5MC7A

Crystal structure of truncated human coatomer protein complex, subunit z1 (copz1)
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
139
structure length
139
Chain Sequence
TVKAILILDNDGDRLFAKYYDDTYPSVKEQKAFEKNIFNKTHRTDSEIALLEGLTVVYKSSIDLYFYVIGSSYENELMLMAVLNCLFDSLSQMLRKNVEKRALLENMEGLFLAVDEIVDGGVILESDPQQVVHRVALRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Coatomer subunit zeta-1
publication title Crystal structure of truncated human coatomer protein complex subunit zeta 1 (Cop zeta 1).
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 139
sequence length 139
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-11-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.60 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5mc7A00
3TJZC 2XA7S 1NRJA 5MC7A 4UQIS 2JKRI 2VGLS 4UQIM 2XA7M 2JKTI 1W63Q 2VGLM 1W63M 2HF6A 2JKRM 4P6ZS 2JKTM 2FH5A 4NEED 4P6ZM
chains in the Genus database with same CATH superfamily
4JXVA 2P9VB 4R4RA 4YOFA 5FQMA 3VSLA 1ONGA 4E3JA 1SCWA 2WGIA 1GSXA 1G6AA 1E3UD 3LI9A 2EFUA 4QHCA 3GR2A 4R70A 1W63M 4KG2A 1L3LA 2PT7A 3ZG9B 3SS3A 4EETB 4LPZA 2L0WA 3DTKA 1MBLA 1CEFA 2VLGA 3Q7VA 4BBVA 3UE3A 1LL8A 3MFXA 3N6IA 4S2NC 2WKIA 1OPXA 1LHYA 2EWWA 1UGUA 4GNUA 5A92A 4KZ5A 3IH8A 4KQDA 5CERA 4ME4A 3GDIA 3LFVA 3C4OA 4JBFA 1XJ2A 2ZD8A 4PAUA 4CQHA 5EECA 4R6LA 1S6RA 1HTZA 3HUMA 1FOFA 1DP9A 3RXXA 4DKIA 4I3IA 4LV3A 5FI7A 4WMCA 3ICYA 4EXOA 5E2GA 3S22A 4R23A 1IKGA 3OLOA 1TS0A 4X55A 5HAPA 3IX8A 4KZ9A 5I5LA 2DCFA 2ZQDA 1KE4A 2JN7A 4EUZA 5EE8A 4BWIA 2PR5A 4WF0A 3NECA 5FAPA 3F1OB 3OOVA 4K08A 4KUOA 1V9ZA 2XA7M 3MQQA 1YLJA 1FSYA 1TVFA 4L9FA 4HH2A 3VOZA 2W3DA 3GECA 5DF8A 3UE1A 3VFFA 4GD8A 5EVID 1VETB 4OQ0A 2Q9NA 2XF3A 3LIFA 4BBUA 4ZJ2A 1I2WA 4KZ4A 1LSVA 1I5QA 2JE5A 1BYWA 4E3LA 4WBGA 5F83A 3IXBA 3VP3A 3T1SA 3IF6A 4R3JA 4WZ5A 4WZ4A 4NXBA 3TSGA 3NDEA 2A2LA 4UEYA 5AQAA 4AFIA 5G4ZA 5BOHA 1W8QA 3TOIA 1K57A 1NYYA 3MXQA 4CLCB 4OONA 2VGLM 1W7FA 4JF5A 2WKEA 1MKMA 1XGIA 3Q7VB 4QPRA 2WKQA 5AQBA 5F1GA 1KVLA 3K3DA 3CJMA 3EWKA 3AGEA 3ZGAB 3V3RA 1M40A 3MKEA 3BW6A 1DP8A 3FYZA 2A3UA 2K7SA 2ZM0A 4JGRA 1K4EA 4QY6A 4PM5A 4HJ4A 5G4YA 2RCXA 4EW7A 5AVEA 4JGPA 1HVBA 1HLUP 4IJGA 1OTIA 2W1TB 2EA9A 2NUTC 2VKSA 4ZDXA 3LR4A 1GSVA 5CHUA 4O01A 1IYQA 5EOEA 4EBPA 4P0MA 4PPRA 2ZL1B 2JKGA 5CECA 1AWIA 2XLNA 3DBAA 4PKYG 3QNCA 1G28A 5FQQA 1K0KA 2B02A 5EPHA 4P87A 5JYPA 2Y4AA 1SZVA 4Y2FA 1IEMA 4EERA 2B95A 3CG5A 3ZHHA 4ETZA 5DFYA 2V8CA 1DJBA 3EGDC 3UPNA 2YKFA 3MXRA 5M18A 1PI5A 3MFDA 1E3UA 4BJPA 1BLCA 4WN5A 5EFWA 4KG6A 2EXAA 3PAGA 2GDNA 3C2WA 1WA9A 1YMSA 2PAVP 1OTAA 2HDQA 1TDGA 3MR0A 3M2JA 1Q2PA 3V39A 2W3EA 4X1LA 3CITA 4IHQA 5F82A 2XK1A 1PWCA 1IFQA 2VK3A 3PXPA 3LR5A 3C4PA 3MQ0A 3CHWP 5EVLA 4KQRA 1D1JA 3O87A 1RGYA 5TGFA 4ESPA 4D2OA 1MWTA 3U2AA 1S4SA 2Y2HA 3T50A 4MLLA 4GDNA 4UHUA 5HDDA 2X71A 3E98A 3VP4A 3M6HA 4I39A 2A24B 3QP6A 5HSQA 5J7EA 5L09A 4LRXC 4GHIA 3B47A 4FH4A 3IF6C 4KQQA 4Y0TA 4WZ5C 2V1ZA 2JKFA 5EOOA 4H6JA 1YT4A 4JF6A 3BFDA 2PYPA 4CJNA 1SKOA 2ZQ8A 1K57C 3IWIA 2QYBA 1V9YA 5EVIA 1MY8A 3A3JA 3PTEA 3B33A 1GHIA 2Y2IA 3LIAA 4EBLA 4ARZA 2Q9MA 3F1NB 2K2NA 2Y2QA 2EX9A 3AGDA 2VZWA 4F94A 5DF9A 5TJJA 4CLCD 2XA7S 3ZG7B 1NXYA 2FFFB 1DP6A 3G32A 2O99A 1NY0A 3O86A 1C3BA 5J3WA 1PYYA 4G3WA 1LI0A 4ZRRA 4OOLA 4E04A 3H7WA 5GHXA 4E3KA 1VEUA 1H8ZA 4QWOA 2ZQ7A 4GW9A 4RVAA 3BLSA 5FQIA 1EWZA 3BLMA 3MJQA 3DAVA 4QY5A 2V1BA 2GX5A 3N8SA 3BM6A 1RGZA 3Q1FA 2WADA 1Y4OA 1GA9A 1MXOA 4NKPA 4R3AA 4DRTA 3LIBA 5IU1A 4HBTA 4LV1A 1S66L 1IYSA 1FCMA 4OQHA 5AVFA 2VGLS 4BENA 4RYEA 5HD5A 2JBFA 3GMWA 1S0WA 4DJ2A 3TE8A 4ZTKA 3IH9A 1X0OA 2ZJ9A 1EW0A 3EEHA 1Q2QA 1VQQA 1ACFA 2XFTA 5MC7A 2P9VA 4C75A 4NXGA 3A3EA 4BD0A 1F5MA 4MBHA 3OZHA 1ODVA 4I3JA 2WGWB 1BLSA 4KZ7A 5HDSA 4OPRA 4FH2A 5FI2A 5LBRA 1JTDA 2GZAA 3RFBA 3UB6A 2V1AA 2GJ3A 2HJ9C 4R0QA 3GQZA 2W3FA 3T4KA 4MDZA 4FSFA 1H0MA 4Y5FA 5E2HA 4KQOA 2E8IA 3KO6A 3SZTA 3VOYA 3IHBA 2H5SA 3CAXA 4JGOA 2R9WA 2QWSA 3S7OA 3IXHA 3HLDA 3VFHA 4ZJ3A 1KE3A 3WRTA 2XEPA 5FI6A 1JWZA 3EOIA 3B3XA 3ZVTA 1N4OA 3NCKA 4MN6A 1FCOA 1W79A 2H10A 4FTXA 3IQAA 2XH9A 4PM7A 2D02A 2VV8A 3LEZA 1N9LA 3UE0A 5AQ9A 5EVIC 3CLOA 3A0RA 3D9YA 5CRFA 5GLBA 5A93A 3F1OA 4FD8A 1ZC2A 3HCYA 3HLWA 4UA6A 1ZG6A 2IA2A 2HGVA 4K0WA 3Q7ZA 1VETA 2G2UA 3IXGA 2H0TA 2C6WB 4RA7A 2Z2MB 3V50A 5IS1A 2EFXA 3O88A 1GSWA 4S2JA 1MZUA 3A3IA 4NK3A 5CHMA 2ZQCA 2Y55A 1EROA 5CTMA 4H8RA 4DE2A 3UPOA 3CMZA 3S7QA 1FSWA 3NOUC 3MQOA 4CLCA 1ZG4A 2WZZA 2ZMAA 4N9KA 2J7VA 2UV0E 3IS2B 1YKDA 4N1XA 2OAP1 5F68A 5CHJA 1W5DA 4EU0A 4GCZA 3SS4A 1XJ4A 3NJAA 2HDRA 3EQVA 5EVEA 1IYPA 2QKPA 2ZOHA 4MN7A 3UMEA 5M19A 1OJGA 2JC7A 3QHYA 2ZQAA 1MKIA 1K6RA 2VX8A 1JVJA 4BL3A 4S2KA 4Z9QA 3R7WB 1K54A 3DW0A 1BUEA 3TJZC 3K2NA 2PU4A 4M3KA 2W1TA 1ES2A 2WAEA 1G6OA 5J4EA 3G35A 5TBMB 3HREA 4X25A 3V5MA 4HJ3A 4OVDA 1FR6A 2JKRM 2XDMA 2ZL1A 5CXWA 5M1AA 3P7NA 4HJ6A 3E4QA 1WYBA 3KSHA 2G2WA 3DTMA 1UWNX 4GS9B 4FCFA 3WS2A 3UB5P 1TD5A 4WYYA 1KGGA 2Y59A 4GD6A 5F1FA 4E3OA 3HLBA 1VHMA 2W1RA 3PR6A 2VEAA 1M6KA 1ZKJA 4Y17A 3C7UA 3BY9A 3G31A 5FL3A 2J3WA 4M4XA 1SHVA 2VA0A 3OC2A 1MPLA 2JKRI 1OTDA 2HJEA 3M6BA 4II7A 4BLMA 3FV7A 3E0YA 1J9MA 1S1ZA 1L2SA 4LENA 2Z6DA 1KDSA 3BJNA 3LR3A 1TS7A 5E43A 5F5YA 4MBFA 3VOLA 3ZDJA 3OCNA 3MF0A 1ERMA 1PW8A 3PYPA 3MMHA 2XGNA 3I7JA 4KUKA 4MNRA 3BYDA 1OT9A 4ID4A 1CK3A 4WM9A 1CQAA 2FH5A 5TFQA 5A90A 1PZPA 3O3VA 5FASA 1PFLA 4X1MA 3QP5A 1E25A 2A24A 4S2LA 1NZOA 5E2EA 2JCHA 1K55A 2QPNA 4X6TA 3ZG0A 3GVBA 3ULFA 3RJUA 1CJFA 3IHAA 4I5SA 3NIAA 3SS5A 1CI8A 3ZNTA 1F9IA 3PAEA 3T4TA 3RXWA 1L0FA 4LV2A 4CLCC 1MWUA 2P08A 1K6SA 4EWFA 4JGQA 1KDWA 2FFYA 3GRJA 3KYQA 3BFFA 2HP9A 4Y7PA 3F1NA 4WL9A 1HD8A 4OQIA 4BBTA 2XROA 4OKPA 1YLZA 3G6OA 2J3TD 3S4XA 1ALQA 3FC7A 3GTCA 1XKZA 2Y2PA 3QP8A 2OLVA 1KGFA 1LLBA 2PD8A 1U60A 1O07A 5GLCA 1K54C 3HUOA 3BFGA 1H8YA 1OJ5A 4X69A 5DVAA 3DTIA 5HW3A 4FUWA 5FQJA 2INWA 3W4QA 2PBYA 4UQIM 1K38A 3QP2A 3VV4A 2W27A 2DRWA 4N92A 1ESIA 4N9LA 4U0TA 3EGXC 1E4DA 1S1YA 4Y13A 4IUKA 4KZBA 4YINA 1I2SA 2Y8HA 1G5UA 3WRZA 2XQZA 2B5RA 1BULA 1XJ3A 3EQUA 3LY3A 3V3SA 4S2PA 3P09A 4XUZA 4C6YA 3LCEA 4HEFA 1ESUA 1YSPA 4DMZA 3VMAA 2O9AA 5HWVA 1JNUA 1YM1A 3VSKA 3CUEA 3PBTA 4GB7A 4HH3A 3HLCA 2XRNA 3FKVA 4KZAA 4GZBA 3SH8A 3T4OA 2QHKA 4HBUA 3CI6A 3PBOA 2WKPA 2WGWA 1BLHA 3NY4A 4GJ4A 3UPPA 4C3QA 3TG9A 1A0KA 4P6ZM 1EI5A 1H5XA 3IWOA 3UB7A 4N1HA 5FEGA 3HL9A 2I9VA 1T18A 2JHEA 3GSGA 2NUPC 4EQIA 4KG5A 2Y2GA 1DJCA 2YKHA 3W4OA 2B18A 1DJAA 2OLUA 4IBXA 4Z1WA 1K55C 4EQ1A 1TEMA 3JVVA 4LLOB 5GLAA 1W8YA 1O7EA 1T1AA 3LICA 5G18A 5KZHA 1VM1A 2Z2LB 3KYEA 5L07A 3LEQA 1DY6A 1T19A 2V9AA 4HHDA 4Q0IA 2ZMFA 4E6WA 2OSUA 4O7DA 4OPYA 1PWGA 5HD3A 2BLSA 1SDEA 4ZJ1A 3W8KA 1OTEA 1YPRA 5FQ9A 1CEGA 4R4SA 3JYIA 3BECA 3OPPA 2KDKA 5EUAA 4ZAMA 2K31A 3JVUA 1YSQA 3OPRA 4R3BA 2L1MA 2OWJA 3LR0A 2QZ6A 2HZ5A 5DKKA 4DDSA 3IWQA 1L0EA 3N8RA 2ZC3B 2M7VA 5IT5A 2ZC7A 3UO9A 1F2KA 4L0LA 1LL9A 4B4XA 5KSCA 2PDRA 4Y3IA 4O8GA 2Z6CA 3B42A 2VGKA 1NZUA 4LRYC 4G3KA 5L8MA 2FZ0A 2Y2KA 2JKTM 2IWDA 2PR6A 3BFCA 1PW1A 3NHQA 2HP6A 1BT5A 3WS4A 3CWFA 3MZFA 1YLYA 2OAQ1 3S7NA 1TF1A 2X01A 2HPBA 2J80A 2IWBA 1CF0A 1XFNA 4OOMA 2PBDP 5L2FA 1YAXA 1K4FA 1OTBA 3G2YA 3N4IA 3IS2A 5HPIA 3KYZA 3GV9A 1PRQA 3UB8A 3SH7A 3A3FA 1Y54A 1FCNA 2WGVA 4LGWA 2RL3A 3L9KA 2BG1A 3ZG5A 3D72A 2JKTI 1UWPX 5HWTA 4Q0JA 4U3TA 3MBZA 3CUEC 3BWLA 2PHYA 4O0PA 3P98A 2P04A 4EEPA 4HP4A 3BEBA 3PBRA 4F3LB 3R7WA 5CGWA 4K0XA 4BMWA 3ZFZA 2D01A 4HI4A 5TBMA 5D3OA 4GLQA 3UDXA 4B9OA 1PNEA 4JXSA 3S1YA 2EWVA 3HUNA 4GN2A 4EEUA 4UA9A 1ES4A 5E2FA 1XPBA 1ZHHB 4GS9A 2HDUA 4S2IA 4KZ6A 3T1QB 2ZQ9A 2BTFP 4QD4A 1XA1A 4JPMA 5FA7A 1IYOA 4BL2A 1S4RA 1LSXA 2Y2NA 3LO7A 3VE3A 3VP2A 1QMFA 4B93A 2KX6A 1PIOA 3HLEA 3C8CA 1S67L 3N7WA 2G7UA 3H9WA 1Y28A 2HP5A 4XT2B 1D7EA 3LGOA 4R1GA 4KENB 5A8BA 2ZC6B 3MS6A 4LCMA 4X56A 1BSGA 2H28A 5FAQA 1N9BA 5F6AA 3S7PA 4NXEA 1XGJA 1TS6A 1N9OA 2E8JA 2O9BA 1MWRA 2DNSA 1LT0A 2XD1A 4KZ8A 5KMWA 1RP5A 2P7JA 4HESA 4P6ZS 4ETXA 1GCEA 2UWXA 4JXGA 1YLPA 3LY4A 3FKWA 2ZM8A 4YWZA 3NDGA 1FQGA 3CPTB 3VP0A 3E2LA 5I94A 1GA0A 2W3HA 4UA7A 1MWSA 1MC0A 3E2KA 3BQAA 3G2ZA 1HZOA 5FQKA 3F1PB 4EESA 5U47A 4IEDA 3WS5A 5TR7A 4I3AA 3TW8A 2LB9A 1T1BA 5FEFA 3Q81A 4JXWA 3FWLA 4BD1A 3Q07A 2J3TC 3OPLA 2I72A 1GHMA 4HNBA 4WELA 3H82A 4RX3A 3C5AA 1FILA 4HY8A 4PM9A 4G3VA 3ZNYA 4WLAA 1XP4A 2ZM2A 1AXBA 2A49A 3QP1A 3D4FA 2L4RA 3IT9A 4XUXA 4Q8IA 2Y2JA 1PZOA 2KLIA 1PI4A 3C30A 4OLDA 3SH9A 3W4PA 2VV6A 3P01A 5DKLA 2V2FF 3UE6A 1LSWA 4MN5A 3NBLA 1P9RA 4OQGA 1JWPA 2WKHA 5DTTA 3IBJA 3T4SA 3ITBA 2R9XA 3WS0A 3ZQ5A 1L0DA 5KIZA 2V0WA 5HZHA 4P6BA 2Y91A 3G30A 3NI9A 1KOUA 1XFQA 5HFOA 2H0YA 4RX2A 1NLZA 5DF7A 3FG8A 5IHVA 4Q0HA 2WAFA 1YLTA 5FDSA 3IBRA 3E4OA 3C38A 4IBRA 2OWHA 3WWXA 3BQ8A 4OOYA 3LIDA 5EM0A 3NOPC 2XD5A 3ISGA 3T4JA 2IWCA 5DTKA 4Y0OA 3UY6A 3MSHA 4HQAA 3BY8A 3PBNA 2AVXA 3EEAA 2CMNA 1XXMA 4HIAA 1OT6A 1K56D 3IXDA 5GL9A 1H8MA 3PHYA 3AGFA 3R4KA 1LI9A 2DMWA 3VP1A 5GLDA 5HX9A 1NRJA 4QB8A 2V0UA 2ACGA 4CPKA 2HF6A 2M1CA 2QJ7A 3QNBA 3H82B 4E6XA 4PM6A 3HLGA 4MEZA 3OBFA 4GOGA 1NLYA 2WZXA 1T1CA 2XR0A 2EX8A 2V20A 4EV4A 4HP9A 4E3NA 1NJ4A 1J3WA 5FATA 2O9CA 1YQSA 2XSSA 2PRFA 3UDIA 4X68A 3MZDA 4JF4A 5HAIA 3PBQA 5L10A 4L9GA 1YLWA 3FPWA 5CGSA 1P97A 1P0ZA 5A91A 2Y2MA 3N8LA 4PM8A 4LV0A 5KSHA 3TRCA 2M7UA 3W2ZA 2WYXA 3V67A 4E3MA 4NXFA 3T1RA 3HJKA 3RH8B 5JYOA 5CEDA 3ZG8B 3DWKA 1CI9A 1WYCA 4IUHA 3LIEA 3BRMA 3T1XA 2C5WB 3ZYTA 3IF6B 2VJWA 4I38A 4IVIA 4RQ9A 2OOLA 3ZCZA 5CEBA 1QMEA 2J9OA 4UAAA 4Y15A 3DWZA 1SDNA 3KX0X 1OMEA 1SKFA 3HBRA 1JWVA 3UMDA 1NYMA 4LRZE 4KZ3A 4X53A 2LB5A 1WE4A 2O0YA 2PYRA 1ZTUA 3LYXA 4DE1A 3IX3A 4XXRA 4S2OA 4EBNA 1BZAA 3HLFA 3HVFA 4QU3A 4F3LA 1P9WA 1VB6A 5HL6A 4A5RA 1D06A 3G4PA 4YNRA 3T4LA 1W63Q 3DTEA 5DTSA 4PKYA 5CGXA 4DXBA 4MMNA 2Q0OA 1LL5A 3CZDA 5F69A 3SW1A 4CLCE 2WUQA 1KGEA 2OV5A 2KOIA 1KE0A 4OLGA 2EX6A 3UDFA 4FOFA 1H3QA 2EX2A 3K3CA 2QMIA 2Y79A 4IVKA 1YMXA 1XA7A 3WS1A 5HPFA 5GHYA 2J9PA 3IF5A 1STZA 3UB9A 2BASA 2ZC5B 2PU2A 2W3GA 4MBKA 4WEKA 1N9NA 2ZOIA 4S2MA 3HJIA 2V8FA 1K56A 1TS8A 3LI8A 1L0GA 5CX7A 4Y0UA 3BFEA 4XT2A 1ES5A 4WMCD 1FIKA 5DFXA 4K91A 3ZVWA 3SOIA 4NEED 3KSGA 3ITAA 3KSFA 2P74A 4U0XA 4NG2A 4S2NA 4MCWA 1ERQA 3E4PA 3NC8A 3FZCA 5HAQA 2ZLYA 4OPZA 3JPUA 4WUJA 5DJUA 4WEJA 5CTNA 2WKRA 3A0VA 3NULA 3RTYA 1RCJA 3IX4A 1ONHA 4GHIB 2ZMVA 4JLFA 1K25A 4P85A 5FDHA 3CPTA 4ZBEA 4LCLA 3MKFA 1FR1A 1KVMA 5EM1A 2W0NA 3MZEA 1GHPA 4H6JB 4OPQA 4OP8A 4GDBA 4DE3A 1SKOB 3F1PA 3C7VA 1Z09A 3UNWA 1Z6FA 5EVIB 2PD7A 1BTLA 2WK0A 3A3DA 5DJTA 4B4ZA 5HDCA 4DN0A 4R38A 1ES3A 4ARZB 4E3IA 3U4LP 3QP4A 3LUQA 2VV7A 3NOTC 1F98A 4LFUA 1NWZA 1JTGA 2XFSA 1IELA 4UQIS 1IOUA 1TDLA 1XX2A 5HARA 2Y2OA 5HL1A 5J8XA 5GHZA 2GNXA 4YFMA 1XJ6A 2CC1A 3VE4A 4OP5A 5AQ7A 3H7WB 4DJ3A 4L9EA 3M2KA 1BLPA 3KSIA 4JKTA 4DDYA 2QJ5A 3FPVA 1VEUB 2Y2LA 4DE0A 2MJ6A 3UN7A 1NRFA 3OPHA 4PMAA 4B88A 5K5BA 3T4QA 3MXSA 3L7HA 4BQMA 3D3OA 4DF6A 5HWWA 3G34A 1DRMA 3A0SA 4D60A 3OCLA 1G68A 2ZBBA 2EXBA 1PWDA 2ZC4B 2HV1A 2R78A 3PBSA 2J8YA 3O5YA 5EV0A 2VGJA 2X02A 4NETA 2HDSA 5FSRA 4GKUA 3T12B 5AJGA 5C5KA 1IKIA 4HOIA 3Q82A 4QJGA 5FAOA 4DXCA 4PHTA 4OH0A 4EUVA
chains in the Genus database with same CATH topology
4HH3A 4YOFA 5MC7A 2XRNA 4NXGA 1GSXA 4HQAA 3BY8A 3T4OA 2QHKA 3LI9A 1F5MA 3PBNA 1ODVA 4I3JA 1W63M 4R70A 3EEAA 3CI6A 3PBOA 2WKPA 5HDSA 2PT7A 2CMNA 4HIAA 4LPZA 4EETB 1OT6A 2L0WA 4GJ4A 5LBRA 2VLGA 4BBVA 3UE3A 1LL8A 1H8MA 4P6ZM 3MFXA 3PHYA 3R4KA 2GZAA 3RFBA 1OPXA 2DMWA 2EWWA 3UB6A 1UGUA 2V1AA 2GJ3A 2HJ9C 1NRJA 2W3FA 3UB7A 2V0UA 3T4KA 4MDZA 4FSFA 4Y5FA 4KQOA 4KQDA 3KO6A 2I9VA 1T18A 2JHEA 4ME4A 3GDIA 3LFVA 2NUPC 2HF6A 1XJ2A 2M1CA 4PAUA 4CQHA 2QJ7A 3H82B 4R6LA 3CAXA 4JGOA 2YKHA 2QWSA 3OBFA 1DP9A 3S7OA 1NLYA 1T1CA 2B18A 4I3IA 3ICYA 4Z1WA 4EXOA 4HP9A 3OLOA 1TS0A 3EOIA 4EQ1A 2O9CA 3JVVA 2XSSA 4LLOB 5I5LA 4MN6A 1T1AA 3LICA 3PBQA 2D02A 2VV8A 1N9LA 2JN7A 4L9GA 3FPWA 1T19A 1P97A 1P0ZA 2V9AA 4HHDA 4BWIA 4Q0IA 2ZMFA 2PR5A 3CLOA 3A0RA 4WF0A 3F1OB 3OOVA 4K08A 4KUOA 5KSHA 3TRCA 5HD3A 3F1OA 2M7UA 1V9ZA 2XA7M 3W2ZA 3MQQA 3V67A 1OTEA 3HCYA 4L9FA 4NXFA 3HJKA 4HH2A 2W3DA 3GECA 3RH8B 2IA2A 2HGVA 2KDKA 2K31A 3JVUA 1YSQA 2L1MA 2OWJA 3LR0A 5DKKA 4BBUA 3LIFA 2M7VA 5IT5A 4IUHA 1LSVA 3LIEA 4L0LA 5IS1A 2PDRA 4Y3IA 1BYWA 4O8GA 1GSWA 2Z6CA 3ZYTA 3B42A 4LRYC 4G3KA 1MZUA 5L8MA 2FZ0A 2JKTM 4NXBA 2PR6A 2VJWA 4I38A 3NHQA 4RQ9A 2A2LA 4UEYA 4AFIA 2OOLA 3CWFA 2OAQ1 3S7NA 1TF1A 5G4ZA 2J80A 3S7QA 3MXQA 4CLCB 3NOUC 3MQOA 2VGLM 4CLCA 1XFNA 4OOMA 3KX0X 1YAXA 1MKMA 1OTBA 3IS2B 4QPRA 4EUVA 1YKDA 2WKQA 3IS2A 2OAP1 5HPIA 3KYZA 5F68A 3K3DA 3UB8A 3UMDA 3EWKA 4EU0A 4GCZA 1XJ4A 3BW6A 1DP8A 3NJAA 4LRZE 3EQVA 2LB5A 3D72A 2JKTI 2O0YA 1UWPX 2QKPA 5HWTA 2ZOHA 4MN7A 4Q0JA 2PYRA 1OJGA 1ZTUA 3UMEA 2K7SA 3LYXA 3CUEC 4JGRA 4HJ4A 3BWLA 2PHYA 4O0PA 5G4YA 2VX8A 2P04A 4EEPA 4EW7A 5AVEA 4JGPA 4HP4A 4IJGA 3PBRA 3R7WB 1OTIA 4F3LB 3R7WA 2W1TB 3TJZC 3K2NA 2EA9A 1P9WA 2NUTC 4F3LA 2VKSA 1VB6A 1GSVA 2W1TA 3LR4A 4O01A 5HL6A 1G6OA 5J4EA 1D06A 5TBMB 4BMWA 2D01A 4HI4A 4YNRA 5TBMA 3T4LA 1W63Q 4HJ3A 4GLQA 4PKYA 4B9OA 2JKRM 3P7NA 3DBAA 4MMNA 4HJ6A 3E4QA 4PKYG 1G28A 2EWVA 5F69A 3KSHA 4EEUA 3SW1A 4CLCE 2B02A 4GS9B 1UWNX 2KOIA 1ZHHB 4GS9A 4FOFA 1H3QA 1TD5A 3K3CA 4Y2FA 2Y79A 4EERA 1VHMA 2W1RA 3PR6A 2VEAA 4ETZA 5HPFA 5DFYA 3EGDC 2YKFA 3BY9A 1S4RA 1STZA 5FL3A 3UB9A 2BASA 1LSXA 4BJPA 3VE3A 4B93A 2W3GA 2J3WA 4M4XA 4WEKA 2KX6A 1N9NA 4WN5A 5EFWA 2ZOIA 3C8CA 2VA0A 3OC2A 1S67L 3C2WA 3HJIA 1WA9A 2G7UA 1TS8A 3LI8A 2JKRI 1OTDA 2HJEA 4II7A 1OTAA 3E0YA 5CX7A 3H9WA 1Y28A 4XT2B 1S1ZA 3MR0A 1D7EA 2Z6DA 3BJNA 4XT2A 3LR3A 1TS7A 5DFXA 2W3EA 5F5YA 5A8BA 3CITA 4IHQA 4NEED 2H28A 3VOLA 3KSGA 3OCNA 5F6AA 3S7PA 3MF0A 4NXEA 1IFQA 1TS6A 1N9OA 3KSFA 3PXPA 3LR5A 2O9BA 3MQ0A 3PYPA 3MMHA 1LT0A 4KUKA 4MCWA 3E4PA 1OT9A 2P7JA 3U2AA 1S4SA 4P6ZS 4ETXA 2FH5A 4WUJA 3T50A 5DJUA 4WEJA 2WKRA 3A0VA 5HDDA 3RTYA 3E98A 5HSQA 4I39A 5J7EA 2A24B 4YWZA 2A24A 2ZMVA 4GHIB 4LRXC 4GHIA 3B47A 2W3HA 3ULFA 1MC0A 3BQAA 4I5SA 2W0NA 4H6JB 4H6JA 1F9IA 3F1PB 4EESA 2PYPA 3F1PA 4I3AA 3T4TA 3TW8A 2LB9A 1T1BA 2PD7A 2QYBA 4CLCC 1V9YA 5DJTA 2P08A 5HDCA 4DN0A 4R38A 2J3TC 4JGQA 4ARZB 3B33A 3LIAA 4ARZA 4HNBA 4WELA 3KYQA 3H82A 3F1NB 2K2NA 3LUQA 2VV7A 3NOTC 3F1NA 4HY8A 1F98A 2VZWA 4G3VA 4WL9A 1NWZA 5DF9A 4BBTA 2XROA 5TJJA 4WLAA 4CLCD 2XA7S 4UQIS 1IOUA 1DP6A 3G6OA 2O99A 2J3TD 2L4RA 3FC7A 2GNXA 5J3WA 1XJ6A 4G3WA 4ZRRA 3VE4A 2PD8A 2KLIA 4OOLA 3C30A 3H7WB 4DJ3A 4L9EA 4E04A 3KSIA 3H7WA 2VV6A 3P01A 5DKLA 2QJ5A 3FPVA 3UE6A 1OJ5A 1LSWA 4MN5A 2MJ6A 1P9RA 2INWA 4GW9A 3IBJA 5K5BA 4UQIM 3T4QA 3D3OA 3T4SA 5HWWA 3VV4A 2W27A 3MJQA 1DRMA 3A0SA 3ZQ5A 5KIZA 2V0WA 5HZHA 3EGXC 1S1YA 2V1BA 1KOUA 2GX5A 4IUKA 3OCLA 1XFQA 2ZBBA 2HV1A 4NKPA 4R3AA 2R78A 1NLZA 3LIBA 3PBSA 5IU1A 2Y8HA 1S66L 3O5YA 3FG8A 5AVFA 4Q0HA 2VGLS 1XJ3A 5AJGA 3EQUA 5HD5A 3IBRA 5C5KA 4HOIA 3E4OA 3C38A 4DJ2A 2OWHA 3TE8A 3BQ8A 3LIDA 1YSPA 4DMZA 3NOPC 2O9AA 5HWVA 1JNUA 4PHTA 1X0OA 1EW0A 3CUEA 3PBTA 3EEHA 3T4JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TJZ C;  2XA7 S;  1NRJ A;  5MC7 A;  4UQI S;  2JKR I;  2VGL S;  4UQI M;  2XA7 M;  2JKT I;  1W63 Q;  2VGL M;  1W63 M;  2HF6 A;  2JKR M;  4P6Z S;  2JKT M;  2FH5 A;  4NEE D;  4P6Z M; 
#chains in the Genus database with same CATH topology
 4JXV A;  2P9V B;  4R4R A;  4YOF A;  5FQM A;  3VSL A;  1ONG A;  4E3J A;  1SCW A;  2WGI A;  1GSX A;  1G6A A;  1E3U D;  3LI9 A;  2EFU A;  4QHC A;  3GR2 A;  4R70 A;  1W63 M;  4KG2 A;  1L3L A;  2PT7 A;  3ZG9 B;  3SS3 A;  4EET B;  4LPZ A;  2L0W A;  3DTK A;  1MBL A;  1CEF A;  2VLG A;  3Q7V A;  4BBV A;  3UE3 A;  1LL8 A;  3MFX A;  3N6I A;  4S2N C;  2WKI A;  1OPX A;  1LHY A;  2EWW A;  1UGU A;  4GNU A;  5A92 A;  4KZ5 A;  3IH8 A;  4KQD A;  5CER A;  4ME4 A;  3GDI A;  3LFV A;  3C4O A;  4JBF A;  1XJ2 A;  2ZD8 A;  4PAU A;  4CQH A;  5EEC A;  4R6L A;  1S6R A;  1HTZ A;  3HUM A;  1FOF A;  1DP9 A;  3RXX A;  4DKI A;  4I3I A;  4LV3 A;  5FI7 A;  4WMC A;  3ICY A;  4EXO A;  5E2G A;  3S22 A;  4R23 A;  1IKG A;  3OLO A;  1TS0 A;  4X55 A;  5HAP A;  3IX8 A;  4KZ9 A;  5I5L A;  2DCF A;  2ZQD A;  1KE4 A;  2JN7 A;  4EUZ A;  5EE8 A;  4BWI A;  2PR5 A;  4WF0 A;  3NEC A;  5FAP A;  3F1O B;  3OOV A;  4K08 A;  4KUO A;  1V9Z A;  2XA7 M;  3MQQ A;  1YLJ A;  1FSY A;  1TVF A;  4L9F A;  4HH2 A;  3VOZ A;  2W3D A;  3GEC A;  5DF8 A;  3UE1 A;  3VFF A;  4GD8 A;  5EVI D;  1VET B;  4OQ0 A;  2Q9N A;  2XF3 A;  3LIF A;  4BBU A;  4ZJ2 A;  1I2W A;  4KZ4 A;  1LSV A;  1I5Q A;  2JE5 A;  1BYW A;  4E3L A;  4WBG A;  5F83 A;  3IXB A;  3VP3 A;  3T1S A;  3IF6 A;  4R3J A;  4WZ5 A;  4WZ4 A;  4NXB A;  3TSG A;  3NDE A;  2A2L A;  4UEY A;  5AQA A;  4AFI A;  5G4Z A;  5BOH A;  1W8Q A;  3TOI A;  1K57 A;  1NYY A;  3MXQ A;  4CLC B;  4OON A;  2VGL M;  1W7F A;  4JF5 A;  2WKE A;  1MKM A;  1XGI A;  3Q7V B;  4QPR A;  2WKQ A;  5AQB A;  5F1G A;  1KVL A;  3K3D A;  3CJM A;  3EWK A;  3AGE A;  3ZGA B;  3V3R A;  1M40 A;  3MKE A;  3BW6 A;  1DP8 A;  3FYZ A;  2A3U A;  2K7S A;  2ZM0 A;  4JGR A;  1K4E A;  4QY6 A;  4PM5 A;  4HJ4 A;  5G4Y A;  2RCX A;  4EW7 A;  5AVE A;  4JGP A;  1HVB A;  1HLU P;  4IJG A;  1OTI A;  2W1T B;  2EA9 A;  2NUT C;  2VKS A;  4ZDX A;  3LR4 A;  1GSV A;  5CHU A;  4O01 A;  1IYQ A;  5EOE A;  4EBP A;  4P0M A;  4PPR A;  2ZL1 B;  2JKG A;  5CEC A;  1AWI A;  2XLN A;  3DBA A;  4PKY G;  3QNC A;  1G28 A;  5FQQ A;  1K0K A;  2B02 A;  5EPH A;  4P87 A;  5JYP A;  2Y4A A;  1SZV A;  4Y2F A;  1IEM A;  4EER A;  2B95 A;  3CG5 A;  3ZHH A;  4ETZ A;  5DFY A;  2V8C A;  1DJB A;  3EGD C;  3UPN A;  2YKF A;  3MXR A;  5M18 A;  1PI5 A;  3MFD A;  1E3U A;  4BJP A;  1BLC A;  4WN5 A;  5EFW A;  4KG6 A;  2EXA A;  3PAG A;  2GDN A;  3C2W A;  1WA9 A;  1YMS A;  2PAV P;  1OTA A;  2HDQ A;  1TDG A;  3MR0 A;  3M2J A;  1Q2P A;  3V39 A;  2W3E A;  4X1L A;  3CIT A;  4IHQ A;  5F82 A;  2XK1 A;  1PWC A;  1IFQ A;  2VK3 A;  3PXP A;  3LR5 A;  3C4P A;  3MQ0 A;  3CHW P;  5EVL A;  4KQR A;  1D1J A;  3O87 A;  1RGY A;  5TGF A;  4ESP A;  4D2O A;  1MWT A;  3U2A A;  1S4S A;  2Y2H A;  3T50 A;  4MLL A;  4GDN A;  4UHU A;  5HDD A;  2X71 A;  3E98 A;  3VP4 A;  3M6H A;  4I39 A;  2A24 B;  3QP6 A;  5HSQ A;  5J7E A;  5L09 A;  4LRX C;  4GHI A;  3B47 A;  4FH4 A;  3IF6 C;  4KQQ A;  4Y0T A;  4WZ5 C;  2V1Z A;  2JKF A;  5EOO A;  4H6J A;  1YT4 A;  4JF6 A;  3BFD A;  2PYP A;  4CJN A;  1SKO A;  2ZQ8 A;  1K57 C;  3IWI A;  2QYB A;  1V9Y A;  5EVI A;  1MY8 A;  3A3J A;  3PTE A;  3B33 A;  1GHI A;  2Y2I A;  3LIA A;  4EBL A;  4ARZ A;  2Q9M A;  3F1N B;  2K2N A;  2Y2Q A;  2EX9 A;  3AGD A;  2VZW A;  4F94 A;  5DF9 A;  5TJJ A;  4CLC D;  2XA7 S;  3ZG7 B;  1NXY A;  2FFF B;  1DP6 A;  3G32 A;  2O99 A;  1NY0 A;  3O86 A;  1C3B A;  5J3W A;  1PYY A;  4G3W A;  1LI0 A;  4ZRR A;  4OOL A;  4E04 A;  3H7W A;  5GHX A;  4E3K A;  1VEU A;  1H8Z A;  4QWO A;  2ZQ7 A;  4GW9 A;  4RVA A;  3BLS A;  5FQI A;  1EWZ A;  3BLM A;  3MJQ A;  3DAV A;  4QY5 A;  2V1B A;  2GX5 A;  3N8S A;  3BM6 A;  1RGZ A;  3Q1F A;  2WAD A;  1Y4O A;  1GA9 A;  1MXO A;  4NKP A;  4R3A A;  4DRT A;  3LIB A;  5IU1 A;  4HBT A;  4LV1 A;  1S66 L;  1IYS A;  1FCM A;  4OQH A;  5AVF A;  2VGL S;  4BEN A;  4RYE A;  5HD5 A;  2JBF A;  3GMW A;  1S0W A;  4DJ2 A;  3TE8 A;  4ZTK A;  3IH9 A;  1X0O A;  2ZJ9 A;  1EW0 A;  3EEH A;  1Q2Q A;  1VQQ A;  1ACF A;  2XFT A;  5MC7 A;  2P9V A;  4C75 A;  4NXG A;  3A3E A;  4BD0 A;  1F5M A;  4MBH A;  3OZH A;  1ODV A;  4I3J A;  2WGW B;  1BLS A;  4KZ7 A;  5HDS A;  4OPR A;  4FH2 A;  5FI2 A;  5LBR A;  1JTD A;  2GZA A;  3RFB A;  3UB6 A;  2V1A A;  2GJ3 A;  2HJ9 C;  4R0Q A;  3GQZ A;  2W3F A;  3T4K A;  4MDZ A;  4FSF A;  1H0M A;  4Y5F A;  5E2H A;  4KQO A;  2E8I A;  3KO6 A;  3SZT A;  3VOY A;  3IHB A;  2H5S A;  3CAX A;  4JGO A;  2R9W A;  2QWS A;  3S7O A;  3IXH A;  3HLD A;  3VFH A;  4ZJ3 A;  1KE3 A;  3WRT A;  2XEP A;  5FI6 A;  1JWZ A;  3EOI A;  3B3X A;  3ZVT A;  1N4O A;  3NCK A;  4MN6 A;  1FCO A;  1W79 A;  2H10 A;  4FTX A;  3IQA A;  2XH9 A;  4PM7 A;  2D02 A;  2VV8 A;  3LEZ A;  1N9L A;  3UE0 A;  5AQ9 A;  5EVI C;  3CLO A;  3A0R A;  3D9Y A;  5CRF A;  5GLB A;  5A93 A;  3F1O A;  4FD8 A;  1ZC2 A;  3HCY A;  3HLW A;  4UA6 A;  1ZG6 A;  2IA2 A;  2HGV A;  4K0W A;  3Q7Z A;  1VET A;  2G2U A;  3IXG A;  2H0T A;  2C6W B;  4RA7 A;  2Z2M B;  3V50 A;  5IS1 A;  2EFX A;  3O88 A;  1GSW A;  4S2J A;  1MZU A;  3A3I A;  4NK3 A;  5CHM A;  2ZQC A;  2Y55 A;  1ERO A;  5CTM A;  4H8R A;  4DE2 A;  3UPO A;  3CMZ A;  3S7Q A;  1FSW A;  3NOU C;  3MQO A;  4CLC A;  1ZG4 A;  2WZZ A;  2ZMA A;  4N9K A;  2J7V A;  2UV0 E;  3IS2 B;  1YKD A;  4N1X A;  2OAP 1;  5F68 A;  5CHJ A;  1W5D A;  4EU0 A;  4GCZ A;  3SS4 A;  1XJ4 A;  3NJA A;  2HDR A;  3EQV A;  5EVE A;  1IYP A;  2QKP A;  2ZOH A;  4MN7 A;  3UME A;  5M19 A;  1OJG A;  2JC7 A;  3QHY A;  2ZQA A;  1MKI A;  1K6R A;  2VX8 A;  1JVJ A;  4BL3 A;  4S2K A;  4Z9Q A;  3R7W B;  1K54 A;  3DW0 A;  1BUE A;  3TJZ C;  3K2N A;  2PU4 A;  4M3K A;  2W1T A;  1ES2 A;  2WAE A;  1G6O A;  5J4E A;  3G35 A;  5TBM B;  3HRE A;  4X25 A;  3V5M A;  4HJ3 A;  4OVD A;  1FR6 A;  2JKR M;  2XDM A;  2ZL1 A;  5CXW A;  5M1A A;  3P7N A;  4HJ6 A;  3E4Q A;  1WYB A;  3KSH A;  2G2W A;  3DTM A;  1UWN X;  4GS9 B;  4FCF A;  3WS2 A;  3UB5 P;  1TD5 A;  4WYY A;  1KGG A;  2Y59 A;  4GD6 A;  5F1F A;  4E3O A;  3HLB A;  1VHM A;  2W1R A;  3PR6 A;  2VEA A;  1M6K A;  1ZKJ A;  4Y17 A;  3C7U A;  3BY9 A;  3G31 A;  5FL3 A;  2J3W A;  4M4X A;  1SHV A;  2VA0 A;  3OC2 A;  1MPL A;  2JKR I;  1OTD A;  2HJE A;  3M6B A;  4II7 A;  4BLM A;  3FV7 A;  3E0Y A;  1J9M A;  1S1Z A;  1L2S A;  4LEN A;  2Z6D A;  1KDS A;  3BJN A;  3LR3 A;  1TS7 A;  5E43 A;  5F5Y A;  4MBF A;  3VOL A;  3ZDJ A;  3OCN A;  3MF0 A;  1ERM A;  1PW8 A;  3PYP A;  3MMH A;  2XGN A;  3I7J A;  4KUK A;  4MNR A;  3BYD A;  1OT9 A;  4ID4 A;  1CK3 A;  4WM9 A;  1CQA A;  2FH5 A;  5TFQ A;  5A90 A;  1PZP A;  3O3V A;  5FAS A;  1PFL A;  4X1M A;  3QP5 A;  1E25 A;  2A24 A;  4S2L A;  1NZO A;  5E2E A;  2JCH A;  1K55 A;  2QPN A;  4X6T A;  3ZG0 A;  3GVB A;  3ULF A;  3RJU A;  1CJF A;  3IHA A;  4I5S A;  3NIA A;  3SS5 A;  1CI8 A;  3ZNT A;  1F9I A;  3PAE A;  3T4T A;  3RXW A;  1L0F A;  4LV2 A;  4CLC C;  1MWU A;  2P08 A;  1K6S A;  4EWF A;  4JGQ A;  1KDW A;  2FFY A;  3GRJ A;  3KYQ A;  3BFF A;  2HP9 A;  4Y7P A;  3F1N A;  4WL9 A;  1HD8 A;  4OQI A;  4BBT A;  2XRO A;  4OKP A;  1YLZ A;  3G6O A;  2J3T D;  3S4X A;  1ALQ A;  3FC7 A;  3GTC A;  1XKZ A;  2Y2P A;  3QP8 A;  2OLV A;  1KGF A;  1LLB A;  2PD8 A;  1U60 A;  1O07 A;  5GLC A;  1K54 C;  3HUO A;  3BFG A;  1H8Y A;  1OJ5 A;  4X69 A;  5DVA A;  3DTI A;  5HW3 A;  4FUW A;  5FQJ A;  2INW A;  3W4Q A;  2PBY A;  4UQI M;  1K38 A;  3QP2 A;  3VV4 A;  2W27 A;  2DRW A;  4N92 A;  1ESI A;  4N9L A;  4U0T A;  3EGX C;  1E4D A;  1S1Y A;  4Y13 A;  4IUK A;  4KZB A;  4YIN A;  1I2S A;  2Y8H A;  1G5U A;  3WRZ A;  2XQZ A;  2B5R A;  1BUL A;  1XJ3 A;  3EQU A;  3LY3 A;  3V3S A;  4S2P A;  3P09 A;  4XUZ A;  4C6Y A;  3LCE A;  4HEF A;  1ESU A;  1YSP A;  4DMZ A;  3VMA A;  2O9A A;  5HWV A;  1JNU A;  1YM1 A;  3VSK A;  3CUE A;  3PBT A;  4GB7 A;  4HH3 A;  3HLC A;  2XRN A;  3FKV A;  4KZA A;  4GZB A;  3SH8 A;  3T4O A;  2QHK A;  4HBU A;  3CI6 A;  3PBO A;  2WKP A;  2WGW A;  1BLH A;  3NY4 A;  4GJ4 A;  3UPP A;  4C3Q A;  3TG9 A;  1A0K A;  4P6Z M;  1EI5 A;  1H5X A;  3IWO A;  3UB7 A;  4N1H A;  5FEG A;  3HL9 A;  2I9V A;  1T18 A;  2JHE A;  3GSG A;  2NUP C;  4EQI A;  4KG5 A;  2Y2G A;  1DJC A;  2YKH A;  3W4O A;  2B18 A;  1DJA A;  2OLU A;  4IBX A;  4Z1W A;  1K55 C;  4EQ1 A;  1TEM A;  3JVV A;  4LLO B;  5GLA A;  1W8Y A;  1O7E A;  1T1A A;  3LIC A;  5G18 A;  5KZH A;  1VM1 A;  2Z2L B;  3KYE A;  5L07 A;  3LEQ A;  1DY6 A;  1T19 A;  2V9A A;  4HHD A;  4Q0I A;  2ZMF A;  4E6W A;  2OSU A;  4O7D A;  4OPY A;  1PWG A;  5HD3 A;  2BLS A;  1SDE A;  4ZJ1 A;  3W8K A;  1OTE A;  1YPR A;  5FQ9 A;  1CEG A;  4R4S A;  3JYI A;  3BEC A;  3OPP A;  2KDK A;  5EUA A;  4ZAM A;  2K31 A;  3JVU A;  1YSQ A;  3OPR A;  4R3B A;  2L1M A;  2OWJ A;  3LR0 A;  2QZ6 A;  2HZ5 A;  5DKK A;  4DDS A;  3IWQ A;  1L0E A;  3N8R A;  2ZC3 B;  2M7V A;  5IT5 A;  2ZC7 A;  3UO9 A;  1F2K A;  4L0L A;  1LL9 A;  4B4X A;  5KSC A;  2PDR A;  4Y3I A;  4O8G A;  2Z6C A;  3B42 A;  2VGK A;  1NZU A;  4LRY C;  4G3K A;  5L8M A;  2FZ0 A;  2Y2K A;  2JKT M;  2IWD A;  2PR6 A;  3BFC A;  1PW1 A;  3NHQ A;  2HP6 A;  1BT5 A;  3WS4 A;  3CWF A;  3MZF A;  1YLY A;  2OAQ 1;  3S7N A;  1TF1 A;  2X01 A;  2HPB A;  2J80 A;  2IWB A;  1CF0 A;  1XFN A;  4OOM A;  2PBD P;  5L2F A;  1YAX A;  1K4F A;  1OTB A;  3G2Y A;  3N4I A;  3IS2 A;  5HPI A;  3KYZ A;  3GV9 A;  1PRQ A;  3UB8 A;  3SH7 A;  3A3F A;  1Y54 A;  1FCN A;  2WGV A;  4LGW A;  2RL3 A;  3L9K A;  2BG1 A;  3ZG5 A;  3D72 A;  2JKT I;  1UWP X;  5HWT A;  4Q0J A;  4U3T A;  3MBZ A;  3CUE C;  3BWL A;  2PHY A;  4O0P A;  3P98 A;  2P04 A;  4EEP A;  4HP4 A;  3BEB A;  3PBR A;  4F3L B;  3R7W A;  5CGW A;  4K0X A;  4BMW A;  3ZFZ A;  2D01 A;  4HI4 A;  5TBM A;  5D3O A;  4GLQ A;  3UDX A;  4B9O A;  1PNE A;  4JXS A;  3S1Y A;  2EWV A;  3HUN A;  4GN2 A;  4EEU A;  4UA9 A;  1ES4 A;  5E2F A;  1XPB A;  1ZHH B;  4GS9 A;  2HDU A;  4S2I A;  4KZ6 A;  3T1Q B;  2ZQ9 A;  2BTF P;  4QD4 A;  1XA1 A;  4JPM A;  5FA7 A;  1IYO A;  4BL2 A;  1S4R A;  1LSX A;  2Y2N A;  3LO7 A;  3VE3 A;  3VP2 A;  1QMF A;  4B93 A;  2KX6 A;  1PIO A;  3HLE A;  3C8C A;  1S67 L;  3N7W A;  2G7U A;  3H9W A;  1Y28 A;  2HP5 A;  4XT2 B;  1D7E A;  3LGO A;  4R1G A;  4KEN B;  5A8B A;  2ZC6 B;  3MS6 A;  4LCM A;  4X56 A;  1BSG A;  2H28 A;  5FAQ A;  1N9B A;  5F6A A;  3S7P A;  4NXE A;  1XGJ A;  1TS6 A;  1N9O A;  2E8J A;  2O9B A;  1MWR A;  2DNS A;  1LT0 A;  2XD1 A;  4KZ8 A;  5KMW A;  1RP5 A;  2P7J A;  4HES A;  4P6Z S;  4ETX A;  1GCE A;  2UWX A;  4JXG A;  1YLP A;  3LY4 A;  3FKW A;  2ZM8 A;  4YWZ A;  3NDG A;  1FQG A;  3CPT B;  3VP0 A;  3E2L A;  5I94 A;  1GA0 A;  2W3H A;  4UA7 A;  1MWS A;  1MC0 A;  3E2K A;  3BQA A;  3G2Z A;  1HZO A;  5FQK A;  3F1P B;  4EES A;  5U47 A;  4IED A;  3WS5 A;  5TR7 A;  4I3A A;  3TW8 A;  2LB9 A;  1T1B A;  5FEF A;  3Q81 A;  4JXW A;  3FWL A;  4BD1 A;  3Q07 A;  2J3T C;  3OPL A;  2I72 A;  1GHM A;  4HNB A;  4WEL A;  3H82 A;  4RX3 A;  3C5A A;  1FIL A;  4HY8 A;  4PM9 A;  4G3V A;  3ZNY A;  4WLA A;  1XP4 A;  2ZM2 A;  1AXB A;  2A49 A;  3QP1 A;  3D4F A;  2L4R A;  3IT9 A;  4XUX A;  4Q8I A;  2Y2J A;  1PZO A;  2KLI A;  1PI4 A;  3C30 A;  4OLD A;  3SH9 A;  3W4P A;  2VV6 A;  3P01 A;  5DKL A;  2V2F F;  3UE6 A;  1LSW A;  4MN5 A;  3NBL A;  1P9R A;  4OQG A;  1JWP A;  2WKH A;  5DTT A;  3IBJ A;  3T4S A;  3ITB A;  2R9X A;  3WS0 A;  3ZQ5 A;  1L0D A;  5KIZ A;  2V0W A;  5HZH A;  4P6B A;  2Y91 A;  3G30 A;  3NI9 A;  1KOU A;  1XFQ A;  5HFO A;  2H0Y A;  4RX2 A;  1NLZ A;  5DF7 A;  3FG8 A;  5IHV A;  4Q0H A;  2WAF A;  1YLT A;  5FDS A;  3IBR A;  3E4O A;  3C38 A;  4IBR A;  2OWH A;  3WWX A;  3BQ8 A;  4OOY A;  3LID A;  5EM0 A;  3NOP C;  2XD5 A;  3ISG A;  3T4J A;  2IWC A;  5DTK A;  4Y0O A;  3UY6 A;  3MSH A;  4HQA A;  3BY8 A;  3PBN A;  2AVX A;  3EEA A;  2CMN A;  1XXM A;  4HIA A;  1OT6 A;  1K56 D;  3IXD A;  5GL9 A;  1H8M A;  3PHY A;  3AGF A;  3R4K A;  1LI9 A;  2DMW A;  3VP1 A;  5GLD A;  5HX9 A;  1NRJ A;  4QB8 A;  2V0U A;  2ACG A;  4CPK A;  2HF6 A;  2M1C A;  2QJ7 A;  3QNB A;  3H82 B;  4E6X A;  4PM6 A;  3HLG A;  4MEZ A;  3OBF A;  4GOG A;  1NLY A;  2WZX A;  1T1C A;  2XR0 A;  2EX8 A;  2V20 A;  4EV4 A;  4HP9 A;  4E3N A;  1NJ4 A;  1J3W A;  5FAT A;  2O9C A;  1YQS A;  2XSS A;  2PRF A;  3UDI A;  4X68 A;  3MZD A;  4JF4 A;  5HAI A;  3PBQ A;  5L10 A;  4L9G A;  1YLW A;  3FPW A;  5CGS A;  1P97 A;  1P0Z A;  5A91 A;  2Y2M A;  3N8L A;  4PM8 A;  4LV0 A;  5KSH A;  3TRC A;  2M7U A;  3W2Z A;  2WYX A;  3V67 A;  4E3M A;  4NXF A;  3T1R A;  3HJK A;  3RH8 B;  5JYO A;  5CED A;  3ZG8 B;  3DWK A;  1CI9 A;  1WYC A;  4IUH A;  3LIE A;  3BRM A;  3T1X A;  2C5W B;  3ZYT A;  3IF6 B;  2VJW A;  4I38 A;  4IVI A;  4RQ9 A;  2OOL A;  3ZCZ A;  5CEB A;  1QME A;  2J9O A;  4UAA A;  4Y15 A;  3DWZ A;  1SDN A;  3KX0 X;  1OME A;  1SKF A;  3HBR A;  1JWV A;  3UMD A;  1NYM A;  4LRZ E;  4KZ3 A;  4X53 A;  2LB5 A;  1WE4 A;  2O0Y A;  2PYR A;  1ZTU A;  3LYX A;  4DE1 A;  3IX3 A;  4XXR A;  4S2O A;  4EBN A;  1BZA A;  3HLF A;  3HVF A;  4QU3 A;  4F3L A;  1P9W A;  1VB6 A;  5HL6 A;  4A5R A;  1D06 A;  3G4P A;  4YNR A;  3T4L A;  1W63 Q;  3DTE A;  5DTS A;  4PKY A;  5CGX A;  4DXB A;  4MMN A;  2Q0O A;  1LL5 A;  3CZD A;  5F69 A;  3SW1 A;  4CLC E;  2WUQ A;  1KGE A;  2OV5 A;  2KOI A;  1KE0 A;  4OLG A;  2EX6 A;  3UDF A;  4FOF A;  1H3Q A;  2EX2 A;  3K3C A;  2QMI A;  2Y79 A;  4IVK A;  1YMX A;  1XA7 A;  3WS1 A;  5HPF A;  5GHY A;  2J9P A;  3IF5 A;  1STZ A;  3UB9 A;  2BAS A;  2ZC5 B;  2PU2 A;  2W3G A;  4MBK A;  4WEK A;  1N9N A;  2ZOI A;  4S2M A;  3HJI A;  2V8F A;  1K56 A;  1TS8 A;  3LI8 A;  1L0G A;  5CX7 A;  4Y0U A;  3BFE A;  4XT2 A;  1ES5 A;  4WMC D;  1FIK A;  5DFX A;  4K91 A;  3ZVW A;  3SOI A;  4NEE D;  3KSG A;  3ITA A;  3KSF A;  2P74 A;  4U0X A;  4NG2 A;  4S2N A;  4MCW A;  1ERQ A;  3E4P A;  3NC8 A;  3FZC A;  5HAQ A;  2ZLY A;  4OPZ A;  3JPU A;  4WUJ A;  5DJU A;  4WEJ A;  5CTN A;  2WKR A;  3A0V A;  3NUL A;  3RTY A;  1RCJ A;  3IX4 A;  1ONH A;  4GHI B;  2ZMV A;  4JLF A;  1K25 A;  4P85 A;  5FDH A;  3CPT A;  4ZBE A;  4LCL A;  3MKF A;  1FR1 A;  1KVM A;  5EM1 A;  2W0N A;  3MZE A;  1GHP A;  4H6J B;  4OPQ A;  4OP8 A;  4GDB A;  4DE3 A;  1SKO B;  3F1P A;  3C7V A;  1Z09 A;  3UNW A;  1Z6F A;  5EVI B;  2PD7 A;  1BTL A;  2WK0 A;  3A3D A;  5DJT A;  4B4Z A;  5HDC A;  4DN0 A;  4R38 A;  1ES3 A;  4ARZ B;  4E3I A;  3U4L P;  3QP4 A;  3LUQ A;  2VV7 A;  3NOT C;  1F98 A;  4LFU A;  1NWZ A;  1JTG A;  2XFS A;  1IEL A;  4UQI S;  1IOU A;  1TDL A;  1XX2 A;  5HAR A;  2Y2O A;  5HL1 A;  5J8X A;  5GHZ A;  2GNX A;  4YFM A;  1XJ6 A;  2CC1 A;  3VE4 A;  4OP5 A;  5AQ7 A;  3H7W B;  4DJ3 A;  4L9E A;  3M2K A;  1BLP A;  3KSI A;  4JKT A;  4DDY A;  2QJ5 A;  3FPV A;  1VEU B;  2Y2L A;  4DE0 A;  2MJ6 A;  3UN7 A;  1NRF A;  3OPH A;  4PMA A;  4B88 A;  5K5B A;  3T4Q A;  3MXS A;  3L7H A;  4BQM A;  3D3O A;  4DF6 A;  5HWW A;  3G34 A;  1DRM A;  3A0S A;  4D60 A;  3OCL A;  1G68 A;  2ZBB A;  2EXB A;  1PWD A;  2ZC4 B;  2HV1 A;  2R78 A;  3PBS A;  2J8Y A;  3O5Y A;  5EV0 A;  2VGJ A;  2X02 A;  4NET A;  2HDS A;  5FSR A;  4GKU A;  3T12 B;  5AJG A;  5C5K A;  1IKI A;  4HOI A;  3Q82 A;  4QJG A;  5FAO A;  4DXC A;  4PHT A;  4OH0 A;  4EUV A; 
#chains in the Genus database with same CATH homology
 4HH3 A;  4YOF A;  5MC7 A;  2XRN A;  4NXG A;  1GSX A;  4HQA A;  3BY8 A;  3T4O A;  2QHK A;  3LI9 A;  1F5M A;  3PBN A;  1ODV A;  4I3J A;  1W63 M;  4R70 A;  3EEA A;  3CI6 A;  3PBO A;  2WKP A;  5HDS A;  2PT7 A;  2CMN A;  4HIA A;  4LPZ A;  4EET B;  1OT6 A;  2L0W A;  4GJ4 A;  5LBR A;  2VLG A;  4BBV A;  3UE3 A;  1LL8 A;  1H8M A;  4P6Z M;  3MFX A;  3PHY A;  3R4K A;  2GZA A;  3RFB A;  1OPX A;  2DMW A;  2EWW A;  3UB6 A;  1UGU A;  2V1A A;  2GJ3 A;  2HJ9 C;  1NRJ A;  2W3F A;  3UB7 A;  2V0U A;  3T4K A;  4MDZ A;  4FSF A;  4Y5F A;  4KQO A;  4KQD A;  3KO6 A;  2I9V A;  1T18 A;  2JHE A;  4ME4 A;  3GDI A;  3LFV A;  2NUP C;  2HF6 A;  1XJ2 A;  2M1C A;  4PAU A;  4CQH A;  2QJ7 A;  3H82 B;  4R6L A;  3CAX A;  4JGO A;  2YKH A;  2QWS A;  3OBF A;  1DP9 A;  3S7O A;  1NLY A;  1T1C A;  2B18 A;  4I3I A;  3ICY A;  4Z1W A;  4EXO A;  4HP9 A;  3OLO A;  1TS0 A;  3EOI A;  4EQ1 A;  2O9C A;  3JVV A;  2XSS A;  4LLO B;  5I5L A;  4MN6 A;  1T1A A;  3LIC A;  3PBQ A;  2D02 A;  2VV8 A;  1N9L A;  2JN7 A;  4L9G A;  3FPW A;  1T19 A;  1P97 A;  1P0Z A;  2V9A A;  4HHD A;  4BWI A;  4Q0I A;  2ZMF A;  2PR5 A;  3CLO A;  3A0R A;  4WF0 A;  3F1O B;  3OOV A;  4K08 A;  4KUO A;  5KSH A;  3TRC A;  5HD3 A;  3F1O A;  2M7U A;  1V9Z A;  2XA7 M;  3W2Z A;  3MQQ A;  3V67 A;  1OTE A;  3HCY A;  4L9F A;  4NXF A;  3HJK A;  4HH2 A;  2W3D A;  3GEC A;  3RH8 B;  2IA2 A;  2HGV A;  2KDK A;  2K31 A;  3JVU A;  1YSQ A;  2L1M A;  2OWJ A;  3LR0 A;  5DKK A;  4BBU A;  3LIF A;  2M7V A;  5IT5 A;  4IUH A;  1LSV A;  3LIE A;  4L0L A;  5IS1 A;  2PDR A;  4Y3I A;  1BYW A;  4O8G A;  1GSW A;  2Z6C A;  3ZYT A;  3B42 A;  4LRY C;  4G3K A;  1MZU A;  5L8M A;  2FZ0 A;  2JKT M;  4NXB A;  2PR6 A;  2VJW A;  4I38 A;  3NHQ A;  4RQ9 A;  2A2L A;  4UEY A;  4AFI A;  2OOL A;  3CWF A;  2OAQ 1;  3S7N A;  1TF1 A;  5G4Z A;  2J80 A;  3S7Q A;  3MXQ A;  4CLC B;  3NOU C;  3MQO A;  2VGL M;  4CLC A;  1XFN A;  4OOM A;  3KX0 X;  1YAX A;  1MKM A;  1OTB A;  3IS2 B;  4QPR A;  4EUV A;  1YKD A;  2WKQ A;  3IS2 A;  2OAP 1;  5HPI A;  3KYZ A;  5F68 A;  3K3D A;  3UB8 A;  3UMD A;  3EWK A;  4EU0 A;  4GCZ A;  1XJ4 A;  3BW6 A;  1DP8 A;  3NJA A;  4LRZ E;  3EQV A;  2LB5 A;  3D72 A;  2JKT I;  2O0Y A;  1UWP X;  2QKP A;  5HWT A;  2ZOH A;  4MN7 A;  4Q0J A;  2PYR A;  1OJG A;  1ZTU A;  3UME A;  2K7S A;  3LYX A;  3CUE C;  4JGR A;  4HJ4 A;  3BWL A;  2PHY A;  4O0P A;  5G4Y A;  2VX8 A;  2P04 A;  4EEP A;  4EW7 A;  5AVE A;  4JGP A;  4HP4 A;  4IJG A;  3PBR A;  3R7W B;  1OTI A;  4F3L B;  3R7W A;  2W1T B;  3TJZ C;  3K2N A;  2EA9 A;  1P9W A;  2NUT C;  4F3L A;  2VKS A;  1VB6 A;  1GSV A;  2W1T A;  3LR4 A;  4O01 A;  5HL6 A;  1G6O A;  5J4E A;  1D06 A;  5TBM B;  4BMW A;  2D01 A;  4HI4 A;  4YNR A;  5TBM A;  3T4L A;  1W63 Q;  4HJ3 A;  4GLQ A;  4PKY A;  4B9O A;  2JKR M;  3P7N A;  3DBA A;  4MMN A;  4HJ6 A;  3E4Q A;  4PKY G;  1G28 A;  2EWV A;  5F69 A;  3KSH A;  4EEU A;  3SW1 A;  4CLC E;  2B02 A;  4GS9 B;  1UWN X;  2KOI A;  1ZHH B;  4GS9 A;  4FOF A;  1H3Q A;  1TD5 A;  3K3C A;  4Y2F A;  2Y79 A;  4EER A;  1VHM A;  2W1R A;  3PR6 A;  2VEA A;  4ETZ A;  5HPF A;  5DFY A;  3EGD C;  2YKF A;  3BY9 A;  1S4R A;  1STZ A;  5FL3 A;  3UB9 A;  2BAS A;  1LSX A;  4BJP A;  3VE3 A;  4B93 A;  2W3G A;  2J3W A;  4M4X A;  4WEK A;  2KX6 A;  1N9N A;  4WN5 A;  5EFW A;  2ZOI A;  3C8C A;  2VA0 A;  3OC2 A;  1S67 L;  3C2W A;  3HJI A;  1WA9 A;  2G7U A;  1TS8 A;  3LI8 A;  2JKR I;  1OTD A;  2HJE A;  4II7 A;  1OTA A;  3E0Y A;  5CX7 A;  3H9W A;  1Y28 A;  4XT2 B;  1S1Z A;  3MR0 A;  1D7E A;  2Z6D A;  3BJN A;  4XT2 A;  3LR3 A;  1TS7 A;  5DFX A;  2W3E A;  5F5Y A;  5A8B A;  3CIT A;  4IHQ A;  4NEE D;  2H28 A;  3VOL A;  3KSG A;  3OCN A;  5F6A A;  3S7P A;  3MF0 A;  4NXE A;  1IFQ A;  1TS6 A;  1N9O A;  3KSF A;  3PXP A;  3LR5 A;  2O9B A;  3MQ0 A;  3PYP A;  3MMH A;  1LT0 A;  4KUK A;  4MCW A;  3E4P A;  1OT9 A;  2P7J A;  3U2A A;  1S4S A;  4P6Z S;  4ETX A;  2FH5 A;  4WUJ A;  3T50 A;  5DJU A;  4WEJ A;  2WKR A;  3A0V A;  5HDD A;  3RTY A;  3E98 A;  5HSQ A;  4I39 A;  5J7E A;  2A24 B;  4YWZ A;  2A24 A;  2ZMV A;  4GHI B;  4LRX C;  4GHI A;  3B47 A;  2W3H A;  3ULF A;  1MC0 A;  3BQA A;  4I5S A;  2W0N A;  4H6J B;  4H6J A;  1F9I A;  3F1P B;  4EES A;  2PYP A;  3F1P A;  4I3A A;  3T4T A;  3TW8 A;  2LB9 A;  1T1B A;  2PD7 A;  2QYB A;  4CLC C;  1V9Y A;  5DJT A;  2P08 A;  5HDC A;  4DN0 A;  4R38 A;  2J3T C;  4JGQ A;  4ARZ B;  3B33 A;  3LIA A;  4ARZ A;  4HNB A;  4WEL A;  3KYQ A;  3H82 A;  3F1N B;  2K2N A;  3LUQ A;  2VV7 A;  3NOT C;  3F1N A;  4HY8 A;  1F98 A;  2VZW A;  4G3V A;  4WL9 A;  1NWZ A;  5DF9 A;  4BBT A;  2XRO A;  5TJJ A;  4WLA A;  4CLC D;  2XA7 S;  4UQI S;  1IOU A;  1DP6 A;  3G6O A;  2O99 A;  2J3T D;  2L4R A;  3FC7 A;  2GNX A;  5J3W A;  1XJ6 A;  4G3W A;  4ZRR A;  3VE4 A;  2PD8 A;  2KLI A;  4OOL A;  3C30 A;  3H7W B;  4DJ3 A;  4L9E A;  4E04 A;  3KSI A;  3H7W A;  2VV6 A;  3P01 A;  5DKL A;  2QJ5 A;  3FPV A;  3UE6 A;  1OJ5 A;  1LSW A;  4MN5 A;  2MJ6 A;  1P9R A;  2INW A;  4GW9 A;  3IBJ A;  5K5B A;  4UQI M;  3T4Q A;  3D3O A;  3T4S A;  5HWW A;  3VV4 A;  2W27 A;  3MJQ A;  1DRM A;  3A0S A;  3ZQ5 A;  5KIZ A;  2V0W A;  5HZH A;  3EGX C;  1S1Y A;  2V1B A;  1KOU A;  2GX5 A;  4IUK A;  3OCL A;  1XFQ A;  2ZBB A;  2HV1 A;  4NKP A;  4R3A A;  2R78 A;  1NLZ A;  3LIB A;  3PBS A;  5IU1 A;  2Y8H A;  1S66 L;  3O5Y A;  3FG8 A;  5AVF A;  4Q0H A;  2VGL S;  1XJ3 A;  5AJG A;  3EQU A;  5HD5 A;  3IBR A;  5C5K A;  4HOI A;  3E4O A;  3C38 A;  4DJ2 A;  2OWH A;  3TE8 A;  3BQ8 A;  3LID A;  1YSP A;  4DMZ A;  3NOP C;  2O9A A;  5HWV A;  1JNU A;  4PHT A;  1X0O A;  1EW0 A;  3CUE A;  3PBT A;  3EEH A;  3T4J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...