4MBK A;  1K6S A;  4OH0 A;  2C5W B;  4KQO A;  4PPR A;  2EX8 A;  2WZZ A;  4RVA A;  5FI7 A;  4N9L A;  1ALQ A;  3W4O A;  4E3O A;  4DXB A;  1BTL A;  3BFE A;  3NDE A;  2XGN A;  2WKH A;  2DNS A;  3LO7 A;  1Z6F A;  4OOM A;  1CI8 A;  3SS5 A;  4ZJ1 A;  4R0Q A;  1MY8 A;  3PBN A;  3OCN A;  1KGE A;  1M6K A;  2XD5 A;  4IBR A;  2R9W A;  1BT5 A;  3WS4 A;  4OPR A;  4QJG A;  3AGD A;  4X6T A;  1S0W A;  2ZC5 B;  4UA7 A;  4FSF A;  1I2S A;  3UY6 A;  3AGE A;  2X02 A;  1K25 A;  1LL5 A;  4OOL A;  5FAO A;  4LEN A;  1ES5 A;  4PM9 A;  3W4P A;  2EFX A;  4KZA A;  4ZDX A;  4JF5 A;  5FAQ A;  4DE1 A;  5E2G A;  4E6X A;  4OLD A;  4P87 A;  5EE8 A;  1BZA A;  5EOO A;  3GR2 A;  2H5S A;  3SS3 A;  4XUZ A;  4WEK A;  5FA7 A;  3V3R A;  3IWQ A;  1HD8 A;  2E8I A;  3GQZ A;  1K4F A;  1NY0 A;  4S2J A;  1W5D A;  4NET A;  1NZU A;  4C3Q A;  3N8R A;  2XF3 A;  4MLL A;  3DWK A;  4X69 A;  5L2F A;  2XEP A;  3HLG A;  4X53 A;  5DTT A;  4ZBE A;  1XGI A;  4MBF A;  3UE0 A;  3WS5 A;  4DF6 A;  1CEG A;  4FD8 A;  1VQQ A;  4JKT A;  1YMS A;  1KVL A;  3V3S A;  2ZC4 B;  3UPP A;  3HLB A;  4KG2 A;  1XGJ A;  4K0X A;  5TFQ A;  5AQ9 A;  1DY6 A;  1ZC2 A;  3VFH A;  4QHC A;  3W4Q A;  1YLZ A;  5J8X A;  1NXY A;  1NYY A;  5GL9 A;  2DCF A;  1S6R A;  3GV9 A;  2WZX A;  2XFS A;  1RCJ A;  4OQ0 A;  3NIA A;  5EPH A;  3IWO A;  4BD1 A;  1MWS A;  5CXW A;  1G6A A;  2FFY A;  3VP0 A;  3NCK A;  5GHX A;  4S2L A;  5EEC A;  1W79 A;  3Q7V B;  5FQI A;  5TGF A;  3C4O A;  4KZ6 A;  1YLY A;  4S2P A;  5E2F A;  5KSC A;  3HLD A;  2EX9 A;  1PI4 A;  4ZAM A;  5GHZ A;  1IYO A;  1JWV A;  5M18 A;  1H8Z A;  4Y0U A;  1QME A;  2ZQA A;  3BEB A;  2Y2N A;  3M2K A;  5FSR A;  4BQM A;  1WYC A;  4WBG A;  3A3J A;  4OQI A;  4QB8 A;  4KG5 A;  1H8Y A;  3UN7 A;  1FR6 A;  3B3X A;  5IHV A;  1GHM A;  3M2J A;  4IVI A;  2Z2M B;  1DJA A;  1O07 A;  4N92 A;  3MXR A;  4ZJ3 A;  4DE0 A;  5CEB A;  4UA9 A;  3LEZ A;  4GB7 A;  2Y2M A;  3W8K A;  3G31 A;  3IHA A;  5A90 A;  3GRJ A;  3UPO A;  4GNU A;  3PBO A;  1QMF A;  5CEC A;  1KGF A;  1G68 A;  2H0T A;  3BYD A;  4EUZ A;  5HAI A;  3GTC A;  1U60 A;  3BRM A;  1WYB A;  4ID4 A;  4NK3 A;  4QY6 A;  4R1G A;  5FQ9 A;  1XA1 A;  2Y55 A;  3VSL A;  4K91 A;  4GN2 A;  1SDN A;  3HLC A;  2HP9 A;  5EVI C;  5EVI A;  3BFG A;  4B4Z A;  5HAQ A;  3NBL A;  3G34 A;  1L0E A;  3WRT A;  1BUE A;  4LV0 A;  5CGW A;  1J9M A;  5EUA A;  5GLD A;  4BD0 A;  3N4I A;  1MXO A;  1E3U A;  2WUQ A;  2X71 A;  3FWL A;  4C6Y A;  4Q8I A;  4O7D A;  1GCE A;  3AGF A;  4IED A;  1YMX A;  4RA7 A;  3N8L A;  5GHY A;  1GHI A;  3UDF A;  1ZG4 A;  4S2N A;  1N9B A;  1XX2 A;  2Y2I A;  3MKF A;  5DF8 A;  3LY4 A;  4JPM A;  2XDM A;  3Q82 A;  4OP5 A;  5F1G A;  3ISG A;  4WZ5 A;  2Y91 A;  4WZ5 C;  3VP3 A;  1XA7 A;  3CMZ A;  4X55 A;  3UPN A;  1YLW A;  4BJP A;  4Z9Q A;  4S2M A;  5DTS A;  3JYI A;  5HAP A;  1Q2P A;  4DE3 A;  1JWZ A;  1TDG A;  4RYE A;  1ERM A;  5DVA A;  2G2W A;  4BL2 A;  1BUL A;  3C5A A;  5CRF A;  1KDS A;  4HBU A;  3GVB A;  2ZC6 B;  4HES A;  3LY3 A;  2Y2K A;  3HUN A;  5BOH A;  4DDY A;  2Y2J A;  4R4S A;  4CJN A;  4LV2 A;  3ZG9 B;  3PBS A;  1L0F A;  1K54 A;  1K54 C;  1TEM A;  4WYY A;  3ZG5 A;  5M1A A;  3OCL A;  2DRW A;  1FSY A;  2XQZ A;  3NC8 A;  4IBX A;  4L0L A;  1L0G A;  3WS0 A;  1O7E A;  5EOE A;  3NY4 A;  3WS2 A;  5U47 A;  3DW0 A;  3PAG A;  1NJ4 A;  5M19 A;  2WAE A;  4LCL A;  1XP4 A;  2Y2Q A;  3G30 A;  2ZC3 B;  2ZM8 A;  4OPZ A;  3IH9 A;  1ZKJ A;  1XKZ A;  5FI6 A;  4P6B A;  1AXB A;  5FQQ A;  2R9X A;  2B5R A;  1DJB A;  1IKG A;  1K38 A;  1SKF A;  5FQM A;  2ZQD A;  1PIO A;  2Y2H A;  4U0X A;  3RXW A;  1LI0 A;  1KE3 A;  3CZD A;  2HDQ A;  4DXC A;  3G2Z A;  4U0T A;  3IXH A;  3OZH A;  1E3U D;  1KGG A;  2H0Y A;  3CJM A;  1E4D A;  1JWP A;  3IF5 A;  2JC7 A;  4Y0O A;  3MFD A;  2ZQC A;  3SOI A;  1LLB A;  3QHY A;  4R23 A;  4WEL A;  4KZ4 A;  3ZGA B;  4EQI A;  3HL9 A;  2P9V B;  4M3K A;  3CG5 A;  1L0D A;  4P85 A;  4PM8 A;  1BSG A;  1L2S A;  3HVF A;  4FCF A;  4UAA A;  3UE1 A;  3G32 A;  1HTZ A;  1EI5 A;  3SH7 A;  1RP5 A;  2J8Y A;  3PBT A;  4DRT A;  1LL9 A;  3BM6 A;  1RGZ A;  3QNC A;  4JF4 A;  1WE4 A;  3MZE A;  4U3T A;  2V20 A;  3O86 A;  3DTM A;  3P98 A;  5A92 A;  5FAS A;  2WK0 A;  5JYP A;  5FAP A;  1MWR A;  4PMA A;  4UHU A;  3ITB A;  4E3M A;  2P9V A;  3G35 A;  3ZNY A;  1KE0 A;  3PAE A;  2XH9 A;  1MWT A;  3PBQ A;  1H5X A;  3N8S A;  5G18 A;  2J9P A;  1HZO A;  3FZC A;  1K56 A;  4FH4 A;  5CTN A;  4JF6 A;  5EVI B;  1W7F A;  2Y4A A;  2Q9N A;  4GD8 A;  5F82 A;  4YIN A;  3E2L A;  4R4R A;  5HW3 A;  4X56 A;  3V50 A;  3IWI A;  1PW1 A;  3GMW A;  5HX9 A;  4BL3 A;  1PWD A;  3MBZ A;  5FQJ A;  3HUM A;  3BLM A;  3VMA A;  4OKP A;  2RCX A;  1SHV A;  3IQA A;  3O3V A;  4E3L A;  4OOY A;  5CHJ A;  3A3I A;  1C3B A;  1FCO A;  2C6W B;  3C7V A;  3NI9 A;  3V5M A;  4Y7P A;  5CED A;  3P09 A;  4JBF A;  3IXD A;  4KZ3 A;  1BLP A;  1FSW A;  3TOI A;  4E3K A;  1YQS A;  1VM1 A;  4C75 A;  2XK1 A;  1MWU A;  5DF7 A;  4JLF A;  1ESI A;  4R3J A;  4B4X A;  2G2U A;  5F83 A;  1IEM A;  1M40 A;  3VFF A;  2VGK A;  1KVM A;  1K6R A;  2HP5 A;  1K55 A;  1K55 C;  1NYM A;  4KQR A;  3ZG7 B;  1Q2Q A;  2EX6 A;  4XXR A;  2GDN A;  3E2K A;  2ZQ8 A;  4KEN B;  1PI5 A;  4KQQ A;  5GLA A;  4JXW A;  5AQ7 A;  2QZ6 A;  3OC2 A;  2ZM2 A;  2ZD8 A;  5EVL A;  3V39 A;  4E6W A;  4MBH A;  4A5R A;  4PM6 A;  4D2O A;  3HLE A;  3RJU A;  1GA9 A;  4FH2 A;  3BFF A;  3FYZ A;  3Q1F A;  3PBR A;  5DTK A;  3WS1 A;  3ZFZ A;  4DDS A;  3OPR A;  3BEC A;  4B88 A;  4HBT A;  1I5Q A;  2CC1 A;  4RX2 A;  2V1Z A;  4DE2 A;  1IYS A;  1TDL A;  2EXB A;  2IWD A;  4EBP A;  4N1X A;  2ZC7 A;  3O88 A;  1PWG A;  4OON A;  4E3J A;  1ZG6 A;  1N4O A;  3GSG A;  4QU3 A;  1PWC A;  3HBR A;  3SS4 A;  1DJC A;  4QY5 A;  1K56 D;  2J9O A;  3ZNT A;  1IYP A;  1ERQ A;  3WWX A;  1PZO A;  2ZQ7 A;  3EQV A;  5AQB A;  4CPK A;  5CGX A;  2OV5 A;  3RXX A;  3G4P A;  3MXS A;  1PZP A;  3HRE A;  3QNB A;  1CEF A;  2ZMA A;  3MZD A;  4GOG A;  4KZB A;  1HVB A;  4KZ9 A;  5D3O A;  2QMI A;  5E2H A;  1KE4 A;  3OPP A;  1KDW A;  1LI9 A;  1YM1 A;  3EQU A;  4KZ7 A;  1K4E A;  3NDG A;  3S1Y A;  1FQG A;  4YFM A;  1W8Y A;  5HL1 A;  3IF6 A;  3IF6 C;  2Y2O A;  2EFU A;  1ONG A;  1OME A; 
#chains in the Genus database with same CATH topology
 3ZHH A;  1OTE A;  3A3D A;  3MMH A;  2X01 A;  1S1Y A;  4OQG A;  4WF0 A;  5GLB A;  4LV3 A;  4PM7 A;  1IKI A;  4CLC E;  4HIA A;  3BLS A;  3Q7Z A;  3OPH A;  3HLW A;  3UDI A;  3R4K A;  4S2K A;  5HD5 A;  5E2E A;  5KMW A;  5CER A;  1GSX A;  5E43 A;  1ESU A;  2M7U A;  1BLC A;  2ZL1 A;  1UGU A;  3ZDJ A;  2QPN A;  1P97 A;  3SH9 A;  1E25 A;  1CK3 A;  1JTG A;  2Q0O A;  1YLJ A;  2XFT A;  2XA7 M;  4GHI A;  2WGW A;  1DRM A;  1NZO A;  3IHB A;  1FCM A;  2HDS A;  3FV7 A;  2J80 A;  4HEF A;  3F1P B;  4BLM A;  5CTM A;  2CMN A;  3S7P A;  5HWT A;  3QP1 A;  2HDR A;  2WKQ A;  2BAS A;  4HH2 A;  2JKR I;  4IUH A;  4CQH A;  1J3W A;  4S2I A;  4GKU A;  2XLN A;  3VOZ A;  3TG9 A;  2KX6 A;  3VSK A;  4F3L B;  5AQA A;  3S4X A;  4G3K A;  2Y59 A;  3Q81 A;  5K5B A;  1XFQ A;  1MPL A;  4N1H A;  3D9Y A;  5FAT A;  3SH8 A;  2VV8 A;  1N9L A;  4Z1W A;  2VV6 A;  1SDE A;  2O9A A;  4KZ8 A;  3ZCZ A;  4WL9 A;  3A3F A;  3L7H A;  5AVF A;  2EX2 A;  4F94 A;  1YLT A;  3VOY A;  1IEL A;  1OJG A;  2C5W B;  5DFX A;  2WZZ A;  4GLQ A;  1ALQ A;  4E3O A;  4DXB A;  3LO7 A;  1Z6F A;  2XRN A;  1CI8 A;  3VOL A;  2WKP A;  4R0Q A;  3EGX C;  1KGE A;  2HZ5 A;  3MJQ A;  2R9W A;  1BT5 A;  3H7W B;  3KSG A;  4X6T A;  1S0W A;  1T1A A;  1LL5 A;  2UV0 E;  4LRY C;  5FEG A;  1X0O A;  3OLO A;  5E2G A;  4OLD A;  5EE8 A;  3GR2 A;  3LIF A;  4XUZ A;  4WEK A;  5FA7 A;  4HP9 A;  3GQZ A;  1K4F A;  4S2J A;  1WA9 A;  3N8R A;  2JHE A;  2VA0 A;  5IT5 A;  2XRO A;  4JKT A;  5G4Y A;  4EEU A;  3VFH A;  4QHC A;  2QWS A;  5GL9 A;  1S6R A;  3UB7 A;  3GV9 A;  2WZX A;  2DMW A;  4BD1 A;  2PR6 A;  5L8M A;  5EEC A;  5L09 A;  2J3T C;  4KZ6 A;  3HLD A;  5GHZ A;  1PI4 A;  3UMD A;  1IYO A;  1PNE A;  5FSR A;  1WYC A;  3A3J A;  2V9A A;  3UN7 A;  3B3X A;  3ZYT A;  4IVI A;  4N92 A;  1TD5 A;  4UA9 A;  4GB7 A;  3IHA A;  5J7E A;  4LLO B;  3NHQ A;  5CEC A;  1G68 A;  4R1G A;  1U60 A;  2O0Y A;  1YSQ A;  3CLO A;  3BQ8 A;  4K91 A;  5EVI A;  3HLC A;  4B4Z A;  5HAQ A;  2O9C A;  5EUA A;  5GLD A;  2WUQ A;  3LYX A;  4C6Y A;  4Q8I A;  1GCE A;  3AGF A;  2GNX A;  4RA7 A;  1ZG4 A;  1N9B A;  3HCY A;  2Y2I A;  3T4K A;  3LY4 A;  2XDM A;  4Y15 A;  4OP5 A;  1T1B A;  3VP3 A;  1CF0 A;  1XA7 A;  3T1X A;  1JWZ A;  1TDG A;  4RYE A;  1ERM A;  2JKR M;  3GVB A;  3L9K A;  3LY3 A;  4DDY A;  2Y2J A;  2LB5 A;  3ZG9 B;  3PBS A;  1TEM A;  2JN7 A;  4O01 A;  3S7Q A;  3ZG5 A;  1TF1 A;  3OCL A;  2XQZ A;  2MJ6 A;  1T1C A;  1O7E A;  5EOE A;  3MQ0 A;  3BY9 A;  2HV1 A;  3IH9 A;  2JKF A;  4P6B A;  1IKG A;  1SKF A;  2VEA A;  3KO6 A;  3LID A;  3UB6 A;  4NXE A;  2VLG A;  4U0X A;  1LI0 A;  3G2Z A;  4MCW A;  5HDC A;  3MFD A;  2G7U A;  2ZQC A;  3SOI A;  1LLB A;  1TS0 A;  5HL6 A;  1BSG A;  3EOI A;  3HVF A;  4EW7 A;  3LR4 A;  1EI5 A;  2GZA A;  5FDS A;  3QNC A;  4JF4 A;  3MZE A;  2V20 A;  3O86 A;  3BY8 A;  5A92 A;  5JYP A;  2XSS A;  2L1M A;  5F5Y A;  5HSQ A;  2XH9 A;  3PBQ A;  2J9P A;  3FZC A;  4FH4 A;  1OT6 A;  5IS1 A;  4R4R A;  3EWK A;  3V50 A;  3IWI A;  1PW1 A;  1VET A;  3GMW A;  5HX9 A;  1PWD A;  3MBZ A;  4CLC B;  3HUM A;  3O3V A;  5CHJ A;  3CUE A;  1FCO A;  2VGL M;  2V0U A;  4R38 A;  2OWJ A;  4E3K A;  1VM1 A;  2XK1 A;  2VV7 A;  4NXF A;  4I3I A;  5F83 A;  3VFF A;  3LR3 A;  4CLC C;  1Q2Q A;  3C2W A;  2GX5 A;  3E2K A;  2VZW A;  5GLA A;  4QWO A;  5AQ7 A;  3EGD C;  3CAX A;  4BMW A;  4FH2 A;  5DTK A;  3OPR A;  3H82 B;  2VJW A;  2Z6D A;  1IYS A;  2B95 A;  3O88 A;  2QJ5 A;  4OON A;  3GSG A;  3HBR A;  4MDZ A;  3T12 B;  2ZQ7 A;  3JVU A;  3MXS A;  1PZP A;  3HRE A;  4GOG A;  1HVB A;  4Q0I A;  3OPP A;  1SKO B;  1LI9 A;  1W8Y A;  2EFU A;  4UQI S;  1N9N A;  2PBY A;  4DMZ A;  1MKI A;  3PTE A;  2PAV P;  2FFF B;  2H28 A;  4ETX A;  4EUV A;  4UA6 A;  2D02 A;  4HJ6 A;  4PM5 A;  4EU0 A;  3IXG A;  4WM9 A;  2W3E A;  2OLU A;  2PHY A;  3NOU C;  4PKY G;  5J4E A;  1L3L A;  1Y54 A;  3UME A;  2ZJ9 A;  2PBD P;  3EEH A;  2L4R A;  4JGP A;  5EVE A;  1XPB A;  2PT7 A;  3HUO A;  1STZ A;  1RGY A;  2OAQ 1;  2KLI A;  5FQK A;  4EBL A;  3C38 A;  4Y0T A;  3LIA A;  2A49 A;  1FCN A;  3TW8 A;  2V0W A;  3E0Y A;  3BFD A;  4LV1 A;  4GD6 A;  3H9W A;  1TVF A;  2GJ3 A;  4WZ4 A;  1K57 C;  1ERO A;  2WAD A;  4EBN A;  3FKW A;  4I3A A;  4ETZ A;  3JVV A;  4XT2 A;  2HP6 A;  4HHD A;  3MKE A;  2H10 A;  4MEZ A;  4OPY A;  3HLF A;  5HDS A;  4MNR A;  3CPT B;  3N7W A;  1XJ4 A;  1ONH A;  4Y3I A;  1DP8 A;  4R3B A;  3LCE A;  2ZQ9 A;  4HI4 A;  5KSH A;  3Q07 A;  3MZF A;  2WKI A;  3UDX A;  3ZG0 A;  1OTD A;  2WKE A;  5TBM B;  1EWZ A;  2QHK A;  1CJF A;  1IYQ A;  3UB8 A;  3IF6 B;  5F1F A;  2VGJ A;  1N9O A;  2JBF A;  5TR7 A;  4EWF A;  3GEC A;  1ES4 A;  4WEJ A;  1K6S A;  2WKH A;  4OOM A;  4H6J B;  1MY8 A;  2V1B A;  1S66 L;  1GSV A;  3S7N A;  4OPR A;  3AGD A;  3UY6 A;  3AGE A;  5FAO A;  4LEN A;  1ES5 A;  3QP6 A;  3W4P A;  4KZA A;  4ZDX A;  4JF5 A;  5FAQ A;  4E6X A;  2H5S A;  3SS3 A;  1NY0 A;  3MQQ A;  4JGO A;  2NUT C;  3QP2 A;  3S7O A;  2OOL A;  5L2F A;  2V1A A;  4X53 A;  4EXO A;  1KVL A;  2ZC4 B;  3UPP A;  1ZHH B;  2W3H A;  1MC0 A;  1YSP A;  3LIE A;  2W1T A;  5J8X A;  1NXY A;  2P7J A;  2XFS A;  3NIA A;  4O0P A;  2FFY A;  5GHX A;  2HJ9 C;  4ARZ B;  4S2L A;  3C4O A;  5E2F A;  2K7S A;  3DTI A;  1H8Z A;  3KYE A;  2ZOI A;  1S67 L;  4GS9 B;  3O5Y A;  4WBG A;  4KG5 A;  1H8Y A;  2OWH A;  2PYP A;  1GHM A;  3M2J A;  1O07 A;  3DBA A;  4ZJ3 A;  5CEB A;  1G5U A;  3W8K A;  4PKY A;  5A90 A;  3UPO A;  4KQD A;  2W0N A;  2H0T A;  4BBT A;  5HAI A;  1P9W A;  4NK3 A;  4ID4 A;  1G6O A;  5TJJ A;  4B9O A;  4O8G A;  1XA1 A;  3LI9 A;  5EV0 A;  2HP9 A;  1H3Q A;  2A24 B;  1BUE A;  3B47 A;  3N4I A;  1MXO A;  1E3U A;  4JGR A;  3RH8 B;  4O7D A;  2EA9 A;  5GHY A;  3UDF A;  3MKF A;  1IFQ A;  2D01 A;  4ZRR A;  3IX4 A;  4WZ5 A;  3UPN A;  1YLW A;  4S2M A;  3JYI A;  1Q2P A;  3MQO A;  5AVE A;  3K2N A;  4DE3 A;  1D1J A;  1DP6 A;  3DTE A;  4HES A;  3IX8 A;  5BOH A;  4R4S A;  4IUK A;  4WN5 A;  1K54 A;  4IBX A;  5IU1 A;  3PYP A;  1T19 A;  4KUK A;  4LCL A;  2Y2Q A;  1TS6 A;  3F1O B;  3BW6 A;  3QP8 A;  2W3D A;  4Y13 A;  2R9X A;  1LL8 A;  1DJB A;  2P08 A;  2ZQD A;  1KE3 A;  1F5M A;  2HDQ A;  3CZD A;  3GDI A;  3IXH A;  3OZH A;  1E3U D;  1KGG A;  1JWP A;  3IF5 A;  2JC7 A;  1SKO A;  4KZ4 A;  4EQI A;  3HL9 A;  2P9V B;  4P85 A;  3CG5 A;  4PM8 A;  3MS6 A;  3F1N B;  4UAA A;  2ZOH A;  3R7W B;  3SH7 A;  3PBT A;  4Q0H A;  1RGZ A;  3DTM A;  3P98 A;  2WK0 A;  4HQA A;  1FIK A;  4PMA A;  4E3M A;  5G18 A;  4Y5F A;  5CTN A;  4GD8 A;  3E2L A;  5HW3 A;  5FL3 A;  4EQ1 A;  4GW9 A;  5FQJ A;  3BLM A;  3P7N A;  4OKP A;  1SHV A;  4E3L A;  4OOY A;  3A3I A;  2JKG A;  3C7V A;  3NI9 A;  5HDD A;  5MC7 A;  1BLP A;  4C75 A;  4R3J A;  4B4X A;  2G2U A;  1IEM A;  2PD7 A;  2VGK A;  3ICY A;  3TJZ C;  1K55 A;  4HOI A;  3LR0 A;  4XXR A;  2ZQ8 A;  4KQQ A;  5HD3 A;  4JXW A;  3SZT A;  2ZD8 A;  5EVL A;  3HJI A;  3BFF A;  5F6A A;  1CQA A;  3WS1 A;  4DDS A;  4HBT A;  1OT9 A;  2V1Z A;  2IWD A;  1VHM A;  1N4O A;  3SS4 A;  1DJC A;  3MXQ A;  3ZNT A;  3EQV A;  5AQB A;  5TBM A;  5L07 A;  3RXX A;  3G4P A;  3QNB A;  2VX8 A;  3PHY A;  3EQU A;  1K4E A;  1Z09 A;  3S1Y A;  1FQG A;  4HJ3 A;  4D60 A;  3IF6 A;  4OQ0 A;  1ONG A;  4LCM A;  1W8Q A;  5FDH A;  3TSG A;  2HDU A;  3ZVT A;  2Y8H A;  5EVI D;  3UNW A;  3MSH A;  2ZL1 B;  2JCH A;  4ZJ2 A;  3OPL A;  1ES3 A;  2J7V A;  5CHM A;  3CWF A;  2BLS A;  3PR6 A;  2JE5 A;  4H6J A;  5DJT A;  3UO9 A;  4EV4 A;  2IWC A;  2Z6C A;  2UWX A;  4GHI B;  2O99 A;  3IT9 A;  4N9K A;  2WGW B;  2W1R A;  5DF9 A;  3G6O A;  2V2F F;  3C7U A;  1ES2 A;  4L9G A;  2EXA A;  4EEP A;  4I3J A;  1XXM A;  2WYX A;  2I72 A;  2HPB A;  5HWV A;  3FPV A;  4JXV A;  3FKV A;  4IVK A;  3DWZ A;  4K0W A;  5A93 A;  5JYO A;  1Y4O A;  3HJK A;  1CI9 A;  1FR1 A;  3ZVW A;  3TRC A;  3M6B A;  4X1M A;  1JVJ A;  4H8R A;  2K2N A;  4EET B;  4L9F A;  3C4P A;  3VE3 A;  4QD4 A;  1BLH A;  4E3I A;  1YLP A;  4KG6 A;  2INW A;  3B33 A;  4HP4 A;  4OLG A;  2ZBB A;  3F1P A;  5KZH A;  1PYY A;  3NOP C;  3N6I A;  2PU2 A;  4E3N A;  3LGO A;  3KSF A;  4OQH A;  2IWB A;  5CGS A;  2Z2L B;  2M1C A;  4OPQ A;  5GLC A;  4KZ5 A;  4ZTK A;  4UQI M;  4F3L A;  3FC7 A;  1SCW A;  1YT4 A;  4B93 A;  4GZB A;  2XR0 A;  3WRZ A;  1OJ5 A;  1SZV A;  1LT0 A;  3VP2 A;  3LUQ A;  5CHU A;  4KQO A;  3KX0 X;  4PPR A;  5FI7 A;  4N9L A;  4LPZ A;  3W4O A;  1BTL A;  3NDE A;  2DNS A;  4WUJ A;  4X25 A;  3SS5 A;  3FG8 A;  4LFU A;  4ZJ1 A;  3OCN A;  4IBR A;  4ESP A;  3WS4 A;  1P9R A;  4LGW A;  4QJG A;  4UA7 A;  1I2S A;  5FEF A;  3E98 A;  4OOL A;  2W27 A;  2IA2 A;  3NUL A;  4DE1 A;  3W2Z A;  3IBR A;  3IWQ A;  2E8I A;  3H7W A;  2W3F A;  1W5D A;  4C3Q A;  4LRZ E;  4NXG A;  2XF3 A;  4NKP A;  4DJ3 A;  5DTT A;  4ZBE A;  1XGI A;  4MBF A;  3UE0 A;  3WS5 A;  4DF6 A;  1CEG A;  1VQQ A;  3MFX A;  3V3S A;  2VKS A;  4KG2 A;  5TFQ A;  1DY6 A;  4M4X A;  2VK3 A;  1NYY A;  3VV4 A;  2DCF A;  5EPH A;  5CXW A;  2B02 A;  3SW1 A;  1W79 A;  3Q7V B;  3T50 A;  1OPX A;  1YLY A;  4S2P A;  5LBR A;  2EX9 A;  1JWV A;  2OAP 1;  1TS7 A;  4Y0U A;  3M2K A;  1FR6 A;  5IHV A;  1ZTU A;  1NLZ A;  1DJA A;  2BTF P;  2Y2M A;  2LB9 A;  3GRJ A;  3PBO A;  1QMF A;  2KDK A;  1KGF A;  3BYD A;  3GTC A;  3BRM A;  1WYB A;  1S4S A;  5KIZ A;  4R70 A;  4GN2 A;  1SDN A;  3E4P A;  5EVI C;  4BBU A;  3T4O A;  4I39 A;  3NBL A;  1GSW A;  4II7 A;  5CGW A;  3FWL A;  3E4O A;  1V9Z A;  3T4J A;  1H0M A;  4IED A;  4S2N A;  3C8C A;  4R3A A;  5DF8 A;  4FOF A;  4JPM A;  3Q82 A;  1S1Z A;  3ISG A;  4X55 A;  4BJP A;  4Z9Q A;  5DTS A;  3FPW A;  4NEE D;  2ZMF A;  1MKM A;  4BL2 A;  3BQA A;  3UB9 A;  5CRF A;  4HBU A;  2ZC6 B;  1JNU A;  3NEC A;  4LV2 A;  1FIL A;  4WYY A;  5M1A A;  2DRW A;  3LIC A;  3NC8 A;  4L0L A;  3WS0 A;  3V67 A;  2FZ0 A;  3DW0 A;  3PAG A;  4P6Z S;  1NJ4 A;  4IJG A;  1VEU B;  3G30 A;  2ZC3 B;  3LIB A;  5FI6 A;  1AXB A;  1PRQ A;  4DJ2 A;  2B5R A;  1K38 A;  5F68 A;  5FQM A;  1PIO A;  2Y2H A;  4PHT A;  4WLA A;  3RXW A;  4DXC A;  4U0T A;  5DFY A;  1E4D A;  4R23 A;  3KYZ A;  1MZU A;  1XFN A;  3UE1 A;  3G32 A;  1ODV A;  1HTZ A;  4K08 A;  1RP5 A;  3UB5 P;  4I38 A;  4DRT A;  3BM6 A;  1VET B;  5HPF A;  4U3T A;  4QPR A;  5FAS A;  1H8M A;  3G35 A;  1KE0 A;  3PAE A;  3N8S A;  1HZO A;  4MN7 A;  1K56 A;  4JF6 A;  1W7F A;  2Q9N A;  4YIN A;  4R6L A;  4X56 A;  2FH5 A;  3IS2 B;  4BL3 A;  5AJG A;  2HGV A;  3VMA A;  3IQA A;  1C3B A;  3CUE C;  1XJ2 A;  2C6W B;  2PD8 A;  4Y7P A;  5A8B A;  3IXD A;  4KZ3 A;  3TOI A;  2O9B A;  4JLF A;  1ESI A;  4E04 A;  2EWV A;  2XA7 S;  1NYM A;  4CLC A;  2EX6 A;  5DKL A;  3TE8 A;  4HNB A;  1PI5 A;  4IHQ A;  1VB6 A;  2ZM2 A;  3OC2 A;  3V39 A;  4MBH A;  3T4Q A;  4PM6 A;  4D2O A;  3HLE A;  3RJU A;  1GA9 A;  1PFL A;  3Q1F A;  3PBR A;  1YKD A;  4NXB A;  1I5Q A;  3K3D A;  3RTY A;  1LSW A;  2EXB A;  4EBP A;  4N1X A;  1PWG A;  4E3J A;  1ZG6 A;  3MF0 A;  4QU3 A;  1PWC A;  2E8J A;  4QY5 A;  1K56 D;  1IYP A;  1PZO A;  1DP9 A;  4CPK A;  3QP5 A;  3MZD A;  4KZB A;  4KZ9 A;  3JPU A;  5D3O A;  2QMI A;  3H82 A;  1KE4 A;  3T4S A;  1KDW A;  2K31 A;  1YM1 A;  4DN0 A;  4KZ7 A;  3NDG A;  4YFM A;  1OME A;  5F1G A;  3IH8 A;  1YPR A;  5EM1 A;  3S22 A;  1T18 A;  2AVX A;  4JXG A;  2XD1 A;  3VP4 A;  3BFC A;  1HLU P;  4EER A;  2A3U A;  4CLC D;  1F9I A;  1GHP A;  4GDB A;  2Y79 A;  2WGV A;  3O87 A;  1NRF A;  4MN6 A;  1LHY A;  3A0S A;  4JXS A;  1NWZ A;  4KUO A;  2RL3 A;  3A3E A;  4OVD A;  3T4T A;  1PW8 A;  2J3W A;  3M6H A;  1I2W A;  1JTD A;  3D4F A;  4XUX A;  3NJA A;  3I7J A;  1LSV A;  2A2L A;  4P0M A;  3D72 A;  4OP8 A;  4XT2 B;  2QKP A;  1OTI A;  4WMC A;  4X68 A;  2BG1 A;  4HY8 A;  4FTX A;  3ITA A;  2OSU A;  5EFW A;  1Y28 A;  4Y17 A;  4Q0J A;  1D06 A;  3LEQ A;  4DKI A;  2P74 A;  2WGI A;  1K57 A;  1EW0 A;  3T1S A;  3LFV A;  2Y2G A;  5CX7 A;  2Y2L A;  3IXB A;  2V8F A;  1BLS A;  3VE4 A;  1LSX A;  2PU4 A;  4FUW A;  1UWP X;  3CI6 A;  2ZMV A;  5I94 A;  3MR0 A;  3ZG8 B;  1AWI A;  4YNR A;  3VP1 A;  5A91 A;  5HZH A;  3Q7V A;  2ZLY A;  5HAR A;  1FOF A;  2OLV A;  3QP4 A;  3KYQ A;  1MBL A;  4GDN A;  3UE3 A;  1GA0 A;  5HWW A;  3G2Y A;  5DJU A;  3E4Q A;  4S2O A;  2ZM0 A;  5HFO A;  3CPT A;  4LRX C;  5F69 A;  2Y2P A;  2Q9M A;  4RX3 A;  3T4L A;  4HH3 A;  2WAF A;  4WMC D;  4S2N C;  4G3W A;  1V9Y A;  4BEN A;  3EEA A;  1ACF A;  5FI2 A;  4MBK A;  4OH0 A;  3KSH A;  2EX8 A;  4RVA A;  4I5S A;  3BFE A;  3U4L P;  2XGN A;  2V8C A;  1NLY A;  3IBJ A;  3PBN A;  1M6K A;  2XD5 A;  3ZQ5 A;  5L10 A;  2ZC5 B;  4FSF A;  2X02 A;  1S4R A;  1K25 A;  1TS8 A;  4EES A;  4PM9 A;  1BYW A;  2EFX A;  5J3W A;  4P87 A;  1BZA A;  2I9V A;  2W1T B;  5EOO A;  3V3R A;  1HD8 A;  4NET A;  1NZU A;  2EWW A;  3T1R A;  4X69 A;  4MLL A;  3DAV A;  3DWK A;  4JGQ A;  2XEP A;  3HLG A;  4FD8 A;  5I5L A;  1YMS A;  3HLB A;  1XGJ A;  4K0X A;  5AQ9 A;  1ZC2 A;  3LI8 A;  3W4Q A;  1VEU A;  1YLZ A;  3D3O A;  3BWL A;  1RCJ A;  3C30 A;  3LR5 A;  3BJN A;  3IWO A;  1MWS A;  1G6A A;  3VP0 A;  3NCK A;  4AFI A;  5FQI A;  5TGF A;  5KSC A;  3CIT A;  3B42 A;  4ZAM A;  1OTB A;  5M18 A;  2YKF A;  1P0Z A;  1QME A;  2ZQA A;  3BEB A;  2Y2N A;  4GCZ A;  4BQM A;  4QB8 A;  4OQI A;  2P04 A;  2JKT I;  2Z2M B;  3MXR A;  4DE0 A;  4ARZ A;  3LEZ A;  3G31 A;  5C5K A;  4GNU A;  4BBV A;  4EUZ A;  4QY6 A;  4GS9 A;  5FQ9 A;  1KOU A;  2Y55 A;  3VSL A;  3UE6 A;  3BFG A;  3G34 A;  1L0E A;  3WRT A;  4LV0 A;  3IS2 A;  1J9M A;  3PXP A;  4BD0 A;  2X71 A;  1D7E A;  1XJ3 A;  1YMX A;  3N8L A;  3P01 A;  2QJ7 A;  5HPI A;  1GHI A;  1XX2 A;  1G28 A;  4MMN A;  3NOT C;  3DTK A;  2Y91 A;  4WZ5 C;  3CMZ A;  2VGL S;  1XJ6 A;  1W63 M;  2A24 A;  2HF6 A;  5HAP A;  2B18 A;  5DVA A;  2G2W A;  1BUL A;  3C5A A;  1KDS A;  5DKK A;  3K3C A;  2Y2K A;  3HUN A;  4CJN A;  1L0F A;  4YWZ A;  1K54 C;  1FSY A;  1K0K A;  5G4Z A;  1L0G A;  3NY4 A;  3WS2 A;  3ULF A;  5U47 A;  5M19 A;  2WAE A;  1XP4 A;  2QYB A;  4G3V A;  2YKH A;  4ME4 A;  2ZM8 A;  4OPZ A;  1ZKJ A;  3U2A A;  1XKZ A;  5FQQ A;  2PRF A;  2PYR A;  3OBF A;  2H0Y A;  3CJM A;  4Y0O A;  3QHY A;  4WEL A;  1F98 A;  3ZGA B;  4M3K A;  1L0D A;  1NRJ A;  1L2S A;  4FCF A;  2W3G A;  3F1O A;  1F2K A;  2NUP C;  2J8Y A;  1LL9 A;  2HJE A;  1WE4 A;  1A0K A;  3RFB A;  3OOV A;  4RQ9 A;  4X1L A;  5FAP A;  1MWR A;  4UHU A;  3ITB A;  2P9V A;  3ZNY A;  1MWT A;  1UWN X;  1H5X A;  4YOF A;  3F1N A;  2WKR A;  5EVI B;  3R7W A;  2Y4A A;  5F82 A;  1YAX A;  2L0W A;  4HJ4 A;  2RCX A;  3V5M A;  5CED A;  3T1Q B;  3P09 A;  4JBF A;  3IX3 A;  1FSW A;  1YQS A;  1MWU A;  5DF7 A;  1M40 A;  1KVM A;  1K6R A;  2HP5 A;  1K55 C;  4KQR A;  4L9E A;  3ZG7 B;  2PDR A;  2GDN A;  3A0V A;  4KEN B;  2KOI A;  2QZ6 A;  3KSI A;  4E6W A;  2M7V A;  4A5R A;  4P6Z M;  4UEY A;  3FYZ A;  1IOU A;  2J3T D;  3ZFZ A;  3BEC A;  4B88 A;  2CC1 A;  4GJ4 A;  4RX2 A;  2JKT M;  2ACG A;  4DE2 A;  2PR5 A;  1TDL A;  2R78 A;  2ZC7 A;  4BWI A;  4PAU A;  2J9O A;  1ERQ A;  4MN5 A;  3WWX A;  4Y2F A;  3CHW P;  3A0R A;  5CGX A;  2OV5 A;  1CEF A;  2ZMA A;  1OTA A;  5E2H A;  5EM0 A;  1W63 Q;  5HL1 A;  3IF6 C;  2Y2O A;  4NG2 A; 
#chains in the Genus database with same CATH homology
 3IH8 A;  3ZHH A;  4LCM A;  3A3D A;  2PBY A;  1W8Q A;  1MKI A;  5FDH A;  2HDU A;  2X01 A;  3S22 A;  3TSG A;  3ZVT A;  4OQG A;  5EVI D;  3PTE A;  4JXG A;  2XD1 A;  5GLB A;  3UNW A;  3VP4 A;  3BFC A;  4LV3 A;  2FFF B;  4PM7 A;  1IKI A;  2JCH A;  4ZJ2 A;  4UA6 A;  4PM5 A;  3OPL A;  1ES3 A;  2J7V A;  3BLS A;  5CHM A;  3IXG A;  2A3U A;  4WM9 A;  3Q7Z A;  1GHP A;  3OPH A;  3HLW A;  4GDB A;  3UDI A;  2BLS A;  4S2K A;  2OLU A;  2WGV A;  2JE5 A;  3O87 A;  1NRF A;  1LHY A;  4JXS A;  5E2E A;  5KMW A;  1Y54 A;  2RL3 A;  3UO9 A;  2ZJ9 A;  5CER A;  2IWC A;  3A3E A;  4OVD A;  4EV4 A;  2UWX A;  3IT9 A;  1PW8 A;  2WGW B;  4N9K A;  5E43 A;  1ESU A;  3M6H A;  1BLC A;  1XPB A;  3HUO A;  5DF9 A;  1I2W A;  1JTD A;  3ZDJ A;  2V2F F;  2QPN A;  3C7U A;  3D4F A;  3SH9 A;  4XUX A;  1ES2 A;  1RGY A;  1E25 A;  1CK3 A;  5FQK A;  4EBL A;  3I7J A;  4Y0T A;  2EXA A;  2A49 A;  4P0M A;  4OP8 A;  1JTG A;  1FCN A;  4WMC A;  1XXM A;  2WYX A;  2BG1 A;  4X68 A;  2I72 A;  3ITA A;  3BFD A;  2HPB A;  2OSU A;  1YLJ A;  2XFT A;  4JXV A;  4LV1 A;  4GD6 A;  3FKV A;  4IVK A;  2WGW A;  1NZO A;  1TVF A;  3DWZ A;  3IHB A;  4DKI A;  4K0W A;  1FCM A;  2HDS A;  2P74 A;  1K57 A;  1K57 C;  2WGI A;  3FV7 A;  4WZ4 A;  5A93 A;  5JYO A;  1ERO A;  1CI9 A;  2WAD A;  2Y2G A;  4HEF A;  1FR1 A;  3ZVW A;  4EBN A;  3FKW A;  3M6B A;  2Y2L A;  3IXB A;  1JVJ A;  1BLS A;  4BLM A;  4H8R A;  5CTM A;  2PU4 A;  2HDR A;  2HP6 A;  3C4P A;  5I94 A;  3MKE A;  2H10 A;  4MEZ A;  4OPY A;  3ZG8 B;  4QD4 A;  3HLF A;  3VP1 A;  1BLH A;  4E3I A;  5A91 A;  1YLP A;  4KG6 A;  4S2I A;  4MNR A;  4GKU A;  3Q7V A;  2XLN A;  3VOZ A;  2ZLY A;  3N7W A;  3TG9 A;  4OLG A;  5HAR A;  1ONH A;  3VSK A;  5AQA A;  5KZH A;  1FOF A;  2OLV A;  4R3B A;  1PYY A;  3LCE A;  3S4X A;  1MBL A;  4GDN A;  3N6I A;  2ZQ9 A;  3UE3 A;  5KSH A;  1GA0 A;  2PU2 A;  2Y59 A;  3Q81 A;  3G2Y A;  3Q07 A;  4E3N A;  3MZF A;  1MPL A;  4OQH A;  4N1H A;  2WKI A;  2IWB A;  3UDX A;  4S2O A;  5FAT A;  5CGS A;  2Z2L B;  3SH8 A;  3ZG0 A;  2WKE A;  4OPQ A;  5GLC A;  2ZM0 A;  1EWZ A;  4KZ5 A;  4ZTK A;  5HFO A;  1IYQ A;  1SDE A;  1SCW A;  4KZ8 A;  1YT4 A;  3ZCZ A;  3A3F A;  2Y2P A;  3IF6 B;  2Q9M A;  4RX3 A;  4GZB A;  2XR0 A;  5F1F A;  2VGJ A;  3WRZ A;  4WMC D;  2WAF A;  2EX2 A;  4S2N C;  4F94 A;  2JBF A;  5TR7 A;  4BEN A;  1YLT A;  3VOY A;  1IEL A;  4EWF A;  3VP2 A;  1ES4 A;  4WEJ A;  5CHU A;  5FI2 A;  4MBK A;  1K6S A;  4OH0 A;  2C5W B;  4KQO A;  4PPR A;  2EX8 A;  2WZZ A;  4RVA A;  5FI7 A;  4N9L A;  1ALQ A;  3W4O A;  4E3O A;  4DXB A;  1BTL A;  3BFE A;  3NDE A;  2XGN A;  2WKH A;  2DNS A;  3LO7 A;  1Z6F A;  4OOM A;  1CI8 A;  3SS5 A;  4ZJ1 A;  4R0Q A;  1MY8 A;  3PBN A;  3OCN A;  1KGE A;  1M6K A;  2XD5 A;  4IBR A;  2R9W A;  1BT5 A;  3WS4 A;  4OPR A;  4QJG A;  3AGD A;  4X6T A;  1S0W A;  2ZC5 B;  4UA7 A;  4FSF A;  1I2S A;  3UY6 A;  3AGE A;  2X02 A;  1K25 A;  1LL5 A;  4OOL A;  5FAO A;  4LEN A;  1ES5 A;  4PM9 A;  3W4P A;  2EFX A;  4KZA A;  4ZDX A;  4JF5 A;  5FAQ A;  4DE1 A;  5E2G A;  4E6X A;  4OLD A;  4P87 A;  5EE8 A;  1BZA A;  5EOO A;  3GR2 A;  2H5S A;  3SS3 A;  4XUZ A;  4WEK A;  5FA7 A;  3V3R A;  3IWQ A;  1HD8 A;  2E8I A;  3GQZ A;  1K4F A;  1NY0 A;  4S2J A;  1W5D A;  4NET A;  1NZU A;  4C3Q A;  3N8R A;  2XF3 A;  4MLL A;  3DWK A;  4X69 A;  5L2F A;  2XEP A;  3HLG A;  4X53 A;  5DTT A;  4ZBE A;  1XGI A;  4MBF A;  3UE0 A;  3WS5 A;  4DF6 A;  1CEG A;  4FD8 A;  1VQQ A;  4JKT A;  1YMS A;  1KVL A;  3V3S A;  2ZC4 B;  3UPP A;  3HLB A;  4KG2 A;  1XGJ A;  4K0X A;  5TFQ A;  5AQ9 A;  1DY6 A;  1ZC2 A;  3VFH A;  4QHC A;  3W4Q A;  1YLZ A;  5J8X A;  1NXY A;  1NYY A;  5GL9 A;  2DCF A;  1S6R A;  3GV9 A;  2WZX A;  2XFS A;  1RCJ A;  4OQ0 A;  3NIA A;  5EPH A;  3IWO A;  4BD1 A;  1MWS A;  5CXW A;  1G6A A;  2FFY A;  3VP0 A;  3NCK A;  5GHX A;  4S2L A;  5EEC A;  1W79 A;  3Q7V B;  5FQI A;  5TGF A;  3C4O A;  4KZ6 A;  1YLY A;  4S2P A;  5E2F A;  5KSC A;  3HLD A;  2EX9 A;  1PI4 A;  4ZAM A;  5GHZ A;  1IYO A;  1JWV A;  5M18 A;  1H8Z A;  4Y0U A;  1QME A;  2ZQA A;  3BEB A;  2Y2N A;  3M2K A;  5FSR A;  4BQM A;  1WYC A;  4WBG A;  3A3J A;  4OQI A;  4QB8 A;  4KG5 A;  1H8Y A;  3UN7 A;  1FR6 A;  3B3X A;  5IHV A;  1GHM A;  3M2J A;  4IVI A;  2Z2M B;  1DJA A;  1O07 A;  4N92 A;  3MXR A;  4ZJ3 A;  4DE0 A;  5CEB A;  4UA9 A;  3LEZ A;  4GB7 A;  2Y2M A;  3W8K A;  3G31 A;  3IHA A;  5A90 A;  3GRJ A;  3UPO A;  4GNU A;  3PBO A;  1QMF A;  5CEC A;  1KGF A;  1G68 A;  2H0T A;  3BYD A;  4EUZ A;  5HAI A;  3GTC A;  1U60 A;  3BRM A;  1WYB A;  4ID4 A;  4NK3 A;  4QY6 A;  4R1G A;  5FQ9 A;  1XA1 A;  2Y55 A;  3VSL A;  4K91 A;  4GN2 A;  1SDN A;  3HLC A;  2HP9 A;  5EVI C;  5EVI A;  3BFG A;  4B4Z A;  5HAQ A;  3NBL A;  3G34 A;  1L0E A;  3WRT A;  1BUE A;  4LV0 A;  5CGW A;  1J9M A;  5EUA A;  5GLD A;  4BD0 A;  3N4I A;  1MXO A;  1E3U A;  2WUQ A;  2X71 A;  3FWL A;  4C6Y A;  4Q8I A;  4O7D A;  1GCE A;  3AGF A;  4IED A;  1YMX A;  4RA7 A;  3N8L A;  5GHY A;  1GHI A;  3UDF A;  1ZG4 A;  4S2N A;  1N9B A;  1XX2 A;  2Y2I A;  3MKF A;  5DF8 A;  3LY4 A;  4JPM A;  2XDM A;  3Q82 A;  4OP5 A;  5F1G A;  3ISG A;  4WZ5 A;  2Y91 A;  4WZ5 C;  3VP3 A;  1XA7 A;  3CMZ A;  4X55 A;  3UPN A;  1YLW A;  4BJP A;  4Z9Q A;  4S2M A;  5DTS A;  3JYI A;  5HAP A;  1Q2P A;  4DE3 A;  1JWZ A;  1TDG A;  4RYE A;  1ERM A;  5DVA A;  2G2W A;  4BL2 A;  1BUL A;  3C5A A;  5CRF A;  1KDS A;  4HBU A;  3GVB A;  2ZC6 B;  4HES A;  3LY3 A;  2Y2K A;  3HUN A;  5BOH A;  4DDY A;  2Y2J A;  4R4S A;  4CJN A;  4LV2 A;  3ZG9 B;  3PBS A;  1L0F A;  1K54 A;  1K54 C;  1TEM A;  4WYY A;  3ZG5 A;  5M1A A;  3OCL A;  2DRW A;  1FSY A;  2XQZ A;  3NC8 A;  4IBX A;  4L0L A;  1L0G A;  3WS0 A;  1O7E A;  5EOE A;  3NY4 A;  3WS2 A;  5U47 A;  3DW0 A;  3PAG A;  1NJ4 A;  5M19 A;  2WAE A;  4LCL A;  1XP4 A;  2Y2Q A;  3G30 A;  2ZC3 B;  2ZM8 A;  4OPZ A;  3IH9 A;  1ZKJ A;  1XKZ A;  5FI6 A;  4P6B A;  1AXB A;  5FQQ A;  2R9X A;  2B5R A;  1DJB A;  1IKG A;  1K38 A;  1SKF A;  5FQM A;  2ZQD A;  1PIO A;  2Y2H A;  4U0X A;  3RXW A;  1LI0 A;  1KE3 A;  3CZD A;  2HDQ A;  4DXC A;  3G2Z A;  4U0T A;  3IXH A;  3OZH A;  1E3U D;  1KGG A;  2H0Y A;  3CJM A;  1E4D A;  1JWP A;  3IF5 A;  2JC7 A;  4Y0O A;  3MFD A;  2ZQC A;  3SOI A;  1LLB A;  3QHY A;  4R23 A;  4WEL A;  4KZ4 A;  3ZGA B;  4EQI A;  3HL9 A;  2P9V B;  4M3K A;  3CG5 A;  1L0D A;  4P85 A;  4PM8 A;  1BSG A;  1L2S A;  3HVF A;  4FCF A;  4UAA A;  3UE1 A;  3G32 A;  1HTZ A;  1EI5 A;  3SH7 A;  1RP5 A;  2J8Y A;  3PBT A;  4DRT A;  1LL9 A;  3BM6 A;  1RGZ A;  3QNC A;  4JF4 A;  1WE4 A;  3MZE A;  4U3T A;  2V20 A;  3O86 A;  3DTM A;  3P98 A;  5A92 A;  5FAS A;  2WK0 A;  5JYP A;  5FAP A;  1MWR A;  4PMA A;  4UHU A;  3ITB A;  4E3M A;  2P9V A;  3G35 A;  3ZNY A;  1KE0 A;  3PAE A;  2XH9 A;  1MWT A;  3PBQ A;  1H5X A;  3N8S A;  5G18 A;  2J9P A;  1HZO A;  3FZC A;  1K56 A;  4FH4 A;  5CTN A;  4JF6 A;  5EVI B;  1W7F A;  2Y4A A;  2Q9N A;  4GD8 A;  5F82 A;  4YIN A;  3E2L A;  4R4R A;  5HW3 A;  4X56 A;  3V50 A;  3IWI A;  1PW1 A;  3GMW A;  5HX9 A;  4BL3 A;  1PWD A;  3MBZ A;  5FQJ A;  3HUM A;  3BLM A;  3VMA A;  4OKP A;  2RCX A;  1SHV A;  3IQA A;  3O3V A;  4E3L A;  4OOY A;  5CHJ A;  3A3I A;  1C3B A;  1FCO A;  2C6W B;  3C7V A;  3NI9 A;  3V5M A;  4Y7P A;  5CED A;  3P09 A;  4JBF A;  3IXD A;  4KZ3 A;  1BLP A;  1FSW A;  3TOI A;  4E3K A;  1YQS A;  1VM1 A;  4C75 A;  2XK1 A;  1MWU A;  5DF7 A;  4JLF A;  1ESI A;  4R3J A;  4B4X A;  2G2U A;  5F83 A;  1IEM A;  1M40 A;  3VFF A;  2VGK A;  1KVM A;  1K6R A;  2HP5 A;  1K55 A;  1K55 C;  1NYM A;  4KQR A;  3ZG7 B;  1Q2Q A;  2EX6 A;  4XXR A;  2GDN A;  3E2K A;  2ZQ8 A;  4KEN B;  1PI5 A;  4KQQ A;  5GLA A;  4JXW A;  5AQ7 A;  2QZ6 A;  3OC2 A;  2ZM2 A;  2ZD8 A;  5EVL A;  3V39 A;  4E6W A;  4MBH A;  4A5R A;  4PM6 A;  4D2O A;  3HLE A;  3RJU A;  1GA9 A;  4FH2 A;  3BFF A;  3FYZ A;  3Q1F A;  3PBR A;  5DTK A;  3WS1 A;  3ZFZ A;  4DDS A;  3OPR A;  3BEC A;  4B88 A;  4HBT A;  1I5Q A;  2CC1 A;  4RX2 A;  2V1Z A;  4DE2 A;  1IYS A;  1TDL A;  2EXB A;  2IWD A;  4EBP A;  4N1X A;  2ZC7 A;  3O88 A;  1PWG A;  4OON A;  4E3J A;  1ZG6 A;  1N4O A;  3GSG A;  4QU3 A;  1PWC A;  3HBR A;  3SS4 A;  1DJC A;  4QY5 A;  1K56 D;  2J9O A;  3ZNT A;  1IYP A;  1ERQ A;  3WWX A;  1PZO A;  2ZQ7 A;  3EQV A;  5AQB A;  4CPK A;  5CGX A;  2OV5 A;  3RXX A;  3G4P A;  3MXS A;  1PZP A;  3HRE A;  3QNB A;  1CEF A;  2ZMA A;  3MZD A;  4GOG A;  4KZB A;  1HVB A;  4KZ9 A;  5D3O A;  2QMI A;  5E2H A;  1KE4 A;  3OPP A;  1KDW A;  1LI9 A;  1YM1 A;  3EQU A;  4KZ7 A;  1K4E A;  3NDG A;  3S1Y A;  1FQG A;  4YFM A;  1W8Y A;  5HL1 A;  3IF6 A;  3IF6 C;  2Y2O A;  2EFU A;  1ONG A;  1OME A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...