2QA4I

A more complete structure of the the l7/l12 stalk of the haloarcula marismortui 50s large ribosomal subunit
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
126
structure length
118
Chain Sequence
IEVLVPGGEANPGPPLGPELPVDVQAVVQEINDQTAEVPVTVKYDDDGSFEIEVGVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RIBOSOMAL RNA
publication title Structure of the base of the L7/L12 stalk of the Haloarcula marismortui large ribosomal subunit: Analysis of L11 movements
pubmed doi rcsb
total genus 13
structure length 118
sequence length 126
ec nomenclature
pdb deposition date 2007-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 2qa4I02
2.10.260.30 Mainly Beta Ribbon Pemi-like Protein 1; Chain: D Pemi-like Protein 1; Chain: D 2qa4I01
2ZJQF 1VQ8I 1VQNI 3CCLI 2E36A 3CCMI 1VQ6I 2ZJPF 1VQOI 5GAHJ 1MMSA 5DM7F 1YITI 2FOWA 3G4SI 1FOXA 3CCSI 3J7YJ 1YJNI 2QEXI 4IOAF 3DLLF 1ACIA 5GAGJ 2ZJRF 4IOCF 1YHQI 1YIJI 1VQPI 3CC4I 1Y39A 1VQKI 3CMAI 1VQ7I 2OTLI 2NXNB 1VQLI 2E35A 3I55I 3J7ZI 1VQ9I 5JVGF 3I56I 3CF5F 4UY8I 5GAEJ 1VQ5I 3CJTB 3CCJI 4V19K 3G71I 1YI2I 2H8WA 1VQ4I 2QA4I 1S72I 2JQ7A 2OTJI 1HC8A 3G6EI 3CCEI 2K3FA 3CCRI 5GADJ 3PIPF 1VQMI 1FOWA 4IO9F 3CMEI 5DM6F 1FOYA 3PIOF 3CD6I 2E34A 1QA6A 3CC7I 1YJ9I 3CCQI 3CCVI 3CCUI 1YJWI 3CC2I
chains in the Genus database with same CATH superfamily
3D0SA 3RKYA 1VQNI 2ZMEC 1XB4A 1WGXA 3UR3C 4GO1A 3HL2A 2GM4A 2GLOA 1P4AA 4EGYA 1Q1VA 1SANA 1SD5A 3S1RJ 1HW1A 3BT9A 1NH3A 2ME6A 4EJUA 3V7SA 1KGSA 2FNPA 2Z5UA 3KX2A 2W82A 3O2PE 1YITI 5LEKA 2NAZA 2EA2A 2P6TA 3S3MA 4HNUA 1Z9CA 3ISPA 2O61A 1WJAA 4UB6C 1IN4A 3E1SA 2DLLA 2LDUA 1HF0A 2EZLA 2QEXI 1X3WB 4PJMA 3CUQC 4ZDPA 1OCOH 2QQBA 3JAMZ 1RKWA 5CVRA 4BJ5C 1ZH5A 2VLAA 2IVMA 3OYIA 5CKTA 2HPMA 2VBZA 1NHAA 2QYOA 3IKVA 3S16J 3HEFA 1GUUA 1T2KA 2E1NA 9ANTA 2V9KA 2KPMA 1QO0D 1IN5A 2QBYA 2RN7A 1X4OA 1X1PA 1K7AA 3A0BC 5IYCJ 2XSJC 4JOMA 3OY9A 1IN8A 1IXRC 2L7ZA 5AIPA 2HVRA 3CDIA 3LA2A 5IP6A 2NNNA 4XLCA 5D5WB 2V4JC 3DTIA 3EUAA 4H4KC 3GTKJ 1BA5A 1MH3A 3KLNA 3GTPJ 2M34A 1YW7A 3CO7C 3DPLC 3KYDB 3RDIA 4ZC3A 1YIOA 3K9TA 2L4MA 2IS1A 1MSFC 5HS8A 5HNFA 3FXLA 2V1UA 5M5XJ 4HNVA 2NS8A 3BR6A 1SFUA 2XGEA 1IF1A 1E0EA 2E7WA 5C44J 4UUSA 2PMHA 1YW9A 4XRMA 3G1LA 1FOYA 1P4XA 3S1NJ 2GXBA 1PUEE 2GQQA 3S3NA 3L7WA 4M74A 1ZGJA 3FMQA 2GZWA 1MMDA 2ZXWH 2HFHA 4HZFA 4MQVA 2FRHA 4WXDA 2DOEA 4OAYA 2Z1DA 2LVSA 2VPRA 1ZARA 2L9NA 3IRQA 4L5IA 3C2HA 3TDUC 3WTZA 2CQQA 3H3ZA 1Z77A 1AWCA 3JSPA 3F8CA 2OZ6A 1U9NA 5J1UA 3I71A 1JKRC 4KDPA 1P2FA 4Y3OA 2EB7A 4C9YA 4DYQA 4A3EJ 1JT0A 2F4OB 1X19A 4A3FJ 3GYHX 2R7SA 4G6QA 3OYBA 2A61A 4XLPF 2H6CA 2KZVA 4M71A 1D3YA 2VASA 3ZN0A 4LLNA 1EKEA 4I02A 3HPGA 3L2UA 1W36D 2M2EA 1Z0RA 1XMXA 2XB0X 1J09A 1NG7A 2KQRA 3KEYA 2V26A 3QPHA 4RGUA 3U2RA 1IGNA 4XICA 4QWQA 2Q2EB 1FYMA 3S17J 3J80K 2NVUB 3G3ZA 3RPUA 3GFIA 1S3JA 1WJEA 3M4OJ 4OINF 2FBIA 2LYCA 3T1BA 4BQQA 4A12A 1K79A 3ABKH 2CH0A 3ONQA 4FASD 1J75A 3SDGA 1GV2A 5CVUA 4I01A 3L2WA 1ZELA 2JVHA 4I0AA 2RGVA 3BLYA 2M4GA 2Y30A 4MTEA 2HU9A 1S7EA 1JKQC 1TQMA 4JQFA 5KK1A 5F04A 2WAFA 3IWFA 3U21A 2NVYJ 3TDZC 2VT3A 3MWMA 2F2EA 5LHGA 5EGOB 5KAFC 3RQ4A 1LUJB 4F93B 2JA8J 2AXTC 1UG2A 2R7XA 2HKOA 3OYEA 4XKWA 3BOQA 1K4SA 3HXLA 1ERDA 1ETWA 3L9FA 2R5YB 3HGGA 5HDKA 2MYSA 5F0FA 2JT1A 4LITA 3CDHA 5F27A 2VKEA 4AD9A 2W1TA 2D2WA 2W1OA 1H8AC 2TRTA 1J0RA 2V79A 4DIQA 2WB1A 1R7JA 1LFUP 3ABTA 3H0DA 1HSJA 4JDOA 4RGXA 4AYBN 1KZHA 1BIAA 3V7RA 4U0VA 2L2OA 5EEHA 1ZG1A 2XRLA 2RC4A 3QPSA 3A01A 1WSUA 3LQQA 1O3TA 1U5TC 3FISA 3ZQHA 2W48A 4P1WA 4LB5A 2YSRA 2ECBA 1ZAOA 4UVCA 3ZOBA 1R00A 2QQ9A 3CCVI 3EUHC 4ANJA 3PNVA 1YW8A 3HRSA 4XKBA 2OJED 3OMYA 4I99C 2MLGA 1FIPA 1HXDA 1AOYA 3CCMI 2GLWA 1TZLA 1YLFA 4G7OF 1I6XA 2P5KA 3I0TA 3ZQQA 1T0FA 3GLXA 1HKSA 4UUVA 1S7AA 4IJAA 5J47A 2P6SA 3OYKA 1GVJA 4OIOF 1YG2A 2ZJ2A 1FMVA 1ETYA 3L2RA 3TW6A 3P5JA 1G4DA 4L9NA 1MNMC 2ICWG 1W0TA 3IHUA 3K4MA 1FX7A 5M3FJ 2P0WA 2L66A 2JA6J 4C3HJ 2LNBA 3P9KA 1UB9A 1B59A 3LOCA 1K83J 3F23A 3PJRA 2ZC2A 3OS1A 3R60A 3ZRGA 2BHZA 5F1JA 3GTMJ 3I53A 4GGGA 2ZJRF 1KU2A 2M4KA 3GMEA 1MBEA 4YG2F 3SEZA 4G6DA 4CHUA 4N4NB 3FMRA 3O6BB 5C4JJ 4ZTFA 1QQIA 2QBYB 2F48A 2FY9A 2FNAA 3AG2H 1HLVA 2EV5A 3FWEA 4BL0B 2KKOA 2P7CB 3GUDA 3FBIB 1ZG3A 5E3NA 2QSHX 4E7IA 3ZPLA 1YTYA 4X6AJ 4RGSA 1KYWA 4A0ZA 5BPIA 3FF5A 3GVAA 4XOTA 1LE8B 2IGOA 1ZYRF 4HF2A 3RKXA 1ORKA 3LSJA 3C7JA 2PMZN 4B3AA 2DMNA 4OAZA 3K4NA 3J7ZI 1YE9A 3OYNA 2R0QC 3I56I 1MKMA 3TGNA 1JUMA 2Q0OA 1TWFJ 4PJLA 4B43A 3CCJI 1DDNA 2V9VA 5E3LA 5E1ZB 4RLFA 1T39A 5CJ9A 2R7UA 3LFKA 3T0YA 2A69F 2CS3A 2OTJI 3K1PA 3DFGA 2LSOA 3OYLA 3DV8A 2IRFG 1IRZA 1QPIA 1RKTA 4EV0A 1WJFA 1B8IA 1Z7UA 3QQAA 2V1NA 3GLLA 3QP6A 2ACJA 2O6GE 3OYDA 2WAQA 1TP4A 2O8KA 4UNOA 1IAWA 4EJVA 2Y0SN 4I7HA 3OR2C 2DW4A 2YS9A 2PJRB 1B1BA 4AM3A 2VONA 3F8BA 5J6XA 1GXQA 1R36A 2ZFWA 1KQ9A 3ZQLA 1Z05A 4J19A 4R79A 1JKOC 2QENA 2VC0A 3IP4B 3RKQA 4PJ0C 1TTYA 5HOOA 1WJ5A 3R6SA 3K2ZA 2NS0A 2L01A 4MQ9F 3BWGA 2L4AA 5E8IA 5L3BA 3A0HC 2VKDA 4Z6YA 3N97A 3I59A 4OIPF 4G94A 1Q1HA 1SFKA 4N0BA 1H88C 4OWRB 3HM5A 3HOVJ 2EINH 4MFEA 3OS0A 2H1LA 4BE2A 3SXYA 5K7HA 1ZRFA 3CP8A 3WG9A 3H9JA 2AS5F 4UHTA 2CYYA 5K5QA 3GZ5A 5TJJA 5IT9K 4V2FA 5DYMA 3SZGA 4AWXB 2K9LA 3DLLF 1W7PB 2H8RA 1KQ8A 3MMYB 2L9SA 1TW3A 1B72B 3F9KA 3K10A 1H0MA 3EETA 2RVCA 1V4RA 4AU7A 2DXIA 4A3LJ 1HDDC 1UMQA 3A1YA 3CUQB 3IUOA 1Y39A 3O27A 4NQWA 3K1MA 1W7PD 4CYCB 3CMAI 4LJZF 2HVSA 1V54H 2R7QA 4PGGA 4ESBA 2A68F 2GA2A 4RB0A 3HOUJ 2VQLA 3BTJA 4HBLA 3KP6A 1ZGAA 1RC9A 2NOJB 1OFCX 2PBIA 2HS5A 3WU1B 4FISA 3I55I 2AO9A 4JX4A 4NHJA 2VJIA 3HOYJ 2F4MB 3VSKA 1M1EB 3V8LA 2YR2A 2X85A 4E7HA 2BZTA 3PUFA 2H8WA 3QOEA 2IA0A 1R1VA 4CZCA 3WTWC 1TWCJ 4BDYA 3BTIA 1MVFD 3G6EI 3BPXA 4ZTJA 1U0JA 5CQGA 1LFPA 3KYCB 4A5NA 1RUOA 4F7ZA 4U88A 3B73A 2YU3A 2JUCA 3A01B 2QCOA 3K69A 1T6SA 5DTDA 1OCZH 2M8GX 1I5ZA 2BEOA 5IP7J 5LGTA 5IOYA 3HKZA 1STZA 2MA3A 3BJ6A 4QSHA 5J3LA 5LGUA 2XRNA 4B47A 4BGDA 1UHMA 1JHHA 3IAS2 2R7RA 1LB2A 4G7HF 3I54A 3ML6A 2CUEA 3IAM2 1MBGA 2JJ7A 4KA4A 2ESNA 4CZZA 2ADUA 2KJCA 4XQFA 2OPTA 1VQ8I 4KITB 2VOOA 2G9WA 1DU0A 4IQJA 2IGMA 3CCLI 2KJBA 3LSKA 2JRTA 2JSPA 4GFBA 3OL3A 2LP0A 4ZYDA 1OYYA 3TKYA 2IJLA 2ZJPF 4BBRJ 1ODDA 1Z91A 1MMSA 5F08A 4HLYA 4DYCA 1SFOJ 5J8CA 3K7AJ 2A6EF 1BR4A 2LR8A 3BR0A 1V55H 2CFXA 4XRFA 2EIJH 3F6OA 2JPCA 4DBRA 2BHYA 2ZO4A 3EPZA 1Z7LA 4N9IA 3F6VA 3S93A 4NC6A 2DA2A 3M1CA 4B48A 1FYLA 3AL0C 4ZYAA 2DT6A 1I1SA 2K5CA 3AAFA 3RSNA 2B7EA 3HYIA 2Y75A 4EATA 2NYXA 2FUG2 2UUZA 3GBGA 1A5JA 1OLTA 5JVTA 1R5GA 4XOPA 4YIFA 5DS9A 2RNJA 1W1WE 3OOPA 2OA4A 3QU3A 2HDWA 4Y4RA 1YS6A 4O5VA 3M1EA 2E2HJ 4F91B 1R1UA 3H92A 2CV0A 1QU3A 2STWA 2XGDA 2LRDA 2ZSIB 1YSFA 1T95A 4WWCA 5JI6A 1E3HA 3R0JA 3E3VA 2XSDC 4YIRX 4HA8A 2XAGA 2Q2EA 2O03A 2J5PA 3C18A 2I5UA 4I76A 5GAEJ 1MJAA 4KJZA 4BUPA 4A3DJ 5FLXZ 4JX6A 4UXNA 3QPLA 3BTLA 4L9TA 2WB1N 4WX9A 2D45A 2H27A 3LSIA 1AHDP 1G6NA 1K6YA 1S72I 1E2XA 3PL8A 3WTTC 2LD5A 2CUZA 4E7ZA 1CGPA 5TRDA 2MC4A 3CDLA 2JZYA 2VN2A 1EV7A 3ZMUA 2W84A 3AG4H 1R49A 4BQAA 1OYWA 4XLHA 5ILSA 1B9NA 4CCJA 5JLWA 2ID6A 1HCRA 5EF6A 3NAUA 2R7VA 5BMZA 3ZMVA 2KISA 2P4WA 4C30A 2CUJA 5KHDA 3E7LA 3OIOA 3H0GJ 1FBUA 1MNDA 2DFIA 3ZN1A 2R5YA 4LLLA 2CJJA 3HSEA 4CICA 1BR1A 3CCQI 2HYJA 3TL4X 1R22A 2X51A 2FF4A 2DFHA 2CV1A 3EDPA 4MTDA 3QYFA 4Y17A 3KFWX 3CO6C 4XIDA 1YX5A 2DMQA 1MMAA 1XG1A 4RA2A 1U5TB 2HR3A 3I59B 3K4BA 4YRVA 4QPQA 1J7KA 5DV5A 5IP9J 2Y9ZA 1QVUA 2K02A 1XGNA 4IHVA 4D1QA 1QHHD 1ZN2A 3PFYA 4BHBA 1OYIA 1A35A 3VSLA 3F0CA 4YFKF 3S1MJ 4HX7A 2RO3A 1BI2A 2FOKA 1IN7A 3C1DA 2DOFA 2F6CA 1V5EA 2V1DA 1DPUA 1MSEC 4XN3A 1YJNI 2XGCA 1ULYA 2DT7B 1JUPA 5E8GA 1DGWY 3ABMH 5ICEA 1I3AA 4IHXA 3TOAA 1RUNA 2DTZA 5GPCA 3V4GA 4HLXA 3F22A 2OUMA 3BG5A 3HSFA 4XLNF 4MO7A 2M87A 2DA3A 4JP0A 5E79C 2CQ7A 1RNLA 1XGMA 5HLIA 3ZQ7A 4E4HA 3MKYB 3HOWJ 3L09A 4NQWB 1IZ1A 3F3XA 2A07F 2GOXB 2FXAA 2QSGX 3JCUC 1PUFB 3L00A 4OIRF 4CA0A 3FZVA 2LBFB 1U78A 2X6XA 3Q0WA 2KIMA 3ZP5A 2K9SA 4HG2A 1YS7A 4Y33A 1DUXC 1S9HA 2IT0A 3WGHA 4D0PA 4LGWA 4KFCA 2E35A 4M9ZA 4A3BJ 5ICCA 1LPQA 3IH2A 1MJ9A 3O3KA 4UUTA 3JRFA 5CQEA 1P4WA 1SVMA 1MZBA 2O8XA 2F5VA 3FXUA 3R4KA 3JRHA 2OQRA 3DU6A 5TGTA 2M7BA 5E1WA 2OCEA 4BEHA 2NNYA 2Z33A 2E2JJ 1QVTA 1P6RA 4N4OB 2WAQN 5D4SA 4A3CJ 4CGZA 1OR7C 4QIWN 3IC7A 3TOBA 1WFXA 2FQ4A 1SD4A 3KP5A 3CCRI 1WRJA 2HGCA 1BW5A 1XCBA 1P9QC 2FU4A 3COAC 3MFKA 4DW6A 4M3BA 2DN0A 4B09A 1LE8A 1UFMA 4YELA 3WODF 1ZRCA 3I4MJ 1TLHB 3HHHA 4RDUA 5FLMJ 3NRVA 4I98B 4PUSA 2XVCA 4M6YA 4PJNA 3OYCA 1O7FA 3LNQA 3I3LA 4PGHA 1USTA 2DQRA 3I4PA 2FMLA 2PLYA 2X1CA 5HS7A 3OS2A 4RB1A 4BAYA 4ENMA 3B02A 2XAHA 2M5WA 4KN7X 2B0LA 4N9HA 2OF7A 3F8FA 2IPQX 4ESJA 5FGMA 3VYRB 4XONA 2P81A 1T38A 3DEWA 1J59A 3HOTA 2AXLA 1IJWC 3IRRA 2O3FA 4C2MJ 4B44A 2PJRA 2CW7A 4XN0A 2XPWA 4RLQA 5ILUA 5E3OA 1FPQA 5K5OA 3QYBA 2W85A 1X1AA 3ABUA 4WK8F 1TWHJ 4XBFA 4AC0A 4RAFA 4XLEA 4NC7A 2LKSA 3W2VA 3CJNA 1D1CA 3JR9A 3FBNB 2YUSA 2CUFA 5CVIA 3MKLA 5GAGJ 1WPKA 2ZXIA 4NNJA 3QYEA 4S0HB 2HTSA 3GFMA 4FCYA 4DZJA 1YIJI 1VQPI 1IXCA 1D1AA 1HW5A 2FA5A 3IL2A 1KQ0A 3OYAA 2BBYA 1LVAA 1T8IA 2ZMEA 3GTJJ 1FTTA 5D6FA 2G0EA 4A3GJ 2H1KA 2OAZA 1X1DA 2XIGA 3H1CA 1BIBA 3JTHA 2K9QA 4DJAA 4A69C 3TEDA 1HKTA 3L2QA 2KIQA 3I5UA 1FC3A 2DYRH 2ZNZA 1W7PA 4M9SA 3N4MA 3I4NJ 3FXMA 1P7JA 3C2GA 1OISA 4A6DA 1B72A 3TQNA 4E7KA 1VQ5I 4CSWA 2ME0A 5DD8A 4EGZA 5ICGA 2KDZA 1MDMA 4JDMA 1ON2A 3CP2A 1YQAA 3BZCA 1OPCA 2E60A 4XSZF 4U0WA 5FROA 2O9LA 2RREA 3CUQA 3HG9A 1ZLKA 5H6QA 3CCEI 2DBBA 1UELB 2ZNYA 4CYCA 2R5ZB 2DPDA 4KN4X 3LAPA 2OQGA 1SEUA 3DKWA 3HKZN 4CO8A 3D5SC 5LHIA 2FBHA 3QPTA 5B1AH 2KIFA 2AQFA 3R61A 1R23A 1ZTRA 2COMA 4RAZA 4IPAA 4RS8A 2KIUA 4LIVA 1WHUA 1SD7A 2E34A 4RM3A 5J4YA 2L7MP 4KICA 1FEXA 1UG0A 4KYWA 4MGRA 1W5CC 3FX3A 4BHPA 2IAIA 2L0KA 1YJWI 1SVLA 2CMPA 3BG6A 4HF1A 2JA5J 2XPVA 1ENHA 3EQLF 5ITMA 1TBXA 2X4HA 1SFXA 4M9XA 4GCVA 1PJRA 2BW3B 4DQ2A 2HEOA 3W6JB 4PK4A 2C6YA 5FRMA 2IA1A 1LDKB 4O6JA 5GTIC 3IWZA 5J1YA 3S2HJ 3DF8A 1P92A 2E71A 1HDPA 1ON1A 2P8TA 4JK1X 4HV5A 1CF7B 2GXAA 3DKYA 4KT6A 5DM7F 2MH2A 2HOTA 2JA2A 4EJTA 1PYVA 2KMUA 3ZR8X 4IRHA 4I2OA 1AKHA 4OMZA 2DFEA 4FETA 1BI1A 2EFPA 2NVTJ 5B5EC 5FKKA 2D1VA 1XS9A 2YPRA 4IOAF 1OJLA 2A3SA 2FBKA 1TQPA 3RIRA 3GTQJ 3OIQA 1WI9A 2IS6A 1AA7A 4M73A 2I10A 1MBJA 3VYTB 3DPTA 2BXYA 4P9FA 1ACIA 3HRUA 4JX5A 2QM3A 3V42A 2L9RA 3FDYA 3QOPA 4IF4A 1R6RA 4I09A 4BE1A 2R93J 4IHWA 2EWNA 1FP2A 3ELKA 4WXHA 2GA1A 3MEXA 4IKFA 1G3YA 4PFOA 3HDDA 1K78B 4CCNA 3V8JA 2E5ZA 5M5WJ 4C3JJ 1WKMA 2QKLB 1S29A 3AKZA 5TISC 1ZR2A 5GPAA 3U1KA 1UHWA 2YX4A 3A2KA 5BOXA 2VOPA 4JBAA 3AG3H 4BYYA 4XRSA 1D1BA 1YFBA 2UZKA 2E1MC 1EJ9A 3E5UA 3IH3A 2BXZA 4A3IJ 1ZK8A 4XLAA 1N25A 3DQVC 1IV8A 4BEHB 2RO4A 3HB9A 2XAQA 2BY0A 2TDXA 2D1HA 2JQ7A 2L7KA 3I64A 2F4IA 3GTLJ 3FK7A 2WADA 1OCTC 2VJ5A 3VDXA 4BQOA 3LMMA 2CV2A 3KIOA 1LDDA 1IC8A 1IG7A 3QP5A 3CMYA 1UAAA 1S7OA 2BV6A 2L02A 5F64A 3WGGA 4MEXF 2HQAA 4G7ZF 5F0CA 2NS7A 3MZHA 3BQYA 2AQEA 5L3EA 4WXCA 4FX0A 3ZMZA 3AFHA 1DGRM 4RB2C 4IHYA 1TWAJ 3ECOA 3LA3A 4D9JA 5H2FC 1LFBA 1Z67A 1IN6A 2K27A 2K85A 3DTEA 2MFZA 3HZJA 2XUBA 4KIBA 2VB6A 4ZJZA 4EJOA 2DJIA 1I3QJ 5LFAA 1L3LA 2XKOA 3WTVC 2IS4A 2WY7Q 3M8FA 2VC1A 3KZIC 2IS2A 3KP2A 3L2VA 5EZHA 4KNYA 3VOEA 5M3MJ 2HDDA 1TC3C 3H5AA 4ON0A 4RBOA 1BBYA 1C0WA 4C2UA 4LG0B 4LOCA 2GBYA 1U8BA 4HSRA 1JJ6C 2VKHA 3MZYA 1EF4A 5FKNA 4XKCA 1QNTA 2V1XA 3VYUB 2MC3A 1X4PA 4A5MA 1U6GA 2DDAA 3GTGJ 2K86A 1XPXA 4FE7A 3SJMA 1DP7P 1IUYA 2XF5A 3BJAA 4IRGA 2M1BA 4KMFA 3BG7A 1IRXA 2MSYA 1ZQ3P 2K1NA 3KP4A 5L3GA 1QZYA 4M3EA 1Z1DA 4FHTA 3OSFA 1U5TA 2CW8A 2VIXA 2QWWA 4PJJA 4UVBA 5E18F 3GX4X 2EV6A 2V6EA 2BY1A 4CDGA 3D5RC 4Y15A 1N78A 3BY6A 5DEQA 3TO7A 4IL6C 3EUHA 1G8XA 4BNCA 1Z21A 2K4BA 3W2WA 2MG4A 2ZMEB 5IPAA 4YFNF 2VPLA 4BJ6C 1D8KA 3FK6A 1JXSA 2HNHA 4HX4A 4LFUA 3PNTA 1V5FA 2LY2A 3IV5A 4JYKA 4MLOA 2DMUA 3K0LA 2QKMB 2OU2A 1IRFA 1FOKA 4ASNA 3KZZA 3LSMA 1G2HA 3SZTA 2AHQA 2CQNA 2OC6A 4ENKA 1MDMB 3M07A 2IA2A 4HAMA 2YU9J 3A4CA 2W57A 5ILVA 2LOOA 1XMAA 3PUBA 3DXJF 4OIQF 3L1PA 1ZREA 1LEAA 2ZXHA 5IT3A 3MKZA 3T5XA 5FFZA 1FBSA 2F5CA 4HNTA 4C3IJ 2KFDA 3FKJA 1PUFA 4IEJA 1SD6A 2IGNA 2EIKH 4ZH4F 2LBFA 4ABZA 5CPRB 3GFJA 4E7LA 1BOBA 5LHHA 3SDBA 2RKHA 4V2GA 3CESA 5K5RA 2K40A 3E6MA 1R4MB 3PSIA 1KYZA 1X3ZB 4LIUA 1NK3P 4IVNA 5FD5A 4CH7A 5J40A 3RPUD 3D5LA 2FQ3A 2L5QA 3NWSA 4BQNA 4GRIA 2HQNA 1XTAA 3CC2I 3BR3A 2DMTA 5D5XB 2XHKA 4U7BA 1IDYA 2LKXA 2E36A 2PG4A 2VXZA 2LG4A 1B9MA 3A03A 4X0GA 4EVIA 2RNGA 2CFOA 2FSWA 2EH3A 1RIOH 5FO5A 2MH9A 3F21A 2B63J 1AKHB 1QZZA 2EQRA 3M8JA 2E19A 3G4SI 4A0XA 1R71A 5CVJA 1YO5C 2STTA 4B8XA 4MFDA 5K7FA 2RO5A 3A02A 1QPMA 1W5SA 4Q5SF 1QRYA 3LFUA 2ISYA 3H9QA 3EYYA 4KMUX 4UV8A 1PDNC 5J4VA 1ZGWA 3ABLH 4FX4A 2HI3A 4M72A 3LA7A 2ZFUA 3ZMSA 4J01A 4U7DA 3K6GA 3HBLA 3S2DJ 1RR8C 1VQ7I 1XDUA 3ZXSA 2GAUA 3ZMDA 5AONA 2IXSA 4ZYHA 2OTLI 2ZSHB 3G73A 1UHSA 2VBWA 2QQ8A 5E17F 5LBQA 3JTGA 4P5OA 1F9NA 1OKRA 1MD0A 2L3DA 1RRJA 1D0XA 2R7WA 5C3EJ 5EEAA 2MD5A 1B4AA 1HSTA 3V8KA 1U8RA 1BW6A 2DOAA 3OYFA 2NVXJ 2LK2A 3PQJA 1P7IA 5DDGA 1ETOA 2CQXA 2DI3A 5ED4A 3G2BA 4HQEA 2P7VB 2QUFA 2JN6A 4RGRA 2VBXA 1DPRA 5A2QK 2XC7A 5JLXA 1I39A 1MBHA 2Y31A 4XMYA 2KHMA 4HEA2 3QWLA 2Y9YA 4A3KJ 4XRSG 3VYSB 3HHGA 2E7XA 4L5EA 4DGWB 1FOWA 3H35A 3SQNA 4IO9F 4OMYA 4GDFA 2HOSA 1O3QA 4XORA 1LEBA 2HQ5A 4XL9A 5IY5H 1WH5A 3WU0A 3VFZA 2W7NA 1YJ9I 2GIVA 3PSFA 1IRGA 3PM1A 2JA7J 2HQRA 2BYVE 1BI3A 3JRBA 4XR6A 1YOVB 4CXFA 3CCUI 1DQUA 2D5VA 1J9IA 4W1UA 1UCRA 4UB8C 4IX7A 4O3MA 1SVOA 3DPUA 2PFBA 1BC7C 1JHFA 1G3TA 1KU7A 2R5ZA 3H9GA 2M9HA 5D5VB 1YRNB 4LG3A 3TP3A 1ZKGA 2BY2A 4Z2YA 4ZZDA 4I0BA 1FY7A 3PO2J 2XDVA 1TT5B 1JTYA 2IBDA 2EILH 3KP7A 5EDNA 2P5VA 3CF2A 2MW8A 1H9TA 1OCRH 3RKWA 1TNTA 3LQRA 3VODA 4M3DA 2L54A 3H3VK 1FOXA 1RPWA 2A05A 3UNGC 2VQGA 5J8FA 2L7FP 4S05A 2EFQA 2OZUA 1T56A 1XCVA 4HOBA 3P7NA 3M7GA 1HA8A 3J81Z 3JREA 1Y56A 3HRMA 2BW3A 3LWFA 2WV0A 3QRFF 3HRTA 1NG6A 3MZ8A 1RR7A 2HKXA 2R7FA 3Q0UA 1FNNA 1SAXA 4XKVA 5L3DA 1CF7A 1XSVA 1F1ZA 4P9UA 3GFLA 4U0YA 5GTHC 5EG0B 4A0YA 2LY1A 3TO6A 1K6OA 3K4KA 2ZCWA 3W6KB 3FXOA 3VEPA 4L9JA 2DQLA 3WTSC 3ZMTA 1U2WA 1IXSB 4PCQA 2QGUA 2Z99A 2P5LC 2X6OA 3KZYA 3DEUA 5ERIA 3FMSA 2BOLA 2WY8Q 3W2AA 3K2AA 3JRCA 2HXIA 2PEXA 3RPQA 1HKQA 1POGA 5K7ZA 3CJTB 3REOA 1EH6A 2Z3YA 5E1XA 4II2A 5JHUA 1FMWA 1JTXA 2RV8A 4CCKA 1X1BA 1X1CA 5ITJA 2ELJA 1R5HA 2VT2A 3ZGKA 5FJ8J 4EQQA 3H5RA 2CO5A 4W97A 1VFCA 2DU9A 1K78A 2K7LA 4QTRA 3MD2A 3FHZA 4AUXA 2W25A 4I6ZA 1WZ2A 3H3UA 3BTCA 4IXAA 4DZPA 4BU2A 1WWXA 5LD2C 1E17A 1MIJA 2XF7A 3H36A 4L9VA 3SHFA 1TWGJ 1W4MA 4XK4A 1WJDA 4BKXA 3BCBA 1Y8RB 2HWVA 4RAGA 1E3OC 2ISZA 1XX5A 3FHNA 1Y8QB 4LK1F 5FB2A 1ZRDA 4D7MA 4U87A 2XAJA 4HSTA 3BROA 3BCAA 5B3SH 3JAMK 3GTOJ 2LTPA 3E0JB 3BR1A 1SMYF 1WVRA 3MCZA 1REPC 3JW4A 1GT0C 3WTYC 4Q4ZF 5HLGA 3OYMA 1LQ1A 2WA0A 1QBJA 2UXXA 1VQOI 1U3EM 3EYIA 1HW2A 1UZCA 4E6KG 4NDLA 5FRNA 2M0CA 3VPRA 5H6RA 5D8KB 1ONVA 3K4LA 2E1CA 3HTUA 1OCCH 1ETVA 2JRMA 1ZR4A 2VKVA 3K1NA 5KNLA 3CCSI 2DO7A 3M9AA 4LK0F 2LH9A 3ECHA 3OIPA 2R7ZJ 3S14J 4G9YA 5IOZA 1A36A 1SFEA 4FE4A 4RAYA 5EJCA 1FJLA 5C4XJ 1WJCA 4DNCA 4AIKA 1X58A 2IW5A 4IHSA 4CCOA 1LNWA 2EV0A 2NVQJ 5HODA 2M0MA 4MIMA 3BC8A 5JHFA 2IGKA 3J7AY 2HTJA 2Y48A 4GXOA 2MLKA 1KONA 1V3FA 1FP1D 4LG0A 4GYIA 2DAOA 2X48A 2FE3A 2X6WA 1XSXA 1S8NA 3CLQA 4UV9A 1E3PA 5CYVA 1APLC 4BH9A 2NXNB 2JK3A 3JRAA 1FSEA 5DUIA 2ZB9A 2GOMA 1IUFA 4Y7NJ 1I27A 3Q5FA 2DPUA 4LD5A 5BNGA 3Q9VA 3IH4A 2BVMA 4B1RA 4BACA 2UWMA 1BOAA 2M8EA 1IW7F 1T0FC 4LB6B 3RTRA 2PI0A 1Z6RA 2FMYA 2ID3A 2PX9A 5IYDJ 2X1EA 5HLTA 2ELKA 2E2IJ 3TO9A 2KRFA 2DMPA 4ZDLA 5L3FA 5D5UB 1HC8A 4WF2A 3V7CA 1J2XA 3LL7A 2HYGD 2VXDA 1MNEA 3ESWB 5GADJ 4C2TA 1GDTA 3IKTA 2VQHA 2FEZA 2Z16A 4OU0A 3UKGA 1WCMJ 1UB4C 2VI6A 4CCMA 2HZDA 3WGIA 4WCGA 2QZ8A 3J80Z 2LF7A 4BS9A 3OV8A 4ESFA 4EJWA 1XC5A 3ERMA 3GW2A 4PFPA 5EZGA 4A6EA 2VUMJ 5JR3A 2KDOA 2H09A 5E3MA 1A6QA 3TMOA 2A5WA 2R92J 3CZ6A 3CLOA 1FBQA 3VB2A 2EA4A 3U1DA 2KLOA 1GVDA 3QU6A 1D0YA 1X3UA 4EM2A 1T33A 3E5QA 4RMNA 2WC2A 2M7AA 3CMMA 2CSOA 3HOSA 1DU6A 3OOUA 1QGPA 3OYHA 1F36A 3BPVA 4MEYF 2FD5A 2HVQA 4PSWA 3KPHA 5GAHJ 1TW2A 2QF7A 2XAUA 1MMNA 3E6DA 2DODA 2FOWA 2JTVA 4HF0A 5CLSA 4A3MJ 1OR7A 1MBKA 1BC8C 4CCLA 2DJNA 2RAEA 2EZKA 3CJRB 3FM3A 3LSPA 4M3FA 1NTCA 2DA7A 4YIIA 1MGTA 3RJPA 5B66C 3D1NI 1R9TJ 3S1QJ 1T08B 3RQIA 3KLOA 5BS6A 2ETHA 2LLKA 3W3CA 4AIHA 5K1YA 1JE8A 1BM9A 1B6AA 1SAUA 1XGOA 3C2BA 2Y2ZA 1XN7A 3DU5A 3DKXA 2PMUA 2V9PA 3GZNB 4HQMA 3CTAA 2E5NA 3OYJA 3CC4I 3BZKA 2X0LA 5IYBJ 2MBFA 3SFIA 5FFXA 1VQKI 5DCMB 4HW0A 5FD6A 1F43A 4B3XA 2MABA 1G59A 1VQLI 2ZBKA 4FTHA 3WG7H 3K70C 4DYRA 1IO2A 5EEGA 2XKPA 3ZQGA 2IEKA 3O8GA 5DUKA 2CWEA 3BJOA 1VQ9I 3S32A 3DTKA 3OYGA 5LGNA 1MMGA 4OOIA 3RI4A 2CU7A 3HUGA 4A3JJ 5LRRA 3FKIJ 3E6BA 1Z3YA 2BE5F 3DP7A 3LSTA 4F92B 4L18B 3PQKA 3G71I 3WE2A 5HVQC 1QZEA 1R5ID 2BY3A 2X9DA 2CQKA 2QA4I 3AL0B 1T98A 2EFOA 2Y0MA 1WH7A 3P9CA 3S3OA 3C3WA 2XGXA 4QPOA 3EUKL 1Y1WJ 3FXJA 1H9GA 3AG1H 3ULQB 2OV7A 2DT5A 1DP3A 2VJ4A 2GIZA 4PDKA 2MGQA 4GYGA 2LY9A 2HOEA 3CMEI 5DM6F 2COBA 5D8LB 4KIFA 1XGSA 5EYRA 3CC7I 1I50J 2G7UA 3GO5A 2EK5A 2XV4S 4E7SA 2QSFX 2F5FA 3G1OA 3B6CA 3FXRA 1A04A 3L2CA 1ZLJA 2HXOA 5KVRA 4HYEA 2EPFA 4BHCA 3U9GA 2JSCA 2VE8A 5F6FA 3KP3A 3TBIA 2TCTA 1ETXA 4HRIA 1EH7A 1D5VA 3TW7A 4D5FA 2EIMH 1XD7A 1O57A 5CVVA 1MW7A 1JT6A 3VWBA 3TNDB 2VE9A 3J7AO 1FSHA 2XASA 1LJ9A 3N05A 2F5DA 3BZ6A 4L0YB 4AIDA 3ROUA 3WHCA 1TT0A 3O8HA 3S8PA 1R58A 4D7NA 3ZQIA 2B9SA 3Q0VA 4CYDA 2BGCA 2LFBA 2Z9OA 3GWZA 3DBHB 1KU9A 1OMIA 4M6XA 5H20A 1VTNC 2NRAC 5J1RA 2EZIA 3LAJA 3LSGA 2KT0A 4KISA 1TQIA 1Y1VJ 1AU7A 3KEOA 3NWTA 1YRNA 4EEFG 3K4CA 1KU3A 3CCYA 3X2QH 1D0ZA 3KEQA 4G8XA 1SC7A 1V5GA 1Z6TA 4TV7A 2R3SA 3OSGA 4BBSJ 4G12A 5FKOA 2A6HF 4ZDOA 4UVAA 1FTZA 1CQTA 2M45A 4MHGA 2XROA 5AIQA 3KYLA 3F8MA 2HZTA 4QLCU 1O3SA 4BY1J 1SMTA 2WBMA 3OWTA 4AVZA 4UUSB 4Y13A 1HQCA 2CG4A 2Y69H 3LSRA 4EMSA 1FWZA 4F52A 5JVGF 4S04A 4D5CA 1GV5A 2RQPA 4ZYGA 2PQ8A 5HNHA 1YI2I 1Y0NA 1VQ4I 3M3YJ 3I58A 4L5JA 2K9NA 2HDCA 5LRSA 1ZHFA 1YYVA 1BI0A 3K4JA 3I9V2 4BE0A 2K3FA 1A31A 5EG0A 1LVKA 3WTUC 1VQMI 2LC2A 2VBYA 3DLAA 4AIJA 5JFRA 4H0EA 2QQAA 1W0UA 1JI8A 2DK5A 2JWTA 3M8EA 2NOGA 1U9OA 5E20A 5IT9Z 3HJEA 2R7TA 1JGGA 3NEUA 3ASNH 5F1RA 4PSXA 3DEEA 5D6EA 1W36C 4XNFA 1FLIA 5DD4A 3DBLB 1D5YA 4J00A 1Y6IA 3T8RA 1BJZA 3HC7A 2JMWA 3R0AA 2A5YB 2OBPA 4HX8A 5HDGA 2DA4A 3FM5A 3WE3A 4II3A 1Y0UA 4K2EA 3CUOA 5ICFA 1J5YA 4LLGF 4BXFA 2PN6A 3BG9A 1EH8A 3GEZA 3GCMA 4M3GA 3KCCA 3BDDA 3PO3J 4IRIA 2XB5A 2LREA 2GWRA 3KE2A 1IV6A 4HPQA 1FYKA 3FXKA 1KA8A 1D8JA 2RQQA 4Q47A 2UV1A 2VQCA 1MJBA 4KT5C 1O7LA 2HYFA 3S2WA 1JGSA 1HBXG 1ETKA 3OL4A 3TP0A 2XF6A 2ZKZA 3CQZJ 1O3RA 1XDSA 1BR2A 1S5LC 2RDPA 2KRCA 1R4NB 1VF9A 3JRIA 1Z0XA 1EA3A 5HLHA 2FX0A 6PAXA 2M30A 3BQZA 1H89C 3HOXJ 3ERED 1BN5A 2V6CA 4HV6A 2GXGA 2OD5A 2DA5A 3E5XA 4IOCF 1JUSA 2W1TB 1USSA 1QHGA 5M5YJ 4ZZLA 4F55A 1G3SA 3ZQCA 1K4TA 2QLZA 5B1BH 1GLNA 2EFWA 2X6YA 2Q8KA 1ZG5A 3NQOA 1TL8A 5HDNA 1GHCA 4E70A 1R1TA 2UXNA 1F4KA 3HOZJ 2DYSH 2Q1ZB 1FT9A 1LKXA 3SYTA 4ENNA 2HOAA 4ENJA 3HSRA 4RM2A 4P96A 2KRHA 3HUGB 1YFHA 4M6VA 4UY8I 4CUGA 2CW0F 1N77A 2DTRA 1A6IA 4A2UA 1UJ8A 2JVGA 3MN2A 2VODA 4DOZA 2EBIA 2MD0A 3DCFA 3SZPA 4KUMA 3G1MA 1VNDA 2DA6A 5FKLA 2K4JA 3DWLE 2IP2A 1X2MA 4BXXJ 4R1HA 2O7OA 3E97A 2I8DA 2KP6A 5LLQA 4YEJA 4NBQA 1L0OC 3WTXC 4HDVA 1GXPA 4BY7J 2DA1A 3HGYA 1N75A 3MAJA 4BJTA 4RB3C 2PJPA 2KZGA 1PP7U 1FZPB 1WJBA 3OR1C 3ASOH 4AYBA 3CD6I 4P55A 2O0YA 3KETA 4FQGA 1QA6A 3FXQA 3W6VA 2HPIA 1BL0A 1W5TA 5F0HA 3PNYA 2DDBA 1RI7A 2ZJQF 2ELHA 1FIAA 3SFZA 3DBRB 2DCEA 2N8GA 5A2QZ 2J5OA 3SEQA 3RZOJ 3HPHA 4LMYA 1LDJA 3LSHA 4ETSA 2ESHA 3HIFA 1VQ6I 2R7DA 2WWYA 1O4XA 4NB5A 3JRDA 2ZXJA 4F3QA 3S15J 3Q3SA 4E7JA 3QAHA 1WI3A 2QVOA 3BR2A 4R8HA 1MBFA 2L9VA 2R7OA 4XM3A 1ITYA 3HTSB 2K9MA 2Z2SB 2H6BA 5FKMA 4A93J 2JPBA 3J7YJ 3P9IA 4MNUA 2W24A 1X2NA 1I1GA 1OQYA 4XSXF 4Y52J 1OCPA 2A6TA 2FJ1A 2H94A 2V7FA 3MQ0A 2EFNA 3Q9SA 1TNSA 4NUBA 2R4GA 1RZ4A 5FLXK 1VZ0A 4PZJA 1IDZA 5HS9A 1G3WA 1RESA 3ZCOA 1YHQI 1RETA 2G7HA 2YX7A 1XSDA 1K61A 1I6HJ 4NC8A 3CJQB 4AVPA 5BQTA 3WHBA 4HDUA 2VJJA 4IHTA 2CGPA 3RYPA 3RCOA 4EM1A 3JSOA 4X1EA 1B8IB 2XPUA 2DK8A 3ZQFA 3FIWA 3GXOA 3RZDJ 1HOMA 3T8TA 5KAIC 2JUGA 2LF8A 3MKWB 4DBQA 1JJ8C 1NK2P 3BP8A 5EGOA 3B6AA 3MVPA 4B4CA 4EM0B 5KCMA 2BVLA 2OCCH 5FLVA 1XMKA 3CF5F 2VL8A 5D4RA 2WAEA 3GZ6A 1YX3A 1PVEA 4IZZA 4V19K 1S6LA 2PMZA 5L3CA 2W00A 2DFFA 2EJRA 1WQ2A 2ECCA 4XLFA 1JKPC 2X1DA 2XAFA 2O5RA 3F8NA 3H5NA 3J81K 2E1OA 4BDZA 1F5TA 2K3PA 2F5EA 5DCMA 5BPDA 3PIPF 5LEJA 1Z3XA 1PP8F 4KIGA 2CRGA 2EZHA 4G6TB 3NARA 2WV1A 2M3AA 4Q48A 4ITVA 5GP9A 3K70D 3F72A 5DCFA 3QODA 4YFXF 3JRGA 3PIOF 4L0ZB 4IQ4A 3GF2A 4FT8A 2LMDA 4ZYEA 2WTEA 1ETQA 2LKPA 4BXUA 3E6CC 1VI0A 1BJAA 1MH4A 2Y0SA 3WU2C 2KL4A 3BR5A 2W4SA 3BG3A 2E1MB 3PFIA 3RYRA
chains in the Genus database with same CATH topology
2ZJQF 1VQ8I 1VQNI 5ITMA 3CCLI 2E36A 3CCMI 1VQ6I 2GLWA 2ZJPF 1VQOI 5GAHJ 1MMSA 3TNDB 5DM7F 1YITI 2FOWA 2RO3A 3G4SI 1FOXA 3CCSI 3J7YJ 2RO5A 1Z0RA 1YJNI 2QEXI 4IOAF 2L66A 3DLLF 2K1NA 1ACIA 5GAGJ 2ZJRF 4IOCF 2W1TB 1YHQI 1YIJI 1VQPI 3CC4I 1Y39A 3O27A 1VQKI 2FY9A 3CMAI 1VQ7I 2OTLI 2NXNB 1VQLI 1YFBA 2E35A 1YSFA 3I55I 3J7ZI 1VQ9I 5JVGF 3I56I 3CF5F 4UY8I 5GAEJ 1VQ5I 3CJTB 3CCJI 4V19K 3G71I 2RO4A 1YI2I 4JDMA 2H8WA 1VQ4I 2W1TA 2QA4I 1S72I 2JQ7A 5ITJA 1MVFD 2OTJI 1HC8A 3G6EI 3CCEI 2K3FA 3CCRI 5GADJ 3PIPF 1VQMI 4JDOA 1FOWA 4IO9F 3CMEI 5DM6F 1UB4C 1FOYA 3PIOF 3CD6I 2E34A 1QA6A 3CC7I 1YJ9I 3CCQI 3CCVI 3CCUI 1YJWI 3CC2I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZJQ F;  1VQ8 I;  1VQN I;  3CCL I;  2E36 A;  3CCM I;  1VQ6 I;  2ZJP F;  1VQO I;  5GAH J;  1MMS A;  5DM7 F;  1YIT I;  2FOW A;  3G4S I;  1FOX A;  3CCS I;  3J7Y J;  1YJN I;  2QEX I;  4IOA F;  3DLL F;  1ACI A;  5GAG J;  2ZJR F;  4IOC F;  1YHQ I;  1YIJ I;  1VQP I;  3CC4 I;  1Y39 A;  1VQK I;  3CMA I;  1VQ7 I;  2OTL I;  2NXN B;  1VQL I;  2E35 A;  3I55 I;  3J7Z I;  1VQ9 I;  5JVG F;  3I56 I;  3CF5 F;  4UY8 I;  5GAE J;  1VQ5 I;  3CJT B;  3CCJ I;  4V19 K;  3G71 I;  1YI2 I;  2H8W A;  1VQ4 I;  2QA4 I;  1S72 I;  2JQ7 A;  2OTJ I;  1HC8 A;  3G6E I;  3CCE I;  2K3F A;  3CCR I;  5GAD J;  3PIP F;  1VQM I;  1FOW A;  4IO9 F;  3CME I;  5DM6 F;  1FOY A;  3PIO F;  3CD6 I;  2E34 A;  1QA6 A;  3CC7 I;  1YJ9 I;  3CCQ I;  3CCV I;  3CCU I;  1YJW I;  3CC2 I; 
#chains in the Genus database with same CATH topology
 3D0S A;  3RKY A;  1VQN I;  2ZME C;  1XB4 A;  1WGX A;  3UR3 C;  4GO1 A;  3HL2 A;  2GM4 A;  2GLO A;  1P4A A;  4EGY A;  1Q1V A;  1SAN A;  1SD5 A;  3S1R J;  1HW1 A;  3BT9 A;  1NH3 A;  2ME6 A;  4EJU A;  3V7S A;  1KGS A;  2FNP A;  2Z5U A;  3KX2 A;  2W82 A;  3O2P E;  1YIT I;  5LEK A;  2NAZ A;  2EA2 A;  2P6T A;  3S3M A;  4HNU A;  1Z9C A;  3ISP A;  2O61 A;  1WJA A;  4UB6 C;  1IN4 A;  3E1S A;  2DLL A;  2LDU A;  1HF0 A;  2EZL A;  2QEX I;  1X3W B;  4PJM A;  3CUQ C;  4ZDP A;  1OCO H;  2QQB A;  3JAM Z;  1RKW A;  5CVR A;  4BJ5 C;  1ZH5 A;  2VLA A;  2IVM A;  3OYI A;  5CKT A;  2HPM A;  2VBZ A;  1NHA A;  2QYO A;  3IKV A;  3S16 J;  3HEF A;  1GUU A;  1T2K A;  2E1N A;  9ANT A;  2V9K A;  2KPM A;  1QO0 D;  1IN5 A;  2QBY A;  2RN7 A;  1X4O A;  1X1P A;  1K7A A;  3A0B C;  5IYC J;  2XSJ C;  4JOM A;  3OY9 A;  1IN8 A;  1IXR C;  2L7Z A;  5AIP A;  2HVR A;  3CDI A;  3LA2 A;  5IP6 A;  2NNN A;  4XLC A;  5D5W B;  2V4J C;  3DTI A;  3EUA A;  4H4K C;  3GTK J;  1BA5 A;  1MH3 A;  3KLN A;  3GTP J;  2M34 A;  1YW7 A;  3CO7 C;  3DPL C;  3KYD B;  3RDI A;  4ZC3 A;  1YIO A;  3K9T A;  2L4M A;  2IS1 A;  1MSF C;  5HS8 A;  5HNF A;  3FXL A;  2V1U A;  5M5X J;  4HNV A;  2NS8 A;  3BR6 A;  1SFU A;  2XGE A;  1IF1 A;  1E0E A;  2E7W A;  5C44 J;  4UUS A;  2PMH A;  1YW9 A;  4XRM A;  3G1L A;  1FOY A;  1P4X A;  3S1N J;  2GXB A;  1PUE E;  2GQQ A;  3S3N A;  3L7W A;  4M74 A;  1ZGJ A;  3FMQ A;  2GZW A;  1MMD A;  2ZXW H;  2HFH A;  4HZF A;  4MQV A;  2FRH A;  4WXD A;  2DOE A;  4OAY A;  2Z1D A;  2LVS A;  2VPR A;  1ZAR A;  2L9N A;  3IRQ A;  4L5I A;  3C2H A;  3TDU C;  3WTZ A;  2CQQ A;  3H3Z A;  1Z77 A;  1AWC A;  3JSP A;  3F8C A;  2OZ6 A;  1U9N A;  5J1U A;  3I71 A;  1JKR C;  4KDP A;  1P2F A;  4Y3O A;  2EB7 A;  4C9Y A;  4DYQ A;  4A3E J;  1JT0 A;  2F4O B;  1X19 A;  4A3F J;  3GYH X;  2R7S A;  4G6Q A;  3OYB A;  2A61 A;  4XLP F;  2H6C A;  2KZV A;  4M71 A;  1D3Y A;  2VAS A;  3ZN0 A;  4LLN A;  1EKE A;  4I02 A;  3HPG A;  3L2U A;  1W36 D;  2M2E A;  1Z0R A;  1XMX A;  2XB0 X;  1J09 A;  1NG7 A;  2KQR A;  3KEY A;  2V26 A;  3QPH A;  4RGU A;  3U2R A;  1IGN A;  4XIC A;  4QWQ A;  2Q2E B;  1FYM A;  3S17 J;  3J80 K;  2NVU B;  3G3Z A;  3RPU A;  3GFI A;  1S3J A;  1WJE A;  3M4O J;  4OIN F;  2FBI A;  2LYC A;  3T1B A;  4BQQ A;  4A12 A;  1K79 A;  3ABK H;  2CH0 A;  3ONQ A;  4FAS D;  1J75 A;  3SDG A;  1GV2 A;  5CVU A;  4I01 A;  3L2W A;  1ZEL A;  2JVH A;  4I0A A;  2RGV A;  3BLY A;  2M4G A;  2Y30 A;  4MTE A;  2HU9 A;  1S7E A;  1JKQ C;  1TQM A;  4JQF A;  5KK1 A;  5F04 A;  2WAF A;  3IWF A;  3U21 A;  2NVY J;  3TDZ C;  2VT3 A;  3MWM A;  2F2E A;  5LHG A;  5EGO B;  5KAF C;  3RQ4 A;  1LUJ B;  4F93 B;  2JA8 J;  2AXT C;  1UG2 A;  2R7X A;  2HKO A;  3OYE A;  4XKW A;  3BOQ A;  1K4S A;  3HXL A;  1ERD A;  1ETW A;  3L9F A;  2R5Y B;  3HGG A;  5HDK A;  2MYS A;  5F0F A;  2JT1 A;  4LIT A;  3CDH A;  5F27 A;  2VKE A;  4AD9 A;  2W1T A;  2D2W A;  2W1O A;  1H8A C;  2TRT A;  1J0R A;  2V79 A;  4DIQ A;  2WB1 A;  1R7J A;  1LFU P;  3ABT A;  3H0D A;  1HSJ A;  4JDO A;  4RGX A;  4AYB N;  1KZH A;  1BIA A;  3V7R A;  4U0V A;  2L2O A;  5EEH A;  1ZG1 A;  2XRL A;  2RC4 A;  3QPS A;  3A01 A;  1WSU A;  3LQQ A;  1O3T A;  1U5T C;  3FIS A;  3ZQH A;  2W48 A;  4P1W A;  4LB5 A;  2YSR A;  2ECB A;  1ZAO A;  4UVC A;  3ZOB A;  1R00 A;  2QQ9 A;  3CCV I;  3EUH C;  4ANJ A;  3PNV A;  1YW8 A;  3HRS A;  4XKB A;  2OJE D;  3OMY A;  4I99 C;  2MLG A;  1FIP A;  1HXD A;  1AOY A;  3CCM I;  2GLW A;  1TZL A;  1YLF A;  4G7O F;  1I6X A;  2P5K A;  3I0T A;  3ZQQ A;  1T0F A;  3GLX A;  1HKS A;  4UUV A;  1S7A A;  4IJA A;  5J47 A;  2P6S A;  3OYK A;  1GVJ A;  4OIO F;  1YG2 A;  2ZJ2 A;  1FMV A;  1ETY A;  3L2R A;  3TW6 A;  3P5J A;  1G4D A;  4L9N A;  1MNM C;  2ICW G;  1W0T A;  3IHU A;  3K4M A;  1FX7 A;  5M3F J;  2P0W A;  2L66 A;  2JA6 J;  4C3H J;  2LNB A;  3P9K A;  1UB9 A;  1B59 A;  3LOC A;  1K83 J;  3F23 A;  3PJR A;  2ZC2 A;  3OS1 A;  3R60 A;  3ZRG A;  2BHZ A;  5F1J A;  3GTM J;  3I53 A;  4GGG A;  2ZJR F;  1KU2 A;  2M4K A;  3GME A;  1MBE A;  4YG2 F;  3SEZ A;  4G6D A;  4CHU A;  4N4N B;  3FMR A;  3O6B B;  5C4J J;  4ZTF A;  1QQI A;  2QBY B;  2F48 A;  2FY9 A;  2FNA A;  3AG2 H;  1HLV A;  2EV5 A;  3FWE A;  4BL0 B;  2KKO A;  2P7C B;  3GUD A;  3FBI B;  1ZG3 A;  5E3N A;  2QSH X;  4E7I A;  3ZPL A;  1YTY A;  4X6A J;  4RGS A;  1KYW A;  4A0Z A;  5BPI A;  3FF5 A;  3GVA A;  4XOT A;  1LE8 B;  2IGO A;  1ZYR F;  4HF2 A;  3RKX A;  1ORK A;  3LSJ A;  3C7J A;  2PMZ N;  4B3A A;  2DMN A;  4OAZ A;  3K4N A;  3J7Z I;  1YE9 A;  3OYN A;  2R0Q C;  3I56 I;  1MKM A;  3TGN A;  1JUM A;  2Q0O A;  1TWF J;  4PJL A;  4B43 A;  3CCJ I;  1DDN A;  2V9V A;  5E3L A;  5E1Z B;  4RLF A;  1T39 A;  5CJ9 A;  2R7U A;  3LFK A;  3T0Y A;  2A69 F;  2CS3 A;  2OTJ I;  3K1P A;  3DFG A;  2LSO A;  3OYL A;  3DV8 A;  2IRF G;  1IRZ A;  1QPI A;  1RKT A;  4EV0 A;  1WJF A;  1B8I A;  1Z7U A;  3QQA A;  2V1N A;  3GLL A;  3QP6 A;  2ACJ A;  2O6G E;  3OYD A;  2WAQ A;  1TP4 A;  2O8K A;  4UNO A;  1IAW A;  4EJV A;  2Y0S N;  4I7H A;  3OR2 C;  2DW4 A;  2YS9 A;  2PJR B;  1B1B A;  4AM3 A;  2VON A;  3F8B A;  5J6X A;  1GXQ A;  1R36 A;  2ZFW A;  1KQ9 A;  3ZQL A;  1Z05 A;  4J19 A;  4R79 A;  1JKO C;  2QEN A;  2VC0 A;  3IP4 B;  3RKQ A;  4PJ0 C;  1TTY A;  5HOO A;  1WJ5 A;  3R6S A;  3K2Z A;  2NS0 A;  2L01 A;  4MQ9 F;  3BWG A;  2L4A A;  5E8I A;  5L3B A;  3A0H C;  2VKD A;  4Z6Y A;  3N97 A;  3I59 A;  4OIP F;  4G94 A;  1Q1H A;  1SFK A;  4N0B A;  1H88 C;  4OWR B;  3HM5 A;  3HOV J;  2EIN H;  4MFE A;  3OS0 A;  2H1L A;  4BE2 A;  3SXY A;  5K7H A;  1ZRF A;  3CP8 A;  3WG9 A;  3H9J A;  2AS5 F;  4UHT A;  2CYY A;  5K5Q A;  3GZ5 A;  5TJJ A;  5IT9 K;  4V2F A;  5DYM A;  3SZG A;  4AWX B;  2K9L A;  3DLL F;  1W7P B;  2H8R A;  1KQ8 A;  3MMY B;  2L9S A;  1TW3 A;  1B72 B;  3F9K A;  3K10 A;  1H0M A;  3EET A;  2RVC A;  1V4R A;  4AU7 A;  2DXI A;  4A3L J;  1HDD C;  1UMQ A;  3A1Y A;  3CUQ B;  3IUO A;  1Y39 A;  3O27 A;  4NQW A;  3K1M A;  1W7P D;  4CYC B;  3CMA I;  4LJZ F;  2HVS A;  1V54 H;  2R7Q A;  4PGG A;  4ESB A;  2A68 F;  2GA2 A;  4RB0 A;  3HOU J;  2VQL A;  3BTJ A;  4HBL A;  3KP6 A;  1ZGA A;  1RC9 A;  2NOJ B;  1OFC X;  2PBI A;  2HS5 A;  3WU1 B;  4FIS A;  3I55 I;  2AO9 A;  4JX4 A;  4NHJ A;  2VJI A;  3HOY J;  2F4M B;  3VSK A;  1M1E B;  3V8L A;  2YR2 A;  2X85 A;  4E7H A;  2BZT A;  3PUF A;  2H8W A;  3QOE A;  2IA0 A;  1R1V A;  4CZC A;  3WTW C;  1TWC J;  4BDY A;  3BTI A;  1MVF D;  3G6E I;  3BPX A;  4ZTJ A;  1U0J A;  5CQG A;  1LFP A;  3KYC B;  4A5N A;  1RUO A;  4F7Z A;  4U88 A;  3B73 A;  2YU3 A;  2JUC A;  3A01 B;  2QCO A;  3K69 A;  1T6S A;  5DTD A;  1OCZ H;  2M8G X;  1I5Z A;  2BEO A;  5IP7 J;  5LGT A;  5IOY A;  3HKZ A;  1STZ A;  2MA3 A;  3BJ6 A;  4QSH A;  5J3L A;  5LGU A;  2XRN A;  4B47 A;  4BGD A;  1UHM A;  1JHH A;  3IAS 2;  2R7R A;  1LB2 A;  4G7H F;  3I54 A;  3ML6 A;  2CUE A;  3IAM 2;  1MBG A;  2JJ7 A;  4KA4 A;  2ESN A;  4CZZ A;  2ADU A;  2KJC A;  4XQF A;  2OPT A;  1VQ8 I;  4KIT B;  2VOO A;  2G9W A;  1DU0 A;  4IQJ A;  2IGM A;  3CCL I;  2KJB A;  3LSK A;  2JRT A;  2JSP A;  4GFB A;  3OL3 A;  2LP0 A;  4ZYD A;  1OYY A;  3TKY A;  2IJL A;  2ZJP F;  4BBR J;  1ODD A;  1Z91 A;  1MMS A;  5F08 A;  4HLY A;  4DYC A;  1SFO J;  5J8C A;  3K7A J;  2A6E F;  1BR4 A;  2LR8 A;  3BR0 A;  1V55 H;  2CFX A;  4XRF A;  2EIJ H;  3F6O A;  2JPC A;  4DBR A;  2BHY A;  2ZO4 A;  3EPZ A;  1Z7L A;  4N9I A;  3F6V A;  3S93 A;  4NC6 A;  2DA2 A;  3M1C A;  4B48 A;  1FYL A;  3AL0 C;  4ZYA A;  2DT6 A;  1I1S A;  2K5C A;  3AAF A;  3RSN A;  2B7E A;  3HYI A;  2Y75 A;  4EAT A;  2NYX A;  2FUG 2;  2UUZ A;  3GBG A;  1A5J A;  1OLT A;  5JVT A;  1R5G A;  4XOP A;  4YIF A;  5DS9 A;  2RNJ A;  1W1W E;  3OOP A;  2OA4 A;  3QU3 A;  2HDW A;  4Y4R A;  1YS6 A;  4O5V A;  3M1E A;  2E2H J;  4F91 B;  1R1U A;  3H92 A;  2CV0 A;  1QU3 A;  2STW A;  2XGD A;  2LRD A;  2ZSI B;  1YSF A;  1T95 A;  4WWC A;  5JI6 A;  1E3H A;  3R0J A;  3E3V A;  2XSD C;  4YIR X;  4HA8 A;  2XAG A;  2Q2E A;  2O03 A;  2J5P A;  3C18 A;  2I5U A;  4I76 A;  5GAE J;  1MJA A;  4KJZ A;  4BUP A;  4A3D J;  5FLX Z;  4JX6 A;  4UXN A;  3QPL A;  3BTL A;  4L9T A;  2WB1 N;  4WX9 A;  2D45 A;  2H27 A;  3LSI A;  1AHD P;  1G6N A;  1K6Y A;  1S72 I;  1E2X A;  3PL8 A;  3WTT C;  2LD5 A;  2CUZ A;  4E7Z A;  1CGP A;  5TRD A;  2MC4 A;  3CDL A;  2JZY A;  2VN2 A;  1EV7 A;  3ZMU A;  2W84 A;  3AG4 H;  1R49 A;  4BQA A;  1OYW A;  4XLH A;  5ILS A;  1B9N A;  4CCJ A;  5JLW A;  2ID6 A;  1HCR A;  5EF6 A;  3NAU A;  2R7V A;  5BMZ A;  3ZMV A;  2KIS A;  2P4W A;  4C30 A;  2CUJ A;  5KHD A;  3E7L A;  3OIO A;  3H0G J;  1FBU A;  1MND A;  2DFI A;  3ZN1 A;  2R5Y A;  4LLL A;  2CJJ A;  3HSE A;  4CIC A;  1BR1 A;  3CCQ I;  2HYJ A;  3TL4 X;  1R22 A;  2X51 A;  2FF4 A;  2DFH A;  2CV1 A;  3EDP A;  4MTD A;  3QYF A;  4Y17 A;  3KFW X;  3CO6 C;  4XID A;  1YX5 A;  2DMQ A;  1MMA A;  1XG1 A;  4RA2 A;  1U5T B;  2HR3 A;  3I59 B;  3K4B A;  4YRV A;  4QPQ A;  1J7K A;  5DV5 A;  5IP9 J;  2Y9Z A;  1QVU A;  2K02 A;  1XGN A;  4IHV A;  4D1Q A;  1QHH D;  1ZN2 A;  3PFY A;  4BHB A;  1OYI A;  1A35 A;  3VSL A;  3F0C A;  4YFK F;  3S1M J;  4HX7 A;  2RO3 A;  1BI2 A;  2FOK A;  1IN7 A;  3C1D A;  2DOF A;  2F6C A;  1V5E A;  2V1D A;  1DPU A;  1MSE C;  4XN3 A;  1YJN I;  2XGC A;  1ULY A;  2DT7 B;  1JUP A;  5E8G A;  1DGW Y;  3ABM H;  5ICE A;  1I3A A;  4IHX A;  3TOA A;  1RUN A;  2DTZ A;  5GPC A;  3V4G A;  4HLX A;  3F22 A;  2OUM A;  3BG5 A;  3HSF A;  4XLN F;  4MO7 A;  2M87 A;  2DA3 A;  4JP0 A;  5E79 C;  2CQ7 A;  1RNL A;  1XGM A;  5HLI A;  3ZQ7 A;  4E4H A;  3MKY B;  3HOW J;  3L09 A;  4NQW B;  1IZ1 A;  3F3X A;  2A07 F;  2GOX B;  2FXA A;  2QSG X;  3JCU C;  1PUF B;  3L00 A;  4OIR F;  4CA0 A;  3FZV A;  2LBF B;  1U78 A;  2X6X A;  3Q0W A;  2KIM A;  3ZP5 A;  2K9S A;  4HG2 A;  1YS7 A;  4Y33 A;  1DUX C;  1S9H A;  2IT0 A;  3WGH A;  4D0P A;  4LGW A;  4KFC A;  2E35 A;  4M9Z A;  4A3B J;  5ICC A;  1LPQ A;  3IH2 A;  1MJ9 A;  3O3K A;  4UUT A;  3JRF A;  5CQE A;  1P4W A;  1SVM A;  1MZB A;  2O8X A;  2F5V A;  3FXU A;  3R4K A;  3JRH A;  2OQR A;  3DU6 A;  5TGT A;  2M7B A;  5E1W A;  2OCE A;  4BEH A;  2NNY A;  2Z33 A;  2E2J J;  1QVT A;  1P6R A;  4N4O B;  2WAQ N;  5D4S A;  4A3C J;  4CGZ A;  1OR7 C;  4QIW N;  3IC7 A;  3TOB A;  1WFX A;  2FQ4 A;  1SD4 A;  3KP5 A;  3CCR I;  1WRJ A;  2HGC A;  1BW5 A;  1XCB A;  1P9Q C;  2FU4 A;  3COA C;  3MFK A;  4DW6 A;  4M3B A;  2DN0 A;  4B09 A;  1LE8 A;  1UFM A;  4YEL A;  3WOD F;  1ZRC A;  3I4M J;  1TLH B;  3HHH A;  4RDU A;  5FLM J;  3NRV A;  4I98 B;  4PUS A;  2XVC A;  4M6Y A;  4PJN A;  3OYC A;  1O7F A;  3LNQ A;  3I3L A;  4PGH A;  1UST A;  2DQR A;  3I4P A;  2FML A;  2PLY A;  2X1C A;  5HS7 A;  3OS2 A;  4RB1 A;  4BAY A;  4ENM A;  3B02 A;  2XAH A;  2M5W A;  4KN7 X;  2B0L A;  4N9H A;  2OF7 A;  3F8F A;  2IPQ X;  4ESJ A;  5FGM A;  3VYR B;  4XON A;  2P81 A;  1T38 A;  3DEW A;  1J59 A;  3HOT A;  2AXL A;  1IJW C;  3IRR A;  2O3F A;  4C2M J;  4B44 A;  2PJR A;  2CW7 A;  4XN0 A;  2XPW A;  4RLQ A;  5ILU A;  5E3O A;  1FPQ A;  5K5O A;  3QYB A;  2W85 A;  1X1A A;  3ABU A;  4WK8 F;  1TWH J;  4XBF A;  4AC0 A;  4RAF A;  4XLE A;  4NC7 A;  2LKS A;  3W2V A;  3CJN A;  1D1C A;  3JR9 A;  3FBN B;  2YUS A;  2CUF A;  5CVI A;  3MKL A;  5GAG J;  1WPK A;  2ZXI A;  4NNJ A;  3QYE A;  4S0H B;  2HTS A;  3GFM A;  4FCY A;  4DZJ A;  1YIJ I;  1VQP I;  1IXC A;  1D1A A;  1HW5 A;  2FA5 A;  3IL2 A;  1KQ0 A;  3OYA A;  2BBY A;  1LVA A;  1T8I A;  2ZME A;  3GTJ J;  1FTT A;  5D6F A;  2G0E A;  4A3G J;  2H1K A;  2OAZ A;  1X1D A;  2XIG A;  3H1C A;  1BIB A;  3JTH A;  2K9Q A;  4DJA A;  4A69 C;  3TED A;  1HKT A;  3L2Q A;  2KIQ A;  3I5U A;  1FC3 A;  2DYR H;  2ZNZ A;  1W7P A;  4M9S A;  3N4M A;  3I4N J;  3FXM A;  1P7J A;  3C2G A;  1OIS A;  4A6D A;  1B72 A;  3TQN A;  4E7K A;  1VQ5 I;  4CSW A;  2ME0 A;  5DD8 A;  4EGZ A;  5ICG A;  2KDZ A;  1MDM A;  4JDM A;  1ON2 A;  3CP2 A;  1YQA A;  3BZC A;  1OPC A;  2E60 A;  4XSZ F;  4U0W A;  5FRO A;  2O9L A;  2RRE A;  3CUQ A;  3HG9 A;  1ZLK A;  5H6Q A;  3CCE I;  2DBB A;  1UEL B;  2ZNY A;  4CYC A;  2R5Z B;  2DPD A;  4KN4 X;  3LAP A;  2OQG A;  1SEU A;  3DKW A;  3HKZ N;  4CO8 A;  3D5S C;  5LHI A;  2FBH A;  3QPT A;  5B1A H;  2KIF A;  2AQF A;  3R61 A;  1R23 A;  1ZTR A;  2COM A;  4RAZ A;  4IPA A;  4RS8 A;  2KIU A;  4LIV A;  1WHU A;  1SD7 A;  2E34 A;  4RM3 A;  5J4Y A;  2L7M P;  4KIC A;  1FEX A;  1UG0 A;  4KYW A;  4MGR A;  1W5C C;  3FX3 A;  4BHP A;  2IAI A;  2L0K A;  1YJW I;  1SVL A;  2CMP A;  3BG6 A;  4HF1 A;  2JA5 J;  2XPV A;  1ENH A;  3EQL F;  5ITM A;  1TBX A;  2X4H A;  1SFX A;  4M9X A;  4GCV A;  1PJR A;  2BW3 B;  4DQ2 A;  2HEO A;  3W6J B;  4PK4 A;  2C6Y A;  5FRM A;  2IA1 A;  1LDK B;  4O6J A;  5GTI C;  3IWZ A;  5J1Y A;  3S2H J;  3DF8 A;  1P92 A;  2E71 A;  1HDP A;  1ON1 A;  2P8T A;  4JK1 X;  4HV5 A;  1CF7 B;  2GXA A;  3DKY A;  4KT6 A;  5DM7 F;  2MH2 A;  2HOT A;  2JA2 A;  4EJT A;  1PYV A;  2KMU A;  3ZR8 X;  4IRH A;  4I2O A;  1AKH A;  4OMZ A;  2DFE A;  4FET A;  1BI1 A;  2EFP A;  2NVT J;  5B5E C;  5FKK A;  2D1V A;  1XS9 A;  2YPR A;  4IOA F;  1OJL A;  2A3S A;  2FBK A;  1TQP A;  3RIR A;  3GTQ J;  3OIQ A;  1WI9 A;  2IS6 A;  1AA7 A;  4M73 A;  2I10 A;  1MBJ A;  3VYT B;  3DPT A;  2BXY A;  4P9F A;  1ACI A;  3HRU A;  4JX5 A;  2QM3 A;  3V42 A;  2L9R A;  3FDY A;  3QOP A;  4IF4 A;  1R6R A;  4I09 A;  4BE1 A;  2R93 J;  4IHW A;  2EWN A;  1FP2 A;  3ELK A;  4WXH A;  2GA1 A;  3MEX A;  4IKF A;  1G3Y A;  4PFO A;  3HDD A;  1K78 B;  4CCN A;  3V8J A;  2E5Z A;  5M5W J;  4C3J J;  1WKM A;  2QKL B;  1S29 A;  3AKZ A;  5TIS C;  1ZR2 A;  5GPA A;  3U1K A;  1UHW A;  2YX4 A;  3A2K A;  5BOX A;  2VOP A;  4JBA A;  3AG3 H;  4BYY A;  4XRS A;  1D1B A;  1YFB A;  2UZK A;  2E1M C;  1EJ9 A;  3E5U A;  3IH3 A;  2BXZ A;  4A3I J;  1ZK8 A;  4XLA A;  1N25 A;  3DQV C;  1IV8 A;  4BEH B;  2RO4 A;  3HB9 A;  2XAQ A;  2BY0 A;  2TDX A;  2D1H A;  2JQ7 A;  2L7K A;  3I64 A;  2F4I A;  3GTL J;  3FK7 A;  2WAD A;  1OCT C;  2VJ5 A;  3VDX A;  4BQO A;  3LMM A;  2CV2 A;  3KIO A;  1LDD A;  1IC8 A;  1IG7 A;  3QP5 A;  3CMY A;  1UAA A;  1S7O A;  2BV6 A;  2L02 A;  5F64 A;  3WGG A;  4MEX F;  2HQA A;  4G7Z F;  5F0C A;  2NS7 A;  3MZH A;  3BQY A;  2AQE A;  5L3E A;  4WXC A;  4FX0 A;  3ZMZ A;  3AFH A;  1DGR M;  4RB2 C;  4IHY A;  1TWA J;  3ECO A;  3LA3 A;  4D9J A;  5H2F C;  1LFB A;  1Z67 A;  1IN6 A;  2K27 A;  2K85 A;  3DTE A;  2MFZ A;  3HZJ A;  2XUB A;  4KIB A;  2VB6 A;  4ZJZ A;  4EJO A;  2DJI A;  1I3Q J;  5LFA A;  1L3L A;  2XKO A;  3WTV C;  2IS4 A;  2WY7 Q;  3M8F A;  2VC1 A;  3KZI C;  2IS2 A;  3KP2 A;  3L2V A;  5EZH A;  4KNY A;  3VOE A;  5M3M J;  2HDD A;  1TC3 C;  3H5A A;  4ON0 A;  4RBO A;  1BBY A;  1C0W A;  4C2U A;  4LG0 B;  4LOC A;  2GBY A;  1U8B A;  4HSR A;  1JJ6 C;  2VKH A;  3MZY A;  1EF4 A;  5FKN A;  4XKC A;  1QNT A;  2V1X A;  3VYU B;  2MC3 A;  1X4P A;  4A5M A;  1U6G A;  2DDA A;  3GTG J;  2K86 A;  1XPX A;  4FE7 A;  3SJM A;  1DP7 P;  1IUY A;  2XF5 A;  3BJA A;  4IRG A;  2M1B A;  4KMF A;  3BG7 A;  1IRX A;  2MSY A;  1ZQ3 P;  2K1N A;  3KP4 A;  5L3G A;  1QZY A;  4M3E A;  1Z1D A;  4FHT A;  3OSF A;  1U5T A;  2CW8 A;  2VIX A;  2QWW A;  4PJJ A;  4UVB A;  5E18 F;  3GX4 X;  2EV6 A;  2V6E A;  2BY1 A;  4CDG A;  3D5R C;  4Y15 A;  1N78 A;  3BY6 A;  5DEQ A;  3TO7 A;  4IL6 C;  3EUH A;  1G8X A;  4BNC A;  1Z21 A;  2K4B A;  3W2W A;  2MG4 A;  2ZME B;  5IPA A;  4YFN F;  2VPL A;  4BJ6 C;  1D8K A;  3FK6 A;  1JXS A;  2HNH A;  4HX4 A;  4LFU A;  3PNT A;  1V5F A;  2LY2 A;  3IV5 A;  4JYK A;  4MLO A;  2DMU A;  3K0L A;  2QKM B;  2OU2 A;  1IRF A;  1FOK A;  4ASN A;  3KZZ A;  3LSM A;  1G2H A;  3SZT A;  2AHQ A;  2CQN A;  2OC6 A;  4ENK A;  1MDM B;  3M07 A;  2IA2 A;  4HAM A;  2YU9 J;  3A4C A;  2W57 A;  5ILV A;  2LOO A;  1XMA A;  3PUB A;  3DXJ F;  4OIQ F;  3L1P A;  1ZRE A;  1LEA A;  2ZXH A;  5IT3 A;  3MKZ A;  3T5X A;  5FFZ A;  1FBS A;  2F5C A;  4HNT A;  4C3I J;  2KFD A;  3FKJ A;  1PUF A;  4IEJ A;  1SD6 A;  2IGN A;  2EIK H;  4ZH4 F;  2LBF A;  4ABZ A;  5CPR B;  3GFJ A;  4E7L A;  1BOB A;  5LHH A;  3SDB A;  2RKH A;  4V2G A;  3CES A;  5K5R A;  2K40 A;  3E6M A;  1R4M B;  3PSI A;  1KYZ A;  1X3Z B;  4LIU A;  1NK3 P;  4IVN A;  5FD5 A;  4CH7 A;  5J40 A;  3RPU D;  3D5L A;  2FQ3 A;  2L5Q A;  3NWS A;  4BQN A;  4GRI A;  2HQN A;  1XTA A;  3CC2 I;  3BR3 A;  2DMT A;  5D5X B;  2XHK A;  4U7B A;  1IDY A;  2LKX A;  2E36 A;  2PG4 A;  2VXZ A;  2LG4 A;  1B9M A;  3A03 A;  4X0G A;  4EVI A;  2RNG A;  2CFO A;  2FSW A;  2EH3 A;  1RIO H;  5FO5 A;  2MH9 A;  3F21 A;  2B63 J;  1AKH B;  1QZZ A;  2EQR A;  3M8J A;  2E19 A;  3G4S I;  4A0X A;  1R71 A;  5CVJ A;  1YO5 C;  2STT A;  4B8X A;  4MFD A;  5K7F A;  2RO5 A;  3A02 A;  1QPM A;  1W5S A;  4Q5S F;  1QRY A;  3LFU A;  2ISY A;  3H9Q A;  3EYY A;  4KMU X;  4UV8 A;  1PDN C;  5J4V A;  1ZGW A;  3ABL H;  4FX4 A;  2HI3 A;  4M72 A;  3LA7 A;  2ZFU A;  3ZMS A;  4J01 A;  4U7D A;  3K6G A;  3HBL A;  3S2D J;  1RR8 C;  1VQ7 I;  1XDU A;  3ZXS A;  2GAU A;  3ZMD A;  5AON A;  2IXS A;  4ZYH A;  2OTL I;  2ZSH B;  3G73 A;  1UHS A;  2VBW A;  2QQ8 A;  5E17 F;  5LBQ A;  3JTG A;  4P5O A;  1F9N A;  1OKR A;  1MD0 A;  2L3D A;  1RRJ A;  1D0X A;  2R7W A;  5C3E J;  5EEA A;  2MD5 A;  1B4A A;  1HST A;  3V8K A;  1U8R A;  1BW6 A;  2DOA A;  3OYF A;  2NVX J;  2LK2 A;  3PQJ A;  1P7I A;  5DDG A;  1ETO A;  2CQX A;  2DI3 A;  5ED4 A;  3G2B A;  4HQE A;  2P7V B;  2QUF A;  2JN6 A;  4RGR A;  2VBX A;  1DPR A;  5A2Q K;  2XC7 A;  5JLX A;  1I39 A;  1MBH A;  2Y31 A;  4XMY A;  2KHM A;  4HEA 2;  3QWL A;  2Y9Y A;  4A3K J;  4XRS G;  3VYS B;  3HHG A;  2E7X A;  4L5E A;  4DGW B;  1FOW A;  3H35 A;  3SQN A;  4IO9 F;  4OMY A;  4GDF A;  2HOS A;  1O3Q A;  4XOR A;  1LEB A;  2HQ5 A;  4XL9 A;  5IY5 H;  1WH5 A;  3WU0 A;  3VFZ A;  2W7N A;  1YJ9 I;  2GIV A;  3PSF A;  1IRG A;  3PM1 A;  2JA7 J;  2HQR A;  2BYV E;  1BI3 A;  3JRB A;  4XR6 A;  1YOV B;  4CXF A;  3CCU I;  1DQU A;  2D5V A;  1J9I A;  4W1U A;  1UCR A;  4UB8 C;  4IX7 A;  4O3M A;  1SVO A;  3DPU A;  2PFB A;  1BC7 C;  1JHF A;  1G3T A;  1KU7 A;  2R5Z A;  3H9G A;  2M9H A;  5D5V B;  1YRN B;  4LG3 A;  3TP3 A;  1ZKG A;  2BY2 A;  4Z2Y A;  4ZZD A;  4I0B A;  1FY7 A;  3PO2 J;  2XDV A;  1TT5 B;  1JTY A;  2IBD A;  2EIL H;  3KP7 A;  5EDN A;  2P5V A;  3CF2 A;  2MW8 A;  1H9T A;  1OCR H;  3RKW A;  1TNT A;  3LQR A;  3VOD A;  4M3D A;  2L54 A;  3H3V K;  1FOX A;  1RPW A;  2A05 A;  3UNG C;  2VQG A;  5J8F A;  2L7F P;  4S05 A;  2EFQ A;  2OZU A;  1T56 A;  1XCV A;  4HOB A;  3P7N A;  3M7G A;  1HA8 A;  3J81 Z;  3JRE A;  1Y56 A;  3HRM A;  2BW3 A;  3LWF A;  2WV0 A;  3QRF F;  3HRT A;  1NG6 A;  3MZ8 A;  1RR7 A;  2HKX A;  2R7F A;  3Q0U A;  1FNN A;  1SAX A;  4XKV A;  5L3D A;  1CF7 A;  1XSV A;  1F1Z A;  4P9U A;  3GFL A;  4U0Y A;  5GTH C;  5EG0 B;  4A0Y A;  2LY1 A;  3TO6 A;  1K6O A;  3K4K A;  2ZCW A;  3W6K B;  3FXO A;  3VEP A;  4L9J A;  2DQL A;  3WTS C;  3ZMT A;  1U2W A;  1IXS B;  4PCQ A;  2QGU A;  2Z99 A;  2P5L C;  2X6O A;  3KZY A;  3DEU A;  5ERI A;  3FMS A;  2BOL A;  2WY8 Q;  3W2A A;  3K2A A;  3JRC A;  2HXI A;  2PEX A;  3RPQ A;  1HKQ A;  1POG A;  5K7Z A;  3CJT B;  3REO A;  1EH6 A;  2Z3Y A;  5E1X A;  4II2 A;  5JHU A;  1FMW A;  1JTX A;  2RV8 A;  4CCK A;  1X1B A;  1X1C A;  5ITJ A;  2ELJ A;  1R5H A;  2VT2 A;  3ZGK A;  5FJ8 J;  4EQQ A;  3H5R A;  2CO5 A;  4W97 A;  1VFC A;  2DU9 A;  1K78 A;  2K7L A;  4QTR A;  3MD2 A;  3FHZ A;  4AUX A;  2W25 A;  4I6Z A;  1WZ2 A;  3H3U A;  3BTC A;  4IXA A;  4DZP A;  4BU2 A;  1WWX A;  5LD2 C;  1E17 A;  1MIJ A;  2XF7 A;  3H36 A;  4L9V A;  3SHF A;  1TWG J;  1W4M A;  4XK4 A;  1WJD A;  4BKX A;  3BCB A;  1Y8R B;  2HWV A;  4RAG A;  1E3O C;  2ISZ A;  1XX5 A;  3FHN A;  1Y8Q B;  4LK1 F;  5FB2 A;  1ZRD A;  4D7M A;  4U87 A;  2XAJ A;  4HST A;  3BRO A;  3BCA A;  5B3S H;  3JAM K;  3GTO J;  2LTP A;  3E0J B;  3BR1 A;  1SMY F;  1WVR A;  3MCZ A;  1REP C;  3JW4 A;  1GT0 C;  3WTY C;  4Q4Z F;  5HLG A;  3OYM A;  1LQ1 A;  2WA0 A;  1QBJ A;  2UXX A;  1VQO I;  1U3E M;  3EYI A;  1HW2 A;  1UZC A;  4E6K G;  4NDL A;  5FRN A;  2M0C A;  3VPR A;  5H6R A;  5D8K B;  1ONV A;  3K4L A;  2E1C A;  3HTU A;  1OCC H;  1ETV A;  2JRM A;  1ZR4 A;  2VKV A;  3K1N A;  5KNL A;  3CCS I;  2DO7 A;  3M9A A;  4LK0 F;  2LH9 A;  3ECH A;  3OIP A;  2R7Z J;  3S14 J;  4G9Y A;  5IOZ A;  1A36 A;  1SFE A;  4FE4 A;  4RAY A;  5EJC A;  1FJL A;  5C4X J;  1WJC A;  4DNC A;  4AIK A;  1X58 A;  2IW5 A;  4IHS A;  4CCO A;  1LNW A;  2EV0 A;  2NVQ J;  5HOD A;  2M0M A;  4MIM A;  3BC8 A;  5JHF A;  2IGK A;  3J7A Y;  2HTJ A;  2Y48 A;  4GXO A;  2MLK A;  1KON A;  1V3F A;  1FP1 D;  4LG0 A;  4GYI A;  2DAO A;  2X48 A;  2FE3 A;  2X6W A;  1XSX A;  1S8N A;  3CLQ A;  4UV9 A;  1E3P A;  5CYV A;  1APL C;  4BH9 A;  2NXN B;  2JK3 A;  3JRA A;  1FSE A;  5DUI A;  2ZB9 A;  2GOM A;  1IUF A;  4Y7N J;  1I27 A;  3Q5F A;  2DPU A;  4LD5 A;  5BNG A;  3Q9V A;  3IH4 A;  2BVM A;  4B1R A;  4BAC A;  2UWM A;  1BOA A;  2M8E A;  1IW7 F;  1T0F C;  4LB6 B;  3RTR A;  2PI0 A;  1Z6R A;  2FMY A;  2ID3 A;  2PX9 A;  5IYD J;  2X1E A;  5HLT A;  2ELK A;  2E2I J;  3TO9 A;  2KRF A;  2DMP A;  4ZDL A;  5L3F A;  5D5U B;  1HC8 A;  4WF2 A;  3V7C A;  1J2X A;  3LL7 A;  2HYG D;  2VXD A;  1MNE A;  3ESW B;  5GAD J;  4C2T A;  1GDT A;  3IKT A;  2VQH A;  2FEZ A;  2Z16 A;  4OU0 A;  3UKG A;  1WCM J;  1UB4 C;  2VI6 A;  4CCM A;  2HZD A;  3WGI A;  4WCG A;  2QZ8 A;  3J80 Z;  2LF7 A;  4BS9 A;  3OV8 A;  4ESF A;  4EJW A;  1XC5 A;  3ERM A;  3GW2 A;  4PFP A;  5EZG A;  4A6E A;  2VUM J;  5JR3 A;  2KDO A;  2H09 A;  5E3M A;  1A6Q A;  3TMO A;  2A5W A;  2R92 J;  3CZ6 A;  3CLO A;  1FBQ A;  3VB2 A;  2EA4 A;  3U1D A;  2KLO A;  1GVD A;  3QU6 A;  1D0Y A;  1X3U A;  4EM2 A;  1T33 A;  3E5Q A;  4RMN A;  2WC2 A;  2M7A A;  3CMM A;  2CSO A;  3HOS A;  1DU6 A;  3OOU A;  1QGP A;  3OYH A;  1F36 A;  3BPV A;  4MEY F;  2FD5 A;  2HVQ A;  4PSW A;  3KPH A;  5GAH J;  1TW2 A;  2QF7 A;  2XAU A;  1MMN A;  3E6D A;  2DOD A;  2FOW A;  2JTV A;  4HF0 A;  5CLS A;  4A3M J;  1OR7 A;  1MBK A;  1BC8 C;  4CCL A;  2DJN A;  2RAE A;  2EZK A;  3CJR B;  3FM3 A;  3LSP A;  4M3F A;  1NTC A;  2DA7 A;  4YII A;  1MGT A;  3RJP A;  5B66 C;  3D1N I;  1R9T J;  3S1Q J;  1T08 B;  3RQI A;  3KLO A;  5BS6 A;  2ETH A;  2LLK A;  3W3C A;  4AIH A;  5K1Y A;  1JE8 A;  1BM9 A;  1B6A A;  1SAU A;  1XGO A;  3C2B A;  2Y2Z A;  1XN7 A;  3DU5 A;  3DKX A;  2PMU A;  2V9P A;  3GZN B;  4HQM A;  3CTA A;  2E5N A;  3OYJ A;  3CC4 I;  3BZK A;  2X0L A;  5IYB J;  2MBF A;  3SFI A;  5FFX A;  1VQK I;  5DCM B;  4HW0 A;  5FD6 A;  1F43 A;  4B3X A;  2MAB A;  1G59 A;  1VQL I;  2ZBK A;  4FTH A;  3WG7 H;  3K70 C;  4DYR A;  1IO2 A;  5EEG A;  2XKP A;  3ZQG A;  2IEK A;  3O8G A;  5DUK A;  2CWE A;  3BJO A;  1VQ9 I;  3S32 A;  3DTK A;  3OYG A;  5LGN A;  1MMG A;  4OOI A;  3RI4 A;  2CU7 A;  3HUG A;  4A3J J;  5LRR A;  3FKI J;  3E6B A;  1Z3Y A;  2BE5 F;  3DP7 A;  3LST A;  4F92 B;  4L18 B;  3PQK A;  3G71 I;  3WE2 A;  5HVQ C;  1QZE A;  1R5I D;  2BY3 A;  2X9D A;  2CQK A;  2QA4 I;  3AL0 B;  1T98 A;  2EFO A;  2Y0M A;  1WH7 A;  3P9C A;  3S3O A;  3C3W A;  2XGX A;  4QPO A;  3EUK L;  1Y1W J;  3FXJ A;  1H9G A;  3AG1 H;  3ULQ B;  2OV7 A;  2DT5 A;  1DP3 A;  2VJ4 A;  2GIZ A;  4PDK A;  2MGQ A;  4GYG A;  2LY9 A;  2HOE A;  3CME I;  5DM6 F;  2COB A;  5D8L B;  4KIF A;  1XGS A;  5EYR A;  3CC7 I;  1I50 J;  2G7U A;  3GO5 A;  2EK5 A;  2XV4 S;  4E7S A;  2QSF X;  2F5F A;  3G1O A;  3B6C A;  3FXR A;  1A04 A;  3L2C A;  1ZLJ A;  2HXO A;  5KVR A;  4HYE A;  2EPF A;  4BHC A;  3U9G A;  2JSC A;  2VE8 A;  5F6F A;  3KP3 A;  3TBI A;  2TCT A;  1ETX A;  4HRI A;  1EH7 A;  1D5V A;  3TW7 A;  4D5F A;  2EIM H;  1XD7 A;  1O57 A;  5CVV A;  1MW7 A;  1JT6 A;  3VWB A;  3TND B;  2VE9 A;  3J7A O;  1FSH A;  2XAS A;  1LJ9 A;  3N05 A;  2F5D A;  3BZ6 A;  4L0Y B;  4AID A;  3ROU A;  3WHC A;  1TT0 A;  3O8H A;  3S8P A;  1R58 A;  4D7N A;  3ZQI A;  2B9S A;  3Q0V A;  4CYD A;  2BGC A;  2LFB A;  2Z9O A;  3GWZ A;  3DBH B;  1KU9 A;  1OMI A;  4M6X A;  5H20 A;  1VTN C;  2NRA C;  5J1R A;  2EZI A;  3LAJ A;  3LSG A;  2KT0 A;  4KIS A;  1TQI A;  1Y1V J;  1AU7 A;  3KEO A;  3NWT A;  1YRN A;  4EEF G;  3K4C A;  1KU3 A;  3CCY A;  3X2Q H;  1D0Z A;  3KEQ A;  4G8X A;  1SC7 A;  1V5G A;  1Z6T A;  4TV7 A;  2R3S A;  3OSG A;  4BBS J;  4G12 A;  5FKO A;  2A6H F;  4ZDO A;  4UVA A;  1FTZ A;  1CQT A;  2M45 A;  4MHG A;  2XRO A;  5AIQ A;  3KYL A;  3F8M A;  2HZT A;  4QLC U;  1O3S A;  4BY1 J;  1SMT A;  2WBM A;  3OWT A;  4AVZ A;  4UUS B;  4Y13 A;  1HQC A;  2CG4 A;  2Y69 H;  3LSR A;  4EMS A;  1FWZ A;  4F52 A;  5JVG F;  4S04 A;  4D5C A;  1GV5 A;  2RQP A;  4ZYG A;  2PQ8 A;  5HNH A;  1YI2 I;  1Y0N A;  1VQ4 I;  3M3Y J;  3I58 A;  4L5J A;  2K9N A;  2HDC A;  5LRS A;  1ZHF A;  1YYV A;  1BI0 A;  3K4J A;  3I9V 2;  4BE0 A;  2K3F A;  1A31 A;  5EG0 A;  1LVK A;  3WTU C;  1VQM I;  2LC2 A;  2VBY A;  3DLA A;  4AIJ A;  5JFR A;  4H0E A;  2QQA A;  1W0U A;  1JI8 A;  2DK5 A;  2JWT A;  3M8E A;  2NOG A;  1U9O A;  5E20 A;  5IT9 Z;  3HJE A;  2R7T A;  1JGG A;  3NEU A;  3ASN H;  5F1R A;  4PSX A;  3DEE A;  5D6E A;  1W36 C;  4XNF A;  1FLI A;  5DD4 A;  3DBL B;  1D5Y A;  4J00 A;  1Y6I A;  3T8R A;  1BJZ A;  3HC7 A;  2JMW A;  3R0A A;  2A5Y B;  2OBP A;  4HX8 A;  5HDG A;  2DA4 A;  3FM5 A;  3WE3 A;  4II3 A;  1Y0U A;  4K2E A;  3CUO A;  5ICF A;  1J5Y A;  4LLG F;  4BXF A;  2PN6 A;  3BG9 A;  1EH8 A;  3GEZ A;  3GCM A;  4M3G A;  3KCC A;  3BDD A;  3PO3 J;  4IRI A;  2XB5 A;  2LRE A;  2GWR A;  3KE2 A;  1IV6 A;  4HPQ A;  1FYK A;  3FXK A;  1KA8 A;  1D8J A;  2RQQ A;  4Q47 A;  2UV1 A;  2VQC A;  1MJB A;  4KT5 C;  1O7L A;  2HYF A;  3S2W A;  1JGS A;  1HBX G;  1ETK A;  3OL4 A;  3TP0 A;  2XF6 A;  2ZKZ A;  3CQZ J;  1O3R A;  1XDS A;  1BR2 A;  1S5L C;  2RDP A;  2KRC A;  1R4N B;  1VF9 A;  3JRI A;  1Z0X A;  1EA3 A;  5HLH A;  2FX0 A;  6PAX A;  2M30 A;  3BQZ A;  1H89 C;  3HOX J;  3ERE D;  1BN5 A;  2V6C A;  4HV6 A;  2GXG A;  2OD5 A;  2DA5 A;  3E5X A;  4IOC F;  1JUS A;  2W1T B;  1USS A;  1QHG A;  5M5Y J;  4ZZL A;  4F55 A;  1G3S A;  3ZQC A;  1K4T A;  2QLZ A;  5B1B H;  1GLN A;  2EFW A;  2X6Y A;  2Q8K A;  1ZG5 A;  3NQO A;  1TL8 A;  5HDN A;  1GHC A;  4E70 A;  1R1T A;  2UXN A;  1F4K A;  3HOZ J;  2DYS H;  2Q1Z B;  1FT9 A;  1LKX A;  3SYT A;  4ENN A;  2HOA A;  4ENJ A;  3HSR A;  4RM2 A;  4P96 A;  2KRH A;  3HUG B;  1YFH A;  4M6V A;  4UY8 I;  4CUG A;  2CW0 F;  1N77 A;  2DTR A;  1A6I A;  4A2U A;  1UJ8 A;  2JVG A;  3MN2 A;  2VOD A;  4DOZ A;  2EBI A;  2MD0 A;  3DCF A;  3SZP A;  4KUM A;  3G1M A;  1VND A;  2DA6 A;  5FKL A;  2K4J A;  3DWL E;  2IP2 A;  1X2M A;  4BXX J;  4R1H A;  2O7O A;  3E97 A;  2I8D A;  2KP6 A;  5LLQ A;  4YEJ A;  4NBQ A;  1L0O C;  3WTX C;  4HDV A;  1GXP A;  4BY7 J;  2DA1 A;  3HGY A;  1N75 A;  3MAJ A;  4BJT A;  4RB3 C;  2PJP A;  2KZG A;  1PP7 U;  1FZP B;  1WJB A;  3OR1 C;  3ASO H;  4AYB A;  3CD6 I;  4P55 A;  2O0Y A;  3KET A;  4FQG A;  1QA6 A;  3FXQ A;  3W6V A;  2HPI A;  1BL0 A;  1W5T A;  5F0H A;  3PNY A;  2DDB A;  1RI7 A;  2ZJQ F;  2ELH A;  1FIA A;  3SFZ A;  3DBR B;  2DCE A;  2N8G A;  5A2Q Z;  2J5O A;  3SEQ A;  3RZO J;  3HPH A;  4LMY A;  1LDJ A;  3LSH A;  4ETS A;  2ESH A;  3HIF A;  1VQ6 I;  2R7D A;  2WWY A;  1O4X A;  4NB5 A;  3JRD A;  2ZXJ A;  4F3Q A;  3S15 J;  3Q3S A;  4E7J A;  3QAH A;  1WI3 A;  2QVO A;  3BR2 A;  4R8H A;  1MBF A;  2L9V A;  2R7O A;  4XM3 A;  1ITY A;  3HTS B;  2K9M A;  2Z2S B;  2H6B A;  5FKM A;  4A93 J;  2JPB A;  3J7Y J;  3P9I A;  4MNU A;  2W24 A;  1X2N A;  1I1G A;  1OQY A;  4XSX F;  4Y52 J;  1OCP A;  2A6T A;  2FJ1 A;  2H94 A;  2V7F A;  3MQ0 A;  2EFN A;  3Q9S A;  1TNS A;  4NUB A;  2R4G A;  1RZ4 A;  5FLX K;  1VZ0 A;  4PZJ A;  1IDZ A;  5HS9 A;  1G3W A;  1RES A;  3ZCO A;  1YHQ I;  1RET A;  2G7H A;  2YX7 A;  1XSD A;  1K61 A;  1I6H J;  4NC8 A;  3CJQ B;  4AVP A;  5BQT A;  3WHB A;  4HDU A;  2VJJ A;  4IHT A;  2CGP A;  3RYP A;  3RCO A;  4EM1 A;  3JSO A;  4X1E A;  1B8I B;  2XPU A;  2DK8 A;  3ZQF A;  3FIW A;  3GXO A;  3RZD J;  1HOM A;  3T8T A;  5KAI C;  2JUG A;  2LF8 A;  3MKW B;  4DBQ A;  1JJ8 C;  1NK2 P;  3BP8 A;  5EGO A;  3B6A A;  3MVP A;  4B4C A;  4EM0 B;  5KCM A;  2BVL A;  2OCC H;  5FLV A;  1XMK A;  3CF5 F;  2VL8 A;  5D4R A;  2WAE A;  3GZ6 A;  1YX3 A;  1PVE A;  4IZZ A;  4V19 K;  1S6L A;  2PMZ A;  5L3C A;  2W00 A;  2DFF A;  2EJR A;  1WQ2 A;  2ECC A;  4XLF A;  1JKP C;  2X1D A;  2XAF A;  2O5R A;  3F8N A;  3H5N A;  3J81 K;  2E1O A;  4BDZ A;  1F5T A;  2K3P A;  2F5E A;  5DCM A;  5BPD A;  3PIP F;  5LEJ A;  1Z3X A;  1PP8 F;  4KIG A;  2CRG A;  2EZH A;  4G6T B;  3NAR A;  2WV1 A;  2M3A A;  4Q48 A;  4ITV A;  5GP9 A;  3K70 D;  3F72 A;  5DCF A;  3QOD A;  4YFX F;  3JRG A;  3PIO F;  4L0Z B;  4IQ4 A;  3GF2 A;  4FT8 A;  2LMD A;  4ZYE A;  2WTE A;  1ETQ A;  2LKP A;  4BXU A;  3E6C C;  1VI0 A;  1BJA A;  1MH4 A;  2Y0S A;  3WU2 C;  2KL4 A;  3BR5 A;  2W4S A;  3BG3 A;  2E1M B;  3PFI A;  3RYR A; 
#chains in the Genus database with same CATH homology
 2ZJQ F;  1VQ8 I;  1VQN I;  5ITM A;  3CCL I;  2E36 A;  3CCM I;  1VQ6 I;  2GLW A;  2ZJP F;  1VQO I;  5GAH J;  1MMS A;  3TND B;  5DM7 F;  1YIT I;  2FOW A;  2RO3 A;  3G4S I;  1FOX A;  3CCS I;  3J7Y J;  2RO5 A;  1Z0R A;  1YJN I;  2QEX I;  4IOA F;  2L66 A;  3DLL F;  2K1N A;  1ACI A;  5GAG J;  2ZJR F;  4IOC F;  2W1T B;  1YHQ I;  1YIJ I;  1VQP I;  3CC4 I;  1Y39 A;  3O27 A;  1VQK I;  2FY9 A;  3CMA I;  1VQ7 I;  2OTL I;  2NXN B;  1VQL I;  1YFB A;  2E35 A;  1YSF A;  3I55 I;  3J7Z I;  1VQ9 I;  5JVG F;  3I56 I;  3CF5 F;  4UY8 I;  5GAE J;  1VQ5 I;  3CJT B;  3CCJ I;  4V19 K;  3G71 I;  2RO4 A;  1YI2 I;  4JDM A;  2H8W A;  1VQ4 I;  2W1T A;  2QA4 I;  1S72 I;  2JQ7 A;  5ITJ A;  1MVF D;  2OTJ I;  1HC8 A;  3G6E I;  3CCE I;  2K3F A;  3CCR I;  5GAD J;  3PIP F;  1VQM I;  4JDO A;  1FOW A;  4IO9 F;  3CME I;  5DM6 F;  1UB4 C;  1FOY A;  3PIO F;  3CD6 I;  2E34 A;  1QA6 A;  3CC7 I;  1YJ9 I;  3CCQ I;  3CCV I;  3CCU I;  1YJW I;  3CC2 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...