2QA4I

A more complete structure of the the l7/l12 stalk of the haloarcula marismortui 50s large ribosomal subunit
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
126
structure length
118
Chain Sequence
IEVLVPGGEANPGPPLGPELPVDVQAVVQEINDQTAEVPVTVKYDDDGSFEIEVGVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title Structure of the base of the L7/L12 stalk of the Haloarcula marismortui large ribosomal subunit: Analysis of L11 movements
pubmed doi rcsb
molecule tags Ribosome
total genus 13
structure length 118
sequence length 126
ec nomenclature
pdb deposition date 2007-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 2qa4I02
2.10.260.30 Mainly Beta Ribbon Pemi-like Protein 1; Chain: D Pemi-like Protein 1; Chain: D 2qa4I01
1VQMI 4V19K 2ZJRF 3J7ZI 5DM6F 1FOWA 1YITI 1YI2I 3I56I 1MMSA 2QEXI 1QA6A 2ZJQF 3CMEI 1Y39A 2JQ7A 3PIOF 3CCMI 1YJWI 2H8WA 3CCSI 2OTLI 1FOYA 1YHQI 3CCQI 2FOWA 3CCRI 3DLLF 2K3FA 1ACIA 5JVGF 1VQOI 4UY8I 2E34A 1VQ6I 2NXNB 1YJNI 4IOCF 2ZJPF 3CCJI 3CF5F 3CC2I 3J7YJ 5GAEJ 4IOAF 5DM7F 2OTJI 3CCVI 1VQNI 1VQ8I 5GAHJ 3PIPF 3CCEI 3CC7I 1YIJI 1FOXA 5GAGJ 4IO9F 1VQ9I 1HC8A 3G71I 1YJ9I 1VQ7I 3CJTB 1S72I 3CMAI 2E35A 1VQKI 2E36A 1VQ5I 3CD6I 3CC4I 5GADJ 1VQLI 3G6EI 1VQ4I 3CCUI 1VQPI 3CCLI 3I55I 2QA4I 3G4SI
chains in the Genus database with same CATH superfamily
4EV0A 3KYLA 3KP7A 4JX6A 2QSFX 3H1CA 3K4BA 4IEJA 1R1VA 3PNYA 4C3JJ 2YU3A 3HOXJ 1BBYA 3KETA 1X3WB 1ETKA 3JR9A 5FKNA 2R7UA 4UHTA 2W1TA 2R7XA 2KFDA 3MAJA 3TKYA 3FIWA 1V3FA 3R61A 1HKTA 2QQAA 1B4AA 5LEJA 4LFUA 3BTLA 1FBSA 2R93J 3WE3A 1Q1HA 2EIMH 1JUMA 3ZP5A 1USTA 4HNVA 4L5IA 5F1JA 2RDPA 2DMTA 5E3MA 4XLAA 5F0HA 2LR8A 2H8WA 4XRSG 3DTKA 4JQFA 1WH7A 4HZFA 3E6DA 4J00A 2VODA 1U9NA 4UXNA 4PSWA 1ZAOA 1U78A 2JA8J 2A5WA 3DFGA 1B8IB 4G94A 4XOPA 4AIHA 3FXMA 1WRJA 3ROUA 1EH7A 2E7XA 1BM9A 2FNAA 3GBGA 2GXBA 1B59A 1Z77A 2FY9A 1W4MA 3W6KB 2QWWA 3TW7A 2V1DA 2UV1A 4BNCA 4BGDA 2DMPA 4XLNF 1SFXA 5HNFA 4H0EA 3HOYJ 1LJ9A 3F0CA 1IAWA 3E1SA 3WE2A 5EG0B 3G2BA 5A2QK 1LFUP 3RZOJ 3U1KA 3IAM2 2L02A 1IV8A 3OV8A 2VE9A 3BZKA 4I0BA 1YRNA 5BPIA 3GTPJ 1ZR2A 1IXSB 4HX4A 2CUFA 2ZB9A 5GTHC 4EQQA 3S3OA 1DP7P 1J7KA 3L2VA 4A93J 1KQ0A 4IF4A 2LFBA 2FEZA 4PJNA 3S17J 4AVPA 3VWBA 5JLXA 3OYDA 3A01B 1JUPA 2Q0OA 4CCJA 3MCZA 4YIFA 3PUFA 2FX0A 3ESWB 2Y0MA 4MLOA 5EEHA 4YFNF 2G7UA 4L9VA 3RKXA 2MW8A 4PJ0C 3TP0A 1V55H 4Q48A 5HDGA 1G3WA 2ZFUA 3SFZA 3L09A 1D3YA 2M0MA 4GGGA 1OCTC 5F1RA 3CC4I 4QWQA 3J81K 3W2WA 1S8NA 2D1VA 5HS9A 2QCOA 4HW0A 4UVAA 2GIZA 2M45A 2X6WA 1B8IA 1AKHB 4I01A 5DCFA 2VJIA 3L7WA 4M9XA 1BOAA 3WGIA 2BY1A 4JK1X 3WU2C 3X2QH 5J40A 2COBA 2ZMEB 2EZIA 1GXQA 4E7IA 4G6TB 2IJLA 4BQOA 1R1TA 2FRHA 2PQ8A 1FOWA 5F08A 3RQ4A 3IV5A 1H8AC 4A3DJ 2PX9A 5ICGA 1F4KA 3CJNA 5FO5A 4LG0A 2HR3A 3OSGA 1LKXA 4I0AA 1IUYA 3DP7A 5ITMA 3KX2A 2F5FA 1SANA 4Q47A 1PUFB 3K69A 4B8XA 2ZJ2A 5FKOA 4MIMA 3ERED 2IS4A 4LJZF 1WJBA 4A5NA 2LD5A 3BG3A 5E1ZB 3KLOA 1LDDA 4KIBA 5CVIA 1BW6A 2MH9A 3U21A 3A01A 1SEUA 1K6OA 1MBHA 4QSHA 1ACIA 1HLVA 2QLZA 3JAMK 3I5UA 1U6GA 3E6BA 1OYYA 3I71A 3ZQQA 3CCYA 3OYCA 1JUSA 4EM1A 4KIGA 2V6EA 4A0YA 1M1EB 2ZXHA 1RIOH 1B72B 3QAHA 5JHFA 3ZQCA 5KVRA 4NC7A 4GXOA 2JVGA 4KT5C 2HVSA 2VUMJ 3LQQA 1ZRFA 1RKTA 2EJRA 1H0MA 4QPQA 1O3QA 1FTZA 4PJJA 1OYIA 1OFCX 5GAEJ 1TC3C 2KIQA 4QLCU 2OJED 4N9HA 4KN7X 2Y0SN 4DYQA 1BIAA 1E0EA 1VNDA 2EFOA 1IN4A 2F48A 3D1NI 2OV7A 1XMAA 3HUGA 1FMWA 5HS7A 5E3LA 1H88C 3HTUA 1AWCA 2KQRA 2XGXA 4IHTA 2V9PA 5GAGJ 2KKOA 4A3CJ 2VQHA 2WAFA 2YPRA 3VDXA 2DT7B 4E7JA 2DOAA 3KEYA 3WGHA 1T39A 4I99C 1QVTA 2DFIA 2O03A 1PUFA 2EV6A 1VQ9I 2K40A 1YLFA 3EUHA 3CMAI 1TL8A 1REPC 3PUBA 2E36A 5DTDA 2VBXA 2JN6A 1X4PA 1IRFA 1WVRA 4XBFA 2K27A 5LGTA 3SEQA 1ZHFA 2ZSHB 1X4OA 3BTIA 4DIQA 2EZHA 3J80Z 2L4MA 3ONQA 3H9JA 2WAQN 3EUKL 4ZYGA 2CFOA 1JE8A 3G4SI 2Q8KA 1DPRA 1Z7UA 3I9V2 1CGPA 4JP0A 3GTMJ 1UHSA 3L1PA 1B72A 2PFBA 4FQGA 2P8TA 2R7SA 3UR3C 1TW2A 2CRGA 1RI7A 3OL3A 2XB0X 3U2RA 4RAZA 3AG3H 2BHYA 3HHGA 1R36A 2JA5J 4BDYA 1K7AA 2IRFG 3IHUA 3TO9A 3T5XA 4A3MJ 2VQGA 2LMDA 4UVCA 1QA6A 3M9AA 4ZC3A 3VSLA 1LE8B 1MVFD 4NUBA 5AONA 3T8RA 4C30A 1GV2A 4LGWA 3FZVA 1IG7A 3H92A 3H5AA 1N75A 4XMYA 1F36A 4DZJA 3VSKA 2JUGA 3VB2A 2W57A 3I59B 2P7VB 1D0ZA 2PMZA 1V4RA 1W5CC 4PJMA 3WHCA 2NS7A 3ECOA 3CUQB 1SVOA 5AIPA 1IC8A 4KFCA 2JWTA 2KISA 3FISA 1YYVA 3WG7H 2QKMB 2DPUA 2VC1A 2NXNB 3R0AA 2Y31A 3A0BC 1MMAA 1ZG1A 3NARA 1IN7A 2ME0A 4WF2A 2KJBA 4ON0A 3Q0UA 3T8TA 2IGKA 3JTGA 2FD5A 3BR3A 1S6LA 2MLGA 3HIFA 3QU6A 4Q5SF 4BUPA 3RPUA 2E1MC 3ZMVA 3MFKA 3F22A 4E7KA 3CCVI 4IRGA 4G7HF 2XAQA 1UFMA 4ZYHA 3I53A 1Y8QB 1S7AA 2E1NA 2LKSA 4RM3A 4HX7A 5FRMA 1MSEC 1WSUA 1MKMA 4ZZLA 4WXDA 3FMSA 3GUDA 2H1KA 2LOOA 1D8JA 2W25A 1FIPA 5ILSA 4ESFA 1FLIA 2LYCA 2GLWA 1XGNA 4M71A 2ACJA 1YW7A 1VQ7I 3CJTB 3FDYA 2K1NA 2CUZA 3S2WA 1VQKI 3CJRB 2V9KA 1H9TA 2DQLA 3I59A 1S29A 2XHKA 5F0CA 3CUQA 1IDZA 1ZLKA 4Y15A 2K5CA 4XLHA 4NHJA 3S1NJ 1I27A 1RR8C 2C6YA 2L7FP 2M5WA 1QNTA 4HF0A 1TWHJ 2QQ8A 2JT1A 2CG4A 2HTSA 2ZSIB 4F92B 3HOUJ 5ED4A 4BQNA 4L0ZB 3EETA 2QUFA 3E97A 2ID6A 5J8FA 1XD7A 2F4IA 3GYHX 2KMUA 3BDDA 2WB1N 5L3FA 4XLFA 4JX5A 2V6CA 5EYRA 3IH2A 3RTRA 1S7OA 1R49A 2Y69H 5JFRA 3LSGA 4BEHB 2QEXI 4A3JJ 3NAUA 4RGSA 2VBYA 4J01A 3G73A 4HV6A 3AFHA 1WJ5A 3R0JA 5D5WB 2FBIA 2BXYA 3F8CA 3GWZA 3TOAA 1JT0A 3K4CA 4N4OB 1GDTA 4ETSA 2BV6A 3HHHA 2G9WA 4FT8A 1HKQA 4EMSA 3H3ZA 2GA2A 4B3AA 1TQPA 4FE7A 2OPTA 3GMEA 2H1LA 3F3XA 1VQOI 2WB1A 2B7EA 2BY2A 2VQLA 3FBNB 4ZYDA 1K4SA 4ZJZA 3J80K 4IJAA 1SFEA 3KP4A 2Z16A 3RI4A 4CO8A 1YJNI 4F3QA 4O5VA 1IRXA 3Q0WA 1L3LA 3WU1B 3HYIA 3FXUA 3DU6A 2O6GE 1OJLA 5H6QA 3LSRA 1O4XA 3GTKJ 3M7GA 2ZCWA 3UNGC 1TWCJ 2K9NA 4N4NB 3KLNA 3S15J 3SZGA 5LHHA 2BGCA 2V79A 2E19A 4Z6YA 3QPSA 3Q3SA 1X1AA 3TDZC 1F43A 2OF7A 4ENNA 1C0WA 1QRYA 2DMUA 2LREA 1EA3A 1WJAA 1JGSA 4TV7A 2DFHA 5D4SA 5CYVA 1FOKA 2IGOA 1ZYRF 2XVCA 2DW4A 2X6OA 2HVRA 2HS5A 1O3SA 1P7IA 2K85A 5M3MJ 1SMYF 3DKYA 3OS1A 3P5JA 4O3MA 5HOOA 2XPUA 2QZ8A 2RQPA 5F27A 4RMNA 4IL6C 2KIMA 4LK0F 2DA3A 1ON2A 1LFBA 3TOBA 2UZKA 4WX9A 1TT5B 2GOXB 3FF5A 1O7LA 3PM1A 2L4AA 2W82A 1DP3A 4II3A 4GRIA 4HV5A 1A04A 3P7NA 1APLC 3PL8A 3K7AJ 3WGGA 4U0WA 4BL0B 4IQJA 4M6XA 4XKCA 2HYGD 1SAXA 4F52A 2CUEA 2ZXIA 2DA7A 1F5TA 2VXDA 1R58A 3FHZA 3JRCA 4UNOA 5IOZA 4Y3OA 3K1PA 1ODDA 2RQQA 5IY5H 1PJRA 2PMUA 1O57A 3ABTA 4YELA 3F8BA 3F21A 2VONA 3RQIA 3GFIA 1D8KA 2XASA 2VI6A 1FSHA 3H36A 4U0YA 2FQ3A 1H9GA 4YIRX 1EH6A 1YS7A 3EUHC 4IQ4A 1DPUA 2VN2A 2XGDA 2EZLA 2IS6A 1MBGA 3D0SA 3V4GA 2E1CA 3HSFA 2P4WA 2V4JC 2PJRA 3CCSI 3C18A 5K5RA 3DPTA 3HEFA 3M3YJ 2K86A 2DDBA 2K3FA 3F72A 1MGTA 3MEXA 2YX4A 5F6FA 2ZO4A 1RUNA 3MQ0A 1J59A 2E34A 4KITB 3LQRA 4LLGF 2M30A 3A03A 4PSXA 1PYVA 1UELB 5ICFA 3HGGA 5CVJA 3KZZA 1KYZA 2ETHA 3HRUA 5CQEA 2HVQA 3HTSB 2MD5A 2OCCH 3LAJA 3K4NA 2YSRA 2NVXJ 2ISYA 4QPOA 3CDLA 4B1RA 2PEXA 3BG7A 3DBLB 3QRFF 1ZK8A 1BI2A 4D7NA 2FQ4A 2NNYA 1ZREA 2E60A 2NVYJ 1EH8A 2ZBKA 1EJ9A 2BVMA 4XN3A 4BXFA 2F5CA 4KT6A 4XIDA 3S2HJ 2EFPA 3BZCA 4LIUA 4M9SA 1UG0A 3KZYA 4B09A 3E6MA 4HF1A 3D5RC 5IPAA 3ZCOA 2Z2SB 1R4NB 2DMNA 4EATA 4LITA 4EJWA 3QP6A 2E1OA 3TBIA 2GZWA 2MLKA 5EEAA 4C2TA 1ONVA 2WY8Q 3M8FA 1S9HA 1TTYA 3K9TA 2H09A 2J5OA 5DS9A 1P9QC 3IH3A 4B3XA 5FKMA 2Z5UA 3IRQA 5J4VA 2AHQA 1NK3P 5IT9Z 4AIKA 3CJQB 3EUAA 3BP8A 1VTNC 2E1MB 2A05A 2IP2A 2VPRA 2E5NA 3TO7A 4CUGA 1WJDA 4DNCA 2R7VA 1B6AA 2F2EA 5GTIC 5HLGA 3Q5FA 3F9KA 4DBRA 1G3TA 2R7RA 3I64A 3L2CA 2AO9A 2VE8A 2QYOA 2R7WA 3JRBA 4U7BA 4IX7A 1TBXA 4D0PA 2IGMA 3ZMUA 2CW7A 5BNGA 1A5JA 1SVMA 1P4WA 3HOVJ 2XC7A 2RN7A 4ZDLA 4CH7A 3DXJF 4I6ZA 1MMSA 3RKYA 4I76A 3BR6A 1NG7A 5ICEA 2XAJA 3CLOA 1XGMA 3CMEI 4L0YB 3M4OJ 2DK8A 2V7FA 1ORKA 3MZYA 2L66A 2ECBA 1D1BA 1UJ8A 2JMWA 5HVQC 4CGZA 5K7HA 4ENJA 3D5SC 1YRNB 3CUQC 2FJ1A 2CWEA 1Y1WJ 2QENA 3RDIA 3VYUB 1MIJA 3ABLH 2FSWA 3ZOBA 2RKHA 3TO6A 4M73A 2R3SA 3GX4X 4B4CA 4IHWA 4BJ6C 1UB4C 2HKXA 2RNGA 2AQFA 3V8JA 3GZNB 3IWZA 3I0TA 3PFYA 5HDNA 3L2RA 3LSMA 2TDXA 1LDKB 2VQCA 1YX3A 3I4PA 5TRDA 2XKOA 2BVLA 3QYEA 5AIQA 5FKKA 2M87A 4FASD 3F23A 3DPLC 4MEXF 1BA5A 2P81A 3F8MA 1HXDA 2Y48A 5LBQA 2HTJA 4PZJA 4HLYA 5BOXA 2PG4A 2MC4A 2Z99A 5DM7F 3HOTA 1YIOA 2M4KA 2VL8A 2X9DA 5GP9A 3FMRA 1OPCA 4X1EA 4D9JA 3K70D 3OIPA 1LB2A 2GXAA 4P5OA 1T2KA 4AIJA 2L0KA 4E7HA 1HDDC 1D0XA 4RM2A 3T0YA 1W7PD 2CQXA 3NWSA 1HQCA 1V54H 2L54A 5IP7J 3NWTA 1V5GA 2E5ZA 2CYYA 2GIVA 2CO5A 3H9GA 5JHUA 1X58A 2WAEA 2HGCA 4PUSA 3SEZA 1IRZA 1PVEA 4LG0B 2EIKH 2UXXA 5E1XA 1R4MB 3KE2A 2E35A 4K2EA 4BH9A 3ZN1A 4BE1A 4IVNA 3CO7C 1QBJA 1R7JA 1W36C 4I98B 2RVCA 3H5RA 3DWLE 3BJAA 2E71A 5K7FA 1U9OA 3O8HA 1G6NA 2KRFA 2GM4A 2DCEA 3DBRB 3K4MA 4LMYA 4P1WA 1MBKA 3I55I 4AM3A 3K4KA 3A1YA 2ELKA 2XAFA 1I1GA 3WTVC 2P5VA 2EPFA 1TWGJ 1IO2A 4RLFA 1G3SA 1V5EA 4E4HA 2XAGA 1QZYA 5J8CA 2ZJRF 2R7ZJ 4CHUA 1POGA 3KCCA 1MW7A 3M1EA 1U8RA 1HCRA 4BE0A 2UUZA 4A69C 1D1AA 3GLLA 3HZJA 1JGGA 2DJIA 3HXLA 3LFUA 3F6OA 3ZQLA 3JTHA 3FBIB 3GO5A 5B1BH 2VPLA 4FISA 1P92A 2GXGA 3CCMI 2D5VA 2HNHA 5DD8A 4ZZDA 3N4MA 3S1MJ 2J5PA 2L5QA 2BY0A 2OTLI 2W84A 4W97A 2LLKA 2MYSA 1FMVA 3F6VA 4Z2YA 2BW3A 5TISC 3WTZA 4AIDA 2NAZA 5IT9K 3HUGB 4MFEA 1IDYA 3A02A 1SMTA 3P9KA 5CJ9A 3S3MA 3SZPA 3LWFA 4CCLA 2BZTA 1N78A 2MABA 3ZGKA 2FXAA 3MKYB 2VLAA 2HFHA 3QOPA 2LP0A 3OSFA 3W2VA 3MWMA 3V42A 2XF6A 1O3RA 2R7FA 2L2OA 2YR2A 2HXOA 1GVDA 5HNHA 3K70C 1E3HA 5B1AH 2ELJA 1SD5A 3DBHB 4ABZA 3K0LA 4IHSA 2IS2A 3SQNA 5BMZA 1NH3A 3ZXSA 1QVUA 1XCBA 3LSTA 4AUXA 2X85A 2A61A 2O7OA 2DA5A 3SJMA 5CVVA 2WC2A 4HAMA 1FYMA 2LBFB 2WBMA 2L01A 2BXZA 4W1UA 1ZN2A 2P7CB 4M3BA 1LNWA 3ZQ7A 1MDMB 3ZQGA 1TNSA 2WTEA 5LRSA 1Y1VJ 2LK2A 1STZA 3FMQA 3MMYB 2HDDA 1GLNA 4I09A 3EDPA 3OYHA 4C3IJ 5IT3A 4LK1F 3REOA 2AQEA 1LVKA 3GTGJ 3HOWJ 3BG9A 3E0JB 4BBRJ 5B3SH 1WHUA 4XLCA 3IC7A 2IAIA 3KFWX 2QA4I 3JSOA 4FE4A 4I2OA 2X1EA 3UKGA 2M2EA 4A5MA 1RC9A 4L9TA 2KT0A 3FKIJ 1YQAA 4HF2A 2DFEA 1VFCA 1USSA 2DXIA 2HOAA 1Y0UA 5E20A 2DA4A 3B6AA 4D5CA 3OIOA 3QPTA 3QWLA 2IS1A 3L2WA 4A0ZA 1YI2I 3A2KA 4FX0A 1WJCA 2FF4A 3KYDB 3WTSC 3RIRA 2Y0SA 2ZJQF 1MMGA 2NNNA 2KZGA 1KQ8A 3HSEA 2XDVA 3LA3A 4HEA2 3FK6A 4BY7J 4RB0A 4X6AJ 4HPQA 3HL2A 3BPXA 3WG9A 5BPDA 1UZCA 1X3ZB 2LY2A 5LGNA 5D5UB 1BJAA 2LBFA 4M6YA 3VYTB 1IXRC 1BR4A 2ADUA 4BXXJ 4OIQF 3PNVA 3DQVC 3HG9A 2VJ4A 2O8XA 4GYIA 4KUMA 4ZDPA 2KDZA 1HW1A 4KYWA 2UXNA 3CCRI 2EFNA 2CU7A 2CV0A 3QYFA 1MDMA 3LSJA 2LH9A 4JYKA 5K5QA 1KQ9A 2XIGA 5FLVA 3F8FA 3S1QJ 3HB9A 1VQ6I 1X2NA 3IL2A 4CSWA 3S16J 3PJRA 1MJAA 1XB4A 3OYJA 3JRIA 2COMA 2F5VA 1X2MA 1QPMA 5FFZA 2WAQA 5LFAA 4HQMA 2MD0A 5J6XA 3CC2I 4LIVA 2YS9A 2QBYB 1DGRM 1QQIA 1TNTA 4S0HB 2ZNZA 1XN7A 3K1NA 4HNTA 2E2JJ 4KA4A 1MBFA 4QIWN 3I4MJ 1SAUA 4J19A 2FMLA 1LFPA 4N0BA 2QM3A 3CP8A 1FBUA 3K10A 5D8KB 4Y7NJ 2K9SA 3BCBA 1XCVA 3LSHA 2LVSA 4EJUA 2DBBA 3LMMA 5C4XJ 1HBXG 4A0XA 2HWVA 2GOMA 4R1HA 5KK1A 3Q9SA 3K6GA 3JRHA 2IGNA 3ASOH 2DOEA 2EB7A 4LOCA 1X3UA 1MZBA 5CKTA 3K2ZA 4Y52J 1HKSA 1SD4A 1VQ4I 2EWNA 2LTPA 1ULYA 1KU9A 2JRTA 2L9NA 3ML6A 4E7ZA 5GPAA 5L3BA 1R5HA 3G1MA 2EZKA 4UVBA 5KHDA 1KGSA 2I10A 2JUCA 2Y30A 2DOFA 2X1CA 5FFXA 4RB1A 3BR0A 2DLLA 3CMMA 2IXSA 2M7AA 2YU9J 4S04A 3CO6C 1YG2A 1J09A 2IBDA 2D2WA 2TRTA 4ENMA 4P96A 1OCZH 1SFOJ 1MD0A 3TL4X 1FP1D 3PSFA 1XSVA 3I56I 4D1QA 1E3PA 2R5ZB 2QBYA 3EYYA 1BW5A 5L3EA 5EZGA 2CQNA 1MH3A 2ME6A 1U5TA 1ITYA 1FT9A 1QZEA 3F8NA 1IN6A 2FA5A 1G59A 2IA2A 2QQBA 3HPGA 1A31A 1ZQ3P 2IA0A 1P2FA 2K3PA 3GCMA 2BYVE 2OZUA 2XAHA 4HBLA 3GTJJ 5K7ZA 1TP4A 2A3SA 1ZGAA 3AL0B 1T95A 1B9NA 1LEAA 4OAYA 2HQAA 3I4NJ 1R6RA 3JW4A 4A3IJ 2CW8A 3SHFA 4L18B 1FP2A 1T33A 2FBHA 5LRRA 1HA8A 3SYTA 3QODA 4MQVA 3OYGA 3OS2A 2JA7J 3OYNA 1QPIA 3QPHA 4YIIA 2F4MB 1TZLA 2GA1A 1OCOH 1FNNA 2JSPA 1BI1A 2B0LA 3B73A 3GEZA 2MBFA 1OISA 2R7OA 3S1RJ 4IHVA 2RV8A 4IRHA 1D0YA 4L5JA 2DU9A 3G1OA 2ICWG 2RGVA 2XAUA 4RAFA 4ZYAA 1BIBA 1ETQA 4IHXA 5H20A 4KN4X 2DT6A 2NS8A 1MH4A 1QU3A 1CF7A 1BN5A 3FKJA 4PFPA 1G4DA 4EGYA 3DKWA 2R5ZA 3V7CA 1BOBA 3S32A 4XQFA 4U88A 1PUEE 1ETOA 2HZTA 2NS0A 3W3CA 3ZN0A 4EM2A 1HW2A 4F93B 4BY1J 2RO3A 3W2AA 4AWXB 3VFZA 1IGNA 2OC6A 1CQTA 2DYSH 2D45A 3ABKH 3L9FA 4DQ2A 3COAC 4FETA 1RUOA 3H5NA 3GW2A 3LFKA 3ZMSA 2EILH 1ETXA 2L3DA 3WTTC 3LAPA 3QU3A 1K83J 3BT9A 2PJRB 3K4LA 3FXLA 3OY9A 4P9UA 1W7PB 2XV4S 3ZQFA 1B1BA 2O5RA 1XGSA 4I7HA 2HXIA 4G8XA 4XM3A 3S3NA 2E2IJ 5EDNA 2VT3A 1UAAA 2G0EA 2OUMA 3DV8A 4XL9A 5FD6A 4HG2A 3H0GJ 5DUKA 4GCVA 3HRSA 4KJZA 1WKMA 3MN2A 2HOSA 4XLPF 1D5YA 2IPQX 4EM0B 3JREA 1Z05A 2V1UA 3MD2A 1FPQA 2EK5A 3GXOA 1HW5A 1AHDP 5E3OA 1E3OC 3KP2A 5HLIA 4JX4A 2IW5A 1P7JA 3TQNA 1Y39A 5KAIC 3O27A 4WCGA 2K4JA 4JDMA 1WGXA 1J75A 5H2FC 4OIRF 1Z1DA 4E7LA 2L9VA 1R23A 2CH0A 1ZLJA 2LY1A 3W6JB 4CCOA 4BHCA 3IP4B 1HSTA 4M3EA 1T8IA 2VC0A 3TMOA 1ETWA 2DT5A 1IN5A 1AU7A 2X51A 1Z9CA 3E5UA 2K7LA 2EIJH 1LPQA 3LSPA 1R22A 1WQ2A 2MSYA 1R1UA 1SD6A 4CDGA 4HRIA 2KRCA 1UHWA 2DTRA 4NBQA 4DYCA 1R71A 5JLWA 2R4GA 3OL4A 4B47A 1E17A 1W7PA 3OYEA 2RREA 3NQOA 1S3JA 1I6XA 2RC4A 2O9LA 2ID3A 1OR7A 4ZTFA 4BXUA 2DODA 4FX4A 4UUSB 3HJEA 1YW8A 4XN0A 4ENKA 3ERMA 2JTVA 4BAYA 4BBSJ 5CLSA 4A12A 2N8GA 2EA2A 1FIAA 1VI0A 4XNFA 2G7HA 2RNJA 1FOXA 1J2XA 1Q1VA 3P9IA 2X48A 4YFXF 2MH2A 2B9SA 4GDFA 2KHMA 2ZNYA 4MGRA 5CVRA 3LNQA 2VT2A 4PJLA 5A2QZ 2HYFA 3CZ6A 1Z91A 4WXHA 4LLNA 5FB2A 4Y4RA 2PLYA 3HRTA 4M72A 2EFWA 4FHTA 4RAGA 2NRAC 3TEDA 3FXQA 6PAXA 1Y8RB 4MO7A 1FYLA 1W1WE 1X1BA 1JJ8C 3GTOJ 5D6EA 3BG5A 5DCMB 4RAYA 4A6EA 4CYCB 4B48A 1LQ1A 4R79A 2H94A 5M5WJ 4MTDA 4XR6A 4ITVA 3GZ6A 2LF7A 1H89C 3AG4H 1DDNA 1Z67A 3LL7A 2VASA 2KDOA 5DYMA 1YITI 2ELHA 2MA3A 3TP3A 1W5SA 3ZQHA 1LUJB 1MJBA 3M1CA 1JTYA 2OZ6A 4AVZA 2A5YB 4MHGA 3J81Z 2OBPA 1ZH5A 3OYLA 1YW9A 2JVHA 2VKDA 3O8GA 3I58A 2PN6A 3S14J 2VOOA 3BOQA 4M74A 1E2XA 3ZR8X 5ERIA 4UUSA 3O2PE 2XRLA 4BE2A 2VIXA 3JRDA 2E2HJ 3J7AO 1JKPC 3HKZN 4V2GA 2MFZA 5F04A 3H0DA 1TWFJ 5DV5A 3I3LA 2MGQA 1RNLA 3KP5A 4GO1A 5FROA 1UB9A 3BCAA 3HSRA 4RA2A 3VOEA 4HQEA 1GUUA 4A3GJ 5D4RA 2XROA 1VZ0A 1Y56A 3AAFA 1JKOC 1R5GA 2JSCA 2XSJC 4BDZA 3NEUA 4UY8I 5DD4A 3OYMA 2IT0A 1KYWA 2AS5F 3GTQJ 2ISZA 1UG2A 4II2A 1YSFA 4KNYA 1XSXA 4PGHA 2A69F 4IOCF 1K61A 3LA2A 5C4JJ 3BR1A 1F1ZA 1U5TC 1WFXA 2Z33A 1U8BA 5LLQA 3MKLA 3HKZA 2HQ5A 1KA8A 2JZYA 2LSOA 5DCMA 2WY7Q 4NQWB 1JTXA 1MJ9A 4CYCA 3U1DA 2KIUA 4A3KJ 3KEQA 3E5QA 2QQ9A 4UUTA 2CJJA 5E18F 4RB2C 3GLXA 4UV9A 1FSEA 2EINH 4CZZA 5IYBJ 3MZ8A 5M5XJ 1W0UA 4BACA 1YIJI 2A68F 3CTAA 3CF2A 3TNDB 2STWA 1YTYA 4PDKA 2BE5F 3FXOA 5EGOA 3GZ5A 4UUVA 3PQKA 4BJ5C 4QTRA 2CFXA 2FOKA 3BROA 4JDOA 1ENHA 4HDUA 4KDPA 4OOIA 1S72I 3P9CA 2EV0A 4YFKF 2CV2A 1MMNA 1ZELA 4FCYA 1Y6IA 5L3CA 5K1YA 3MKWB 4ZDOA 3GFMA 3RCOA 5D6FA 4BU2A 1DQUA 1A35A 1XDUA 3KEOA 3RJPA 5IYDJ 2F5EA 3GFLA 5KCMA 1VQPI 4DYRA 4C2UA 5J47A 1DU6A 2K02A 3DTIA 1IF1A 3WHBA 1T08B 1NTCA 1EF4A 2DA1A 5FD5A 2F5DA 2BW3B 3Q9VA 3CESA 4WWCA 3ABMH 3HOSA 4C3HJ 2XGCA 1T0FA 2ESHA 3J7ZI 5KAFC 1BC7C 1MBEA 4BQQA 3PO2J 5FLMJ 4ESJA 2DO7A 4IPAA 2IA1A 5LD2C 1IUFA 3N97A 5LGUA 2X4HA 4CZCA 2FUG2 2FBKA 5B5EC 4NQWA 2LF8A 3S8PA 5DUIA 2JK3A 3FX3A 1OCPA 4LG3A 2K9MA 4G9YA 1BL0A 2V9VA 4L5EA 3IRRA 4X0GA 3AL0C 3FK7A 1J0RA 3BR2A 2VOPA 3KPHA 4EGZA 1ON1A 2CW0F 2KZVA 2X6XA 2XPWA 2CUJA 1IW7F 1W5TA 5EF6A 2FOWA 3KP3A 3OR1C 5LEKA 3K1MA 4XRSA 3CCQI 4UB6C 5CVUA 1U3EM 3CLQA 3V8LA 3OYKA 1XMXA 3OMYA 1Z0XA 1TLHB 3H3UA 4MFDA 2OQGA 2Y2ZA 2P5KA 1QO0D 3B6CA 3DKXA 3ZMZA 1KU2A 4OWRB 5IP9J 1FTTA 2DK5A 4JOMA 3IUOA 2R7QA 1T98A 2KRHA 4CCMA 2RO5A 3QP5A 2MC3A 2WA0A 1W0TA 1R00A 5HS8A 3BG6A 5M5YJ 1ZGWA 3VYRB 1Z6TA 4MQ9F 2H8RA 4IOAF 2XGEA 4ANJA 4UV8A 3EYIA 2OTJI 5D5VB 2IVMA 4G7ZF 5M3FJ 2QSGX 3NRVA 5F0FA 4RLQA 5HODA 2O61A 4P9FA 4ZH4F 4LLLA 3O6BB 1GHCA 4BHBA 3GF2A 4OIPF 3AKZA 4HLXA 4BJTA 3ABUA 4OMYA 4E6KG 2PBIA 2DI3A 3DF8A 4A2UA 1Z0RA 1HC8A 4NC8A 2DQRA 3BTCA 4RGUA 3OR2C 1X1PA 2W24A 1I3AA 3VYSB 5EG0A 1DU0A 1ZRDA 1VQ5I 1D1CA 3QYBA 4XRMA 4DZPA 3JRAA 3BJ6A 3CD6I 2CS3A 1RR7A 2DA6A 1U2WA 3CUOA 1IJWC 2CQQA 2W4SA 1HOMA 3HBLA 1BJZA 1ERDA 5J4YA 4RGRA 4GYGA 4RS8A 2BY3A 1OR7C 3T1BA 4YRVA 2I5UA 4KICA 2HYJA 1IZ1A 4A6DA 3WODF 1XS9A 1OQYA 3R4KA 3RKQA 3H3VK 2B63J 2ZKZA 2X6YA 3TDUC 2Z1DA 1SVLA 5DM6F 4HOBA 1XC5A 2HQNA 3E7LA 4H4KC 2OA4A 5HDKA 1WJEA 2L7KA 4CXFA 2R5YB 1XTAA 4FTHA 1FBQA 3OYBA 3S93A 2ZFWA 5E8IA 2K4BA 3WTUC 2DAOA 2M3AA 1JHHA 1IN8A 5EEGA 4M3DA 3IH4A 2EV5A 2P6TA 2LY9A 1L0OC 2RAEA 5F64A 4DBQA 5ILUA 1RKWA 4E70A 1AKHA 4NB5A 2CV1A 1FOYA 3BTJA 1ZTRA 3G3ZA 1Z3XA 4CCNA 4XSXF 3L2UA 1SC7A 2ECCA 2ZMEA 5JVGF 1PDNC 1YFHA 2VJJA 4RB3C 4XKBA 1WCMJ 2NVTJ 1I50J 1TQMA 1Z21A 2XF5A 4IZZA 1G2HA 2JRMA 3IKTA 3O3KA 1MMDA 5EJCA 2HI3A 1OKRA 4XKWA 3Q0VA 5E3NA 3BR5A 1YO5C 4EJTA 1MNEA 2H6BA 2L7MP 2ZJPF 2IEKA 3OWTA 1YFBA 2HOEA 3PFIA 2LKPA 4EJVA 3DEWA 2M0CA 1SFUA 2LG4A 4A3EJ 1A6IA 4U7DA 4MNUA 1GXPA 4S05A 4N9IA 3FM3A 1KZHA 2DPDA 1X1DA 2JPBA 3QQAA 1LVAA 5GPCA 4OIOF 3J7AY 5IYCJ 2VKVA 3OIQA 3SZTA 4AC0A 5GAHJ 2M7BA 1XMKA 4YEJA 1ZG5A 1FJLA 1JJ6C 1AOYA 2W7NA 1O3TA 1TQIA 3OOUA 3PSIA 4OAZA 5HLTA 2R5YA 4G7OF 1I6HJ 1RZ4A 3C1DA 3VODA 3B02A 1G8XA 2PMZN 2LKXA 2GWRA 1YX5A 4IO9F 3PO3J 4XK4A 2QF7A 3SDGA 3KZIC 4XSZF 4R8HA 2KIFA 2W00A 4PCQA 2PMHA 2M9HA 5E17F 3G71I 3L2QA 3V7RA 4D5FA 3DEUA 1U5TB 4BQAA 1I3QJ 1EKEA 2CMPA 1XSDA 3OYFA 3RYRA 3E5XA 2O3FA 1JKRC 4F7ZA 2LNBA 3C7JA 3EPZA 3HC7A 5IP6A 1P4XA 1SD7A 4D7MA 3MZHA 3BPVA 4A3LJ 4P55A 3JRFA 4PK4A 4EJOA 4V19K 1A6QA 4XONA 3WTYC 3BLYA 2NOGA 1P6RA 4OINF 2R0QC 2OU2A 2EH3A 3RSNA 5ICCA 2EBIA 3VPRA 1JT6A 1R5ID 2QVOA 2JJ7A 4KMFA 5FJ8J 5FLXZ 1WZ2A 3C2GA 1JHFA 1XG1A 1TT0A 1YE9A 4C2MJ 4HYEA 5B66C 5EZHA 5ITJA 5J3LA 2VKEA 2YX7A 1XPXA 1TWAJ 4DOZA 1K4TA 4M9ZA 1UCRA 3LOCA 3M07A 2CSOA 3PIOF 2L9RA 5ILVA 1SFKA 4OU0A 1WI9A 4G12A 1OMIA 4HSRA 3I54A 2A6TA 4L9NA 3ZMTA 4BHPA 1IRGA 3WTWC 1O7FA 3ZRGA 1GT0C 1J9IA 1CF7B 2Q1ZB 4C9YA 1N25A 2H6CA 1T0FC 1FX7A 1V5FA 3GFJA 1K79A 4LB6B 3R6SA 2DMQA 4WK8F 2HPMA 4U87A 2PI0A 1ZG3A 3QPLA 3BY6A 2KP6A 2HU9A 2XF7A 2BHZA 3ULQB 4LD5A 2GLOA 2WV1A 4KMUX 2H27A 5DEQA 1LE8A 5CPRB 3SDBA 2V26A 2DTZA 2LC2A 5D8LB 1HDPA 2BOLA 3AG2H 3SXYA 2Y9ZA 2DA2A 3JSPA 4LB5A 3CC7I 2ZXWH 2ZC2A 2WWYA 2R92J 2DDAA 1OLTA 2R7DA 2Y75A 2XPVA 2O8KA 4A3BJ 3EQLF 4Y17A 4AU7A 2ZXJA 1VF9A 3BQYA 4XOTA 1NK2P 4AYBN 4F91B 3FWEA 1S7EA 4UB8C 3IKVA 4DGWB 3CDHA 1OCCH 2MG4A 4HA8A 4ESBA 2A6EF 1I1SA 2HPIA 1WWXA 2OCEA 3DCFA 2A6HF 4U0VA 5BQTA 5GADJ 3KYCB 1T56A 5JR3A 3CCUI 4IXAA 2CQ7A 4XRFA 2HOTA 3DLAA 4HX8A 1JI8A 4L9JA 1P4AA 2F4OB 1KONA 2M8EA 4ZTJA 3FHNA 2DYRH 1HSJA 2NOJB 4AD9A 3ISPA 3ASNH 4RBOA 2NVUB 2DN0A 5FKLA 2VBZA 4AYBA 3HRMA 3K2AA 5CQGA 2EQRA 3RYPA 1Y0NA 1GVJA 4I02A 5DDGA 4HSTA 3HM5A 2P5LC 3BWGA 3DPUA 1Z6RA 1EV7A 2VBWA 4KIFA 5D5XB 1JKQC 1KU3A 4JBAA 3CMYA 2HQRA 4BS9A 2WV0A 4IKFA 1NG6A 4ASNA 2PJPA 3C2BA 2JQ7A 1BR2A 1RETA 5J1UA 2GQQA 2W48A 2BBYA 1WPKA 2VJ5A 4EEFG 4Y13A 1YJWI 2E7WA 4WXCA 1MNMC 1J5YA 3E3VA 1WI3A 3KP6A 4PFOA 1YHQI 3HOZJ 5L3DA 2WADA 3M8JA 4OMZA 3IAS2 3DLLF 1BC8C 3C2HA 3RZDJ 2AXTC 1PP8F 1F9NA 3DTEA 1A36A 1JXSA 4O6JA 3H9QA 5K5OA 4A3FJ 1FZPB 3PNTA 3LSIA 3OOPA 2RO4A 2VXZA 1OCRH 2NYXA 2KL4A 3SFIA 2EFQA 3OYIA 1I5ZA 1ETYA 3BJOA 4BEHA 1QGPA 1UMQA 3JRGA 3E6CC 3RKWA 1D5VA 3BQZA 1XGOA 2BEOA 2OAZA 5LHGA 3CF5F 1ETVA 3J7YJ 1GV5A 2LDUA 5JI6A 1MSFC 3OYAA 3LSKA 3MKZA 1KU7A 1S5LC 2KJCA 1XX5A 4MTEA 3C3WA 5FLXK 1ZARA 3ZMDA 5LHIA 2JPCA 3HPHA 3N05A 1VQ8I 2L7ZA 4CICA 4BYYA 1FY7A 1T38A 3A4CA 4NNJA 5FGMA 3TW6A 3CCEI 1WH5A 3ELKA 2ZMEC 1YOVB 4IRIA 4PGGA 3RPUD 1K78B 1Z3YA 2X0LA 3M8EA 1QHHD 3VEPA 2M1BA 3IWFA 2JA2A 2KLOA 3D5LA 3QOEA 1FEXA 3BC8A 4HNUA 2Y9YA 1BI0A 1YS6A 1ZRCA 1RESA 2X1DA 1DGWY 4M6VA 4XLEA 1HF0A 4XICA 4CCKA 5TJJA 2GBYA 3G6EI 2A07F 4MEYF 2XKPA 1K6YA 2DFFA 4KISA 4ZYEA 1ZGJA 3FM5A 1IV6A 1RPWA 1T6SA 1PP7U 3PQJA 1LEBA 3H35A 1VQMI 2P0WA 4GFBA 3BZ6A 5E79C 2ESNA 1X1CA 2M4GA 3OS0A 2FU4A 3G1LA 5IOYA 3FXRA 5HLHA 2FNPA 1RRJA 2OQRA 4RGXA 1X19A 2GAUA 2O0YA 1FC3A 1G3YA 3GVAA 4F55A 2V1NA 2LRDA 1OYWA 5FRNA 3S2DJ 3MVPA 2OD5A 1LDJA 3FXKA 3KIOA 2QKLB 5E1WA 1IXCA 4BKXA 3ZPLA 2QGUA 2XB5A 1AA7A 2K9QA 2VB6A 4Q4ZF 3FXJA 1B9MA 2UWMA 5C44J 5KNLA 2Q2EB 5BS6A 4M3FA 2M8GX 3CDIA 1U0JA 2YUSA 1K78A 1N77A 3LA7A 2STTA 3V8KA 3ECHA 3U9GA 3TGNA 2XSDC 4RDUA 1ZKGA 2AXLA 2XRNA 3JCUC 1MNDA 5EGOB 4NC6A 2QSHX 2JA6J 2R7TA 2VKHA 3L00A 4V2FA 2FMYA 2W85A 4DW6A 1WJFA 2W1TB 2F6CA 4XORA 2M34A 5C3EJ 1ZR4A 3CCJI 1MBJA 2CGPA 2EA4A 4B43A 3W6VA 3GTLJ 2TCTA 4M3GA 3RPQA 4E7SA 4HDVA 2CQKA 1QHGA 5TGTA 4CYDA 1VQNI 1FWZA 2Z3YA 2FE3A 2XUBA 2HZDA 2KPMA 1R9TJ 1FYKA 4NDLA 2HDCA 3PIPF 3V7SA 1BR1A 2NVQJ 3WU0A 5E8GA 2Z9OA 2V1XA 3CQZJ 3A0HC 3DU5A 3R60A 1I39A 1W36D 2DJNA 4YG2F 1TW3A 3WTXC 4EVIA 4CA0A 3HGYA 5H6RA 4DJAA 1UHMA 2L9SA 4G6QA 2I8DA 1DUXC 4IHYA 5J1YA 3DEEA 1YJ9I 3HDDA 4XKVA 2Q2EA 1Z7LA 4B44A 9ANTA 1XDSA 1QZZA 3AG1H 2HEOA 4G6DA 2HDWA 5J1RA 1NHAA 3JAMZ 1BI3A 2P6SA 3ZQIA 1VQLI 3K4JA 5JVTA 2W1OA 4Y33A 2K9LA 3CCLI 5L3GA 2D1HA 2HKOA 3CP2A
chains in the Genus database with same CATH topology
1VQMI 4V19K 2ZJRF 3J7ZI 5DM6F 2W1TA 1FOWA 1YITI 1YI2I 3I56I 1MMSA 2QEXI 5ITMA 1QA6A 2ZJQF 3CMEI 5ITJA 2L66A 1MVFD 1Y39A 2JQ7A 3O27A 4JDMA 3PIOF 3CCMI 1YJWI 2H8WA 3CCSI 2OTLI 1FOYA 1YHQI 3CCQI 2FOWA 3CCRI 3DLLF 2K3FA 1ACIA 5JVGF 1VQOI 1UB4C 2FY9A 4UY8I 2E34A 1VQ6I 2RO4A 2NXNB 1YJNI 1YSFA 2RO5A 2W1TB 4IOCF 2ZJPF 1YFBA 3CCJI 3CF5F 3CC2I 3J7YJ 5GAEJ 4IOAF 5DM7F 2OTJI 3CCVI 1VQNI 1VQ8I 5GAHJ 3PIPF 3CCEI 3CC7I 1YIJI 1FOXA 5GAGJ 3TNDB 4IO9F 2GLWA 4JDOA 1Z0RA 1VQ9I 1HC8A 3G71I 1YJ9I 1VQ7I 3CJTB 1S72I 3CMAI 2E35A 2K1NA 2RO3A 1VQKI 2E36A 1VQ5I 3CD6I 3CC4I 5GADJ 1VQLI 3G6EI 1VQ4I 3CCUI 1VQPI 3CCLI 3I55I 2QA4I 3G4SI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQM I;  4V19 K;  2ZJR F;  3J7Z I;  5DM6 F;  1FOW A;  1YIT I;  1YI2 I;  3I56 I;  1MMS A;  2QEX I;  1QA6 A;  2ZJQ F;  3CME I;  1Y39 A;  2JQ7 A;  3PIO F;  3CCM I;  1YJW I;  2H8W A;  3CCS I;  2OTL I;  1FOY A;  1YHQ I;  3CCQ I;  2FOW A;  3CCR I;  3DLL F;  2K3F A;  1ACI A;  5JVG F;  1VQO I;  4UY8 I;  2E34 A;  1VQ6 I;  2NXN B;  1YJN I;  4IOC F;  2ZJP F;  3CCJ I;  3CF5 F;  3CC2 I;  3J7Y J;  5GAE J;  4IOA F;  5DM7 F;  2OTJ I;  3CCV I;  1VQN I;  1VQ8 I;  5GAH J;  3PIP F;  3CCE I;  3CC7 I;  1YIJ I;  1FOX A;  5GAG J;  4IO9 F;  1VQ9 I;  1HC8 A;  3G71 I;  1YJ9 I;  1VQ7 I;  3CJT B;  1S72 I;  3CMA I;  2E35 A;  1VQK I;  2E36 A;  1VQ5 I;  3CD6 I;  3CC4 I;  5GAD J;  1VQL I;  3G6E I;  1VQ4 I;  3CCU I;  1VQP I;  3CCL I;  3I55 I;  2QA4 I;  3G4S I; 
#chains in the Genus database with same CATH topology
 4EV0 A;  3KYL A;  3KP7 A;  4JX6 A;  2QSF X;  3H1C A;  3K4B A;  4IEJ A;  1R1V A;  3PNY A;  4C3J J;  2YU3 A;  3HOX J;  1BBY A;  3KET A;  1X3W B;  1ETK A;  3JR9 A;  5FKN A;  2R7U A;  4UHT A;  2W1T A;  2R7X A;  2KFD A;  3MAJ A;  3TKY A;  3FIW A;  1V3F A;  3R61 A;  1HKT A;  2QQA A;  1B4A A;  5LEJ A;  4LFU A;  3BTL A;  1FBS A;  2R93 J;  3WE3 A;  1Q1H A;  2EIM H;  1JUM A;  3ZP5 A;  1UST A;  4HNV A;  4L5I A;  5F1J A;  2RDP A;  2DMT A;  5E3M A;  4XLA A;  5F0H A;  2LR8 A;  2H8W A;  4XRS G;  3DTK A;  4JQF A;  1WH7 A;  4HZF A;  3E6D A;  4J00 A;  2VOD A;  1U9N A;  4UXN A;  4PSW A;  1ZAO A;  1U78 A;  2JA8 J;  2A5W A;  3DFG A;  1B8I B;  4G94 A;  4XOP A;  4AIH A;  3FXM A;  1WRJ A;  3ROU A;  1EH7 A;  2E7X A;  1BM9 A;  2FNA A;  3GBG A;  2GXB A;  1B59 A;  1Z77 A;  2FY9 A;  1W4M A;  3W6K B;  2QWW A;  3TW7 A;  2V1D A;  2UV1 A;  4BNC A;  4BGD A;  2DMP A;  4XLN F;  1SFX A;  5HNF A;  4H0E A;  3HOY J;  1LJ9 A;  3F0C A;  1IAW A;  3E1S A;  3WE2 A;  5EG0 B;  3G2B A;  5A2Q K;  1LFU P;  3RZO J;  3U1K A;  3IAM 2;  2L02 A;  1IV8 A;  3OV8 A;  2VE9 A;  3BZK A;  4I0B A;  1YRN A;  5BPI A;  3GTP J;  1ZR2 A;  1IXS B;  4HX4 A;  2CUF A;  2ZB9 A;  5GTH C;  4EQQ A;  3S3O A;  1DP7 P;  1J7K A;  3L2V A;  4A93 J;  1KQ0 A;  4IF4 A;  2LFB A;  2FEZ A;  4PJN A;  3S17 J;  4AVP A;  3VWB A;  5JLX A;  3OYD A;  3A01 B;  1JUP A;  2Q0O A;  4CCJ A;  3MCZ A;  4YIF A;  3PUF A;  2FX0 A;  3ESW B;  2Y0M A;  4MLO A;  5EEH A;  4YFN F;  2G7U A;  4L9V A;  3RKX A;  2MW8 A;  4PJ0 C;  3TP0 A;  1V55 H;  4Q48 A;  5HDG A;  1G3W A;  2ZFU A;  3SFZ A;  3L09 A;  1D3Y A;  2M0M A;  4GGG A;  1OCT C;  5F1R A;  3CC4 I;  4QWQ A;  3J81 K;  3W2W A;  1S8N A;  2D1V A;  5HS9 A;  2QCO A;  4HW0 A;  4UVA A;  2GIZ A;  2M45 A;  2X6W A;  1B8I A;  1AKH B;  4I01 A;  5DCF A;  2VJI A;  3L7W A;  4M9X A;  1BOA A;  3WGI A;  2BY1 A;  4JK1 X;  3WU2 C;  3X2Q H;  5J40 A;  2COB A;  2ZME B;  2EZI A;  1GXQ A;  4E7I A;  4G6T B;  2IJL A;  4BQO A;  1R1T A;  2FRH A;  2PQ8 A;  1FOW A;  5F08 A;  3RQ4 A;  3IV5 A;  1H8A C;  4A3D J;  2PX9 A;  5ICG A;  1F4K A;  3CJN A;  5FO5 A;  4LG0 A;  2HR3 A;  3OSG A;  1LKX A;  4I0A A;  1IUY A;  3DP7 A;  5ITM A;  3KX2 A;  2F5F A;  1SAN A;  4Q47 A;  1PUF B;  3K69 A;  4B8X A;  2ZJ2 A;  5FKO A;  4MIM A;  3ERE D;  2IS4 A;  4LJZ F;  1WJB A;  4A5N A;  2LD5 A;  3BG3 A;  5E1Z B;  3KLO A;  1LDD A;  4KIB A;  5CVI A;  1BW6 A;  2MH9 A;  3U21 A;  3A01 A;  1SEU A;  1K6O A;  1MBH A;  4QSH A;  1ACI A;  1HLV A;  2QLZ A;  3JAM K;  3I5U A;  1U6G A;  3E6B A;  1OYY A;  3I71 A;  3ZQQ A;  3CCY A;  3OYC A;  1JUS A;  4EM1 A;  4KIG A;  2V6E A;  4A0Y A;  1M1E B;  2ZXH A;  1RIO H;  1B72 B;  3QAH A;  5JHF A;  3ZQC A;  5KVR A;  4NC7 A;  4GXO A;  2JVG A;  4KT5 C;  2HVS A;  2VUM J;  3LQQ A;  1ZRF A;  1RKT A;  2EJR A;  1H0M A;  4QPQ A;  1O3Q A;  1FTZ A;  4PJJ A;  1OYI A;  1OFC X;  5GAE J;  1TC3 C;  2KIQ A;  4QLC U;  2OJE D;  4N9H A;  4KN7 X;  2Y0S N;  4DYQ A;  1BIA A;  1E0E A;  1VND A;  2EFO A;  1IN4 A;  2F48 A;  3D1N I;  2OV7 A;  1XMA A;  3HUG A;  1FMW A;  5HS7 A;  5E3L A;  1H88 C;  3HTU A;  1AWC A;  2KQR A;  2XGX A;  4IHT A;  2V9P A;  5GAG J;  2KKO A;  4A3C J;  2VQH A;  2WAF A;  2YPR A;  3VDX A;  2DT7 B;  4E7J A;  2DOA A;  3KEY A;  3WGH A;  1T39 A;  4I99 C;  1QVT A;  2DFI A;  2O03 A;  1PUF A;  2EV6 A;  1VQ9 I;  2K40 A;  1YLF A;  3EUH A;  3CMA I;  1TL8 A;  1REP C;  3PUB A;  2E36 A;  5DTD A;  2VBX A;  2JN6 A;  1X4P A;  1IRF A;  1WVR A;  4XBF A;  2K27 A;  5LGT A;  3SEQ A;  1ZHF A;  2ZSH B;  1X4O A;  3BTI A;  4DIQ A;  2EZH A;  3J80 Z;  2L4M A;  3ONQ A;  3H9J A;  2WAQ N;  3EUK L;  4ZYG A;  2CFO A;  1JE8 A;  3G4S I;  2Q8K A;  1DPR A;  1Z7U A;  3I9V 2;  1CGP A;  4JP0 A;  3GTM J;  1UHS A;  3L1P A;  1B72 A;  2PFB A;  4FQG A;  2P8T A;  2R7S A;  3UR3 C;  1TW2 A;  2CRG A;  1RI7 A;  3OL3 A;  2XB0 X;  3U2R A;  4RAZ A;  3AG3 H;  2BHY A;  3HHG A;  1R36 A;  2JA5 J;  4BDY A;  1K7A A;  2IRF G;  3IHU A;  3TO9 A;  3T5X A;  4A3M J;  2VQG A;  2LMD A;  4UVC A;  1QA6 A;  3M9A A;  4ZC3 A;  3VSL A;  1LE8 B;  1MVF D;  4NUB A;  5AON A;  3T8R A;  4C30 A;  1GV2 A;  4LGW A;  3FZV A;  1IG7 A;  3H92 A;  3H5A A;  1N75 A;  4XMY A;  1F36 A;  4DZJ A;  3VSK A;  2JUG A;  3VB2 A;  2W57 A;  3I59 B;  2P7V B;  1D0Z A;  2PMZ A;  1V4R A;  1W5C C;  4PJM A;  3WHC A;  2NS7 A;  3ECO A;  3CUQ B;  1SVO A;  5AIP A;  1IC8 A;  4KFC A;  2JWT A;  2KIS A;  3FIS A;  1YYV A;  3WG7 H;  2QKM B;  2DPU A;  2VC1 A;  2NXN B;  3R0A A;  2Y31 A;  3A0B C;  1MMA A;  1ZG1 A;  3NAR A;  1IN7 A;  2ME0 A;  4WF2 A;  2KJB A;  4ON0 A;  3Q0U A;  3T8T A;  2IGK A;  3JTG A;  2FD5 A;  3BR3 A;  1S6L A;  2MLG A;  3HIF A;  3QU6 A;  4Q5S F;  4BUP A;  3RPU A;  2E1M C;  3ZMV A;  3MFK A;  3F22 A;  4E7K A;  3CCV I;  4IRG A;  4G7H F;  2XAQ A;  1UFM A;  4ZYH A;  3I53 A;  1Y8Q B;  1S7A A;  2E1N A;  2LKS A;  4RM3 A;  4HX7 A;  5FRM A;  1MSE C;  1WSU A;  1MKM A;  4ZZL A;  4WXD A;  3FMS A;  3GUD A;  2H1K A;  2LOO A;  1D8J A;  2W25 A;  1FIP A;  5ILS A;  4ESF A;  1FLI A;  2LYC A;  2GLW A;  1XGN A;  4M71 A;  2ACJ A;  1YW7 A;  1VQ7 I;  3CJT B;  3FDY A;  2K1N A;  2CUZ A;  3S2W A;  1VQK I;  3CJR B;  2V9K A;  1H9T A;  2DQL A;  3I59 A;  1S29 A;  2XHK A;  5F0C A;  3CUQ A;  1IDZ A;  1ZLK A;  4Y15 A;  2K5C A;  4XLH A;  4NHJ A;  3S1N J;  1I27 A;  1RR8 C;  2C6Y A;  2L7F P;  2M5W A;  1QNT A;  4HF0 A;  1TWH J;  2QQ8 A;  2JT1 A;  2CG4 A;  2HTS A;  2ZSI B;  4F92 B;  3HOU J;  5ED4 A;  4BQN A;  4L0Z B;  3EET A;  2QUF A;  3E97 A;  2ID6 A;  5J8F A;  1XD7 A;  2F4I A;  3GYH X;  2KMU A;  3BDD A;  2WB1 N;  5L3F A;  4XLF A;  4JX5 A;  2V6C A;  5EYR A;  3IH2 A;  3RTR A;  1S7O A;  1R49 A;  2Y69 H;  5JFR A;  3LSG A;  4BEH B;  2QEX I;  4A3J J;  3NAU A;  4RGS A;  2VBY A;  4J01 A;  3G73 A;  4HV6 A;  3AFH A;  1WJ5 A;  3R0J A;  5D5W B;  2FBI A;  2BXY A;  3F8C A;  3GWZ A;  3TOA A;  1JT0 A;  3K4C A;  4N4O B;  1GDT A;  4ETS A;  2BV6 A;  3HHH A;  2G9W A;  4FT8 A;  1HKQ A;  4EMS A;  3H3Z A;  2GA2 A;  4B3A A;  1TQP A;  4FE7 A;  2OPT A;  3GME A;  2H1L A;  3F3X A;  1VQO I;  2WB1 A;  2B7E A;  2BY2 A;  2VQL A;  3FBN B;  4ZYD A;  1K4S A;  4ZJZ A;  3J80 K;  4IJA A;  1SFE A;  3KP4 A;  2Z16 A;  3RI4 A;  4CO8 A;  1YJN I;  4F3Q A;  4O5V A;  1IRX A;  3Q0W A;  1L3L A;  3WU1 B;  3HYI A;  3FXU A;  3DU6 A;  2O6G E;  1OJL A;  5H6Q A;  3LSR A;  1O4X A;  3GTK J;  3M7G A;  2ZCW A;  3UNG C;  1TWC J;  2K9N A;  4N4N B;  3KLN A;  3S15 J;  3SZG A;  5LHH A;  2BGC A;  2V79 A;  2E19 A;  4Z6Y A;  3QPS A;  3Q3S A;  1X1A A;  3TDZ C;  1F43 A;  2OF7 A;  4ENN A;  1C0W A;  1QRY A;  2DMU A;  2LRE A;  1EA3 A;  1WJA A;  1JGS A;  4TV7 A;  2DFH A;  5D4S A;  5CYV A;  1FOK A;  2IGO A;  1ZYR F;  2XVC A;  2DW4 A;  2X6O A;  2HVR A;  2HS5 A;  1O3S A;  1P7I A;  2K85 A;  5M3M J;  1SMY F;  3DKY A;  3OS1 A;  3P5J A;  4O3M A;  5HOO A;  2XPU A;  2QZ8 A;  2RQP A;  5F27 A;  4RMN A;  4IL6 C;  2KIM A;  4LK0 F;  2DA3 A;  1ON2 A;  1LFB A;  3TOB A;  2UZK A;  4WX9 A;  1TT5 B;  2GOX B;  3FF5 A;  1O7L A;  3PM1 A;  2L4A A;  2W82 A;  1DP3 A;  4II3 A;  4GRI A;  4HV5 A;  1A04 A;  3P7N A;  1APL C;  3PL8 A;  3K7A J;  3WGG A;  4U0W A;  4BL0 B;  4IQJ A;  4M6X A;  4XKC A;  2HYG D;  1SAX A;  4F52 A;  2CUE A;  2ZXI A;  2DA7 A;  1F5T A;  2VXD A;  1R58 A;  3FHZ A;  3JRC A;  4UNO A;  5IOZ A;  4Y3O A;  3K1P A;  1ODD A;  2RQQ A;  5IY5 H;  1PJR A;  2PMU A;  1O57 A;  3ABT A;  4YEL A;  3F8B A;  3F21 A;  2VON A;  3RQI A;  3GFI A;  1D8K A;  2XAS A;  2VI6 A;  1FSH A;  3H36 A;  4U0Y A;  2FQ3 A;  1H9G A;  4YIR X;  1EH6 A;  1YS7 A;  3EUH C;  4IQ4 A;  1DPU A;  2VN2 A;  2XGD A;  2EZL A;  2IS6 A;  1MBG A;  3D0S A;  3V4G A;  2E1C A;  3HSF A;  2P4W A;  2V4J C;  2PJR A;  3CCS I;  3C18 A;  5K5R A;  3DPT A;  3HEF A;  3M3Y J;  2K86 A;  2DDB A;  2K3F A;  3F72 A;  1MGT A;  3MEX A;  2YX4 A;  5F6F A;  2ZO4 A;  1RUN A;  3MQ0 A;  1J59 A;  2E34 A;  4KIT B;  3LQR A;  4LLG F;  2M30 A;  3A03 A;  4PSX A;  1PYV A;  1UEL B;  5ICF A;  3HGG A;  5CVJ A;  3KZZ A;  1KYZ A;  2ETH A;  3HRU A;  5CQE A;  2HVQ A;  3HTS B;  2MD5 A;  2OCC H;  3LAJ A;  3K4N A;  2YSR A;  2NVX J;  2ISY A;  4QPO A;  3CDL A;  4B1R A;  2PEX A;  3BG7 A;  3DBL B;  3QRF F;  1ZK8 A;  1BI2 A;  4D7N A;  2FQ4 A;  2NNY A;  1ZRE A;  2E60 A;  2NVY J;  1EH8 A;  2ZBK A;  1EJ9 A;  2BVM A;  4XN3 A;  4BXF A;  2F5C A;  4KT6 A;  4XID A;  3S2H J;  2EFP A;  3BZC A;  4LIU A;  4M9S A;  1UG0 A;  3KZY A;  4B09 A;  3E6M A;  4HF1 A;  3D5R C;  5IPA A;  3ZCO A;  2Z2S B;  1R4N B;  2DMN A;  4EAT A;  4LIT A;  4EJW A;  3QP6 A;  2E1O A;  3TBI A;  2GZW A;  2MLK A;  5EEA A;  4C2T A;  1ONV A;  2WY8 Q;  3M8F A;  1S9H A;  1TTY A;  3K9T A;  2H09 A;  2J5O A;  5DS9 A;  1P9Q C;  3IH3 A;  4B3X A;  5FKM A;  2Z5U A;  3IRQ A;  5J4V A;  2AHQ A;  1NK3 P;  5IT9 Z;  4AIK A;  3CJQ B;  3EUA A;  3BP8 A;  1VTN C;  2E1M B;  2A05 A;  2IP2 A;  2VPR A;  2E5N A;  3TO7 A;  4CUG A;  1WJD A;  4DNC A;  2R7V A;  1B6A A;  2F2E A;  5GTI C;  5HLG A;  3Q5F A;  3F9K A;  4DBR A;  1G3T A;  2R7R A;  3I64 A;  3L2C A;  2AO9 A;  2VE8 A;  2QYO A;  2R7W A;  3JRB A;  4U7B A;  4IX7 A;  1TBX A;  4D0P A;  2IGM A;  3ZMU A;  2CW7 A;  5BNG A;  1A5J A;  1SVM A;  1P4W A;  3HOV J;  2XC7 A;  2RN7 A;  4ZDL A;  4CH7 A;  3DXJ F;  4I6Z A;  1MMS A;  3RKY A;  4I76 A;  3BR6 A;  1NG7 A;  5ICE A;  2XAJ A;  3CLO A;  1XGM A;  3CME I;  4L0Y B;  3M4O J;  2DK8 A;  2V7F A;  1ORK A;  3MZY A;  2L66 A;  2ECB A;  1D1B A;  1UJ8 A;  2JMW A;  5HVQ C;  4CGZ A;  5K7H A;  4ENJ A;  3D5S C;  1YRN B;  3CUQ C;  2FJ1 A;  2CWE A;  1Y1W J;  2QEN A;  3RDI A;  3VYU B;  1MIJ A;  3ABL H;  2FSW A;  3ZOB A;  2RKH A;  3TO6 A;  4M73 A;  2R3S A;  3GX4 X;  4B4C A;  4IHW A;  4BJ6 C;  1UB4 C;  2HKX A;  2RNG A;  2AQF A;  3V8J A;  3GZN B;  3IWZ A;  3I0T A;  3PFY A;  5HDN A;  3L2R A;  3LSM A;  2TDX A;  1LDK B;  2VQC A;  1YX3 A;  3I4P A;  5TRD A;  2XKO A;  2BVL A;  3QYE A;  5AIQ A;  5FKK A;  2M87 A;  4FAS D;  3F23 A;  3DPL C;  4MEX F;  1BA5 A;  2P81 A;  3F8M A;  1HXD A;  2Y48 A;  5LBQ A;  2HTJ A;  4PZJ A;  4HLY A;  5BOX A;  2PG4 A;  2MC4 A;  2Z99 A;  5DM7 F;  3HOT A;  1YIO A;  2M4K A;  2VL8 A;  2X9D A;  5GP9 A;  3FMR A;  1OPC A;  4X1E A;  4D9J A;  3K70 D;  3OIP A;  1LB2 A;  2GXA A;  4P5O A;  1T2K A;  4AIJ A;  2L0K A;  4E7H A;  1HDD C;  1D0X A;  4RM2 A;  3T0Y A;  1W7P D;  2CQX A;  3NWS A;  1HQC A;  1V54 H;  2L54 A;  5IP7 J;  3NWT A;  1V5G A;  2E5Z A;  2CYY A;  2GIV A;  2CO5 A;  3H9G A;  5JHU A;  1X58 A;  2WAE A;  2HGC A;  4PUS A;  3SEZ A;  1IRZ A;  1PVE A;  4LG0 B;  2EIK H;  2UXX A;  5E1X A;  1R4M B;  3KE2 A;  2E35 A;  4K2E A;  4BH9 A;  3ZN1 A;  4BE1 A;  4IVN A;  3CO7 C;  1QBJ A;  1R7J A;  1W36 C;  4I98 B;  2RVC A;  3H5R A;  3DWL E;  3BJA A;  2E71 A;  5K7F A;  1U9O A;  3O8H A;  1G6N A;  2KRF A;  2GM4 A;  2DCE A;  3DBR B;  3K4M A;  4LMY A;  4P1W A;  1MBK A;  3I55 I;  4AM3 A;  3K4K A;  3A1Y A;  2ELK A;  2XAF A;  1I1G A;  3WTV C;  2P5V A;  2EPF A;  1TWG J;  1IO2 A;  4RLF A;  1G3S A;  1V5E A;  4E4H A;  2XAG A;  1QZY A;  5J8C A;  2ZJR F;  2R7Z J;  4CHU A;  1POG A;  3KCC A;  1MW7 A;  3M1E A;  1U8R A;  1HCR A;  4BE0 A;  2UUZ A;  4A69 C;  1D1A A;  3GLL A;  3HZJ A;  1JGG A;  2DJI A;  3HXL A;  3LFU A;  3F6O A;  3ZQL A;  3JTH A;  3FBI B;  3GO5 A;  5B1B H;  2VPL A;  4FIS A;  1P92 A;  2GXG A;  3CCM I;  2D5V A;  2HNH A;  5DD8 A;  4ZZD A;  3N4M A;  3S1M J;  2J5P A;  2L5Q A;  2BY0 A;  2OTL I;  2W84 A;  4W97 A;  2LLK A;  2MYS A;  1FMV A;  3F6V A;  4Z2Y A;  2BW3 A;  5TIS C;  3WTZ A;  4AID A;  2NAZ A;  5IT9 K;  3HUG B;  4MFE A;  1IDY A;  3A02 A;  1SMT A;  3P9K A;  5CJ9 A;  3S3M A;  3SZP A;  3LWF A;  4CCL A;  2BZT A;  1N78 A;  2MAB A;  3ZGK A;  2FXA A;  3MKY B;  2VLA A;  2HFH A;  3QOP A;  2LP0 A;  3OSF A;  3W2V A;  3MWM A;  3V42 A;  2XF6 A;  1O3R A;  2R7F A;  2L2O A;  2YR2 A;  2HXO A;  1GVD A;  5HNH A;  3K70 C;  1E3H A;  5B1A H;  2ELJ A;  1SD5 A;  3DBH B;  4ABZ A;  3K0L A;  4IHS A;  2IS2 A;  3SQN A;  5BMZ A;  1NH3 A;  3ZXS A;  1QVU A;  1XCB A;  3LST A;  4AUX A;  2X85 A;  2A61 A;  2O7O A;  2DA5 A;  3SJM A;  5CVV A;  2WC2 A;  4HAM A;  1FYM A;  2LBF B;  2WBM A;  2L01 A;  2BXZ A;  4W1U A;  1ZN2 A;  2P7C B;  4M3B A;  1LNW A;  3ZQ7 A;  1MDM B;  3ZQG A;  1TNS A;  2WTE A;  5LRS A;  1Y1V J;  2LK2 A;  1STZ A;  3FMQ A;  3MMY B;  2HDD A;  1GLN A;  4I09 A;  3EDP A;  3OYH A;  4C3I J;  5IT3 A;  4LK1 F;  3REO A;  2AQE A;  1LVK A;  3GTG J;  3HOW J;  3BG9 A;  3E0J B;  4BBR J;  5B3S H;  1WHU A;  4XLC A;  3IC7 A;  2IAI A;  3KFW X;  2QA4 I;  3JSO A;  4FE4 A;  4I2O A;  2X1E A;  3UKG A;  2M2E A;  4A5M A;  1RC9 A;  4L9T A;  2KT0 A;  3FKI J;  1YQA A;  4HF2 A;  2DFE A;  1VFC A;  1USS A;  2DXI A;  2HOA A;  1Y0U A;  5E20 A;  2DA4 A;  3B6A A;  4D5C A;  3OIO A;  3QPT A;  3QWL A;  2IS1 A;  3L2W A;  4A0Z A;  1YI2 I;  3A2K A;  4FX0 A;  1WJC A;  2FF4 A;  3KYD B;  3WTS C;  3RIR A;  2Y0S A;  2ZJQ F;  1MMG A;  2NNN A;  2KZG A;  1KQ8 A;  3HSE A;  2XDV A;  3LA3 A;  4HEA 2;  3FK6 A;  4BY7 J;  4RB0 A;  4X6A J;  4HPQ A;  3HL2 A;  3BPX A;  3WG9 A;  5BPD A;  1UZC A;  1X3Z B;  2LY2 A;  5LGN A;  5D5U B;  1BJA A;  2LBF A;  4M6Y A;  3VYT B;  1IXR C;  1BR4 A;  2ADU A;  4BXX J;  4OIQ F;  3PNV A;  3DQV C;  3HG9 A;  2VJ4 A;  2O8X A;  4GYI A;  4KUM A;  4ZDP A;  2KDZ A;  1HW1 A;  4KYW A;  2UXN A;  3CCR I;  2EFN A;  2CU7 A;  2CV0 A;  3QYF A;  1MDM A;  3LSJ A;  2LH9 A;  4JYK A;  5K5Q A;  1KQ9 A;  2XIG A;  5FLV A;  3F8F A;  3S1Q J;  3HB9 A;  1VQ6 I;  1X2N A;  3IL2 A;  4CSW A;  3S16 J;  3PJR A;  1MJA A;  1XB4 A;  3OYJ A;  3JRI A;  2COM A;  2F5V A;  1X2M A;  1QPM A;  5FFZ A;  2WAQ A;  5LFA A;  4HQM A;  2MD0 A;  5J6X A;  3CC2 I;  4LIV A;  2YS9 A;  2QBY B;  1DGR M;  1QQI A;  1TNT A;  4S0H B;  2ZNZ A;  1XN7 A;  3K1N A;  4HNT A;  2E2J J;  4KA4 A;  1MBF A;  4QIW N;  3I4M J;  1SAU A;  4J19 A;  2FML A;  1LFP A;  4N0B A;  2QM3 A;  3CP8 A;  1FBU A;  3K10 A;  5D8K B;  4Y7N J;  2K9S A;  3BCB A;  1XCV A;  3LSH A;  2LVS A;  4EJU A;  2DBB A;  3LMM A;  5C4X J;  1HBX G;  4A0X A;  2HWV A;  2GOM A;  4R1H A;  5KK1 A;  3Q9S A;  3K6G A;  3JRH A;  2IGN A;  3ASO H;  2DOE A;  2EB7 A;  4LOC A;  1X3U A;  1MZB A;  5CKT A;  3K2Z A;  4Y52 J;  1HKS A;  1SD4 A;  1VQ4 I;  2EWN A;  2LTP A;  1ULY A;  1KU9 A;  2JRT A;  2L9N A;  3ML6 A;  4E7Z A;  5GPA A;  5L3B A;  1R5H A;  3G1M A;  2EZK A;  4UVB A;  5KHD A;  1KGS A;  2I10 A;  2JUC A;  2Y30 A;  2DOF A;  2X1C A;  5FFX A;  4RB1 A;  3BR0 A;  2DLL A;  3CMM A;  2IXS A;  2M7A A;  2YU9 J;  4S04 A;  3CO6 C;  1YG2 A;  1J09 A;  2IBD A;  2D2W A;  2TRT A;  4ENM A;  4P96 A;  1OCZ H;  1SFO J;  1MD0 A;  3TL4 X;  1FP1 D;  3PSF A;  1XSV A;  3I56 I;  4D1Q A;  1E3P A;  2R5Z B;  2QBY A;  3EYY A;  1BW5 A;  5L3E A;  5EZG A;  2CQN A;  1MH3 A;  2ME6 A;  1U5T A;  1ITY A;  1FT9 A;  1QZE A;  3F8N A;  1IN6 A;  2FA5 A;  1G59 A;  2IA2 A;  2QQB A;  3HPG A;  1A31 A;  1ZQ3 P;  2IA0 A;  1P2F A;  2K3P A;  3GCM A;  2BYV E;  2OZU A;  2XAH A;  4HBL A;  3GTJ J;  5K7Z A;  1TP4 A;  2A3S A;  1ZGA A;  3AL0 B;  1T95 A;  1B9N A;  1LEA A;  4OAY A;  2HQA A;  3I4N J;  1R6R A;  3JW4 A;  4A3I J;  2CW8 A;  3SHF A;  4L18 B;  1FP2 A;  1T33 A;  2FBH A;  5LRR A;  1HA8 A;  3SYT A;  3QOD A;  4MQV A;  3OYG A;  3OS2 A;  2JA7 J;  3OYN A;  1QPI A;  3QPH A;  4YII A;  2F4M B;  1TZL A;  2GA1 A;  1OCO H;  1FNN A;  2JSP A;  1BI1 A;  2B0L A;  3B73 A;  3GEZ A;  2MBF A;  1OIS A;  2R7O A;  3S1R J;  4IHV A;  2RV8 A;  4IRH A;  1D0Y A;  4L5J A;  2DU9 A;  3G1O A;  2ICW G;  2RGV A;  2XAU A;  4RAF A;  4ZYA A;  1BIB A;  1ETQ A;  4IHX A;  5H20 A;  4KN4 X;  2DT6 A;  2NS8 A;  1MH4 A;  1QU3 A;  1CF7 A;  1BN5 A;  3FKJ A;  4PFP A;  1G4D A;  4EGY A;  3DKW A;  2R5Z A;  3V7C A;  1BOB A;  3S32 A;  4XQF A;  4U88 A;  1PUE E;  1ETO A;  2HZT A;  2NS0 A;  3W3C A;  3ZN0 A;  4EM2 A;  1HW2 A;  4F93 B;  4BY1 J;  2RO3 A;  3W2A A;  4AWX B;  3VFZ A;  1IGN A;  2OC6 A;  1CQT A;  2DYS H;  2D45 A;  3ABK H;  3L9F A;  4DQ2 A;  3COA C;  4FET A;  1RUO A;  3H5N A;  3GW2 A;  3LFK A;  3ZMS A;  2EIL H;  1ETX A;  2L3D A;  3WTT C;  3LAP A;  3QU3 A;  1K83 J;  3BT9 A;  2PJR B;  3K4L A;  3FXL A;  3OY9 A;  4P9U A;  1W7P B;  2XV4 S;  3ZQF A;  1B1B A;  2O5R A;  1XGS A;  4I7H A;  2HXI A;  4G8X A;  4XM3 A;  3S3N A;  2E2I J;  5EDN A;  2VT3 A;  1UAA A;  2G0E A;  2OUM A;  3DV8 A;  4XL9 A;  5FD6 A;  4HG2 A;  3H0G J;  5DUK A;  4GCV A;  3HRS A;  4KJZ A;  1WKM A;  3MN2 A;  2HOS A;  4XLP F;  1D5Y A;  2IPQ X;  4EM0 B;  3JRE A;  1Z05 A;  2V1U A;  3MD2 A;  1FPQ A;  2EK5 A;  3GXO A;  1HW5 A;  1AHD P;  5E3O A;  1E3O C;  3KP2 A;  5HLI A;  4JX4 A;  2IW5 A;  1P7J A;  3TQN A;  1Y39 A;  5KAI C;  3O27 A;  4WCG A;  2K4J A;  4JDM A;  1WGX A;  1J75 A;  5H2F C;  4OIR F;  1Z1D A;  4E7L A;  2L9V A;  1R23 A;  2CH0 A;  1ZLJ A;  2LY1 A;  3W6J B;  4CCO A;  4BHC A;  3IP4 B;  1HST A;  4M3E A;  1T8I A;  2VC0 A;  3TMO A;  1ETW A;  2DT5 A;  1IN5 A;  1AU7 A;  2X51 A;  1Z9C A;  3E5U A;  2K7L A;  2EIJ H;  1LPQ A;  3LSP A;  1R22 A;  1WQ2 A;  2MSY A;  1R1U A;  1SD6 A;  4CDG A;  4HRI A;  2KRC A;  1UHW A;  2DTR A;  4NBQ A;  4DYC A;  1R71 A;  5JLW A;  2R4G A;  3OL4 A;  4B47 A;  1E17 A;  1W7P A;  3OYE A;  2RRE A;  3NQO A;  1S3J A;  1I6X A;  2RC4 A;  2O9L A;  2ID3 A;  1OR7 A;  4ZTF A;  4BXU A;  2DOD A;  4FX4 A;  4UUS B;  3HJE A;  1YW8 A;  4XN0 A;  4ENK A;  3ERM A;  2JTV A;  4BAY A;  4BBS J;  5CLS A;  4A12 A;  2N8G A;  2EA2 A;  1FIA A;  1VI0 A;  4XNF A;  2G7H A;  2RNJ A;  1FOX A;  1J2X A;  1Q1V A;  3P9I A;  2X48 A;  4YFX F;  2MH2 A;  2B9S A;  4GDF A;  2KHM A;  2ZNY A;  4MGR A;  5CVR A;  3LNQ A;  2VT2 A;  4PJL A;  5A2Q Z;  2HYF A;  3CZ6 A;  1Z91 A;  4WXH A;  4LLN A;  5FB2 A;  4Y4R A;  2PLY A;  3HRT A;  4M72 A;  2EFW A;  4FHT A;  4RAG A;  2NRA C;  3TED A;  3FXQ A;  6PAX A;  1Y8R B;  4MO7 A;  1FYL A;  1W1W E;  1X1B A;  1JJ8 C;  3GTO J;  5D6E A;  3BG5 A;  5DCM B;  4RAY A;  4A6E A;  4CYC B;  4B48 A;  1LQ1 A;  4R79 A;  2H94 A;  5M5W J;  4MTD A;  4XR6 A;  4ITV A;  3GZ6 A;  2LF7 A;  1H89 C;  3AG4 H;  1DDN A;  1Z67 A;  3LL7 A;  2VAS A;  2KDO A;  5DYM A;  1YIT I;  2ELH A;  2MA3 A;  3TP3 A;  1W5S A;  3ZQH A;  1LUJ B;  1MJB A;  3M1C A;  1JTY A;  2OZ6 A;  4AVZ A;  2A5Y B;  4MHG A;  3J81 Z;  2OBP A;  1ZH5 A;  3OYL A;  1YW9 A;  2JVH A;  2VKD A;  3O8G A;  3I58 A;  2PN6 A;  3S14 J;  2VOO A;  3BOQ A;  4M74 A;  1E2X A;  3ZR8 X;  5ERI A;  4UUS A;  3O2P E;  2XRL A;  4BE2 A;  2VIX A;  3JRD A;  2E2H J;  3J7A O;  1JKP C;  3HKZ N;  4V2G A;  2MFZ A;  5F04 A;  3H0D A;  1TWF J;  5DV5 A;  3I3L A;  2MGQ A;  1RNL A;  3KP5 A;  4GO1 A;  5FRO A;  1UB9 A;  3BCA A;  3HSR A;  4RA2 A;  3VOE A;  4HQE A;  1GUU A;  4A3G J;  5D4R A;  2XRO A;  1VZ0 A;  1Y56 A;  3AAF A;  1JKO C;  1R5G A;  2JSC A;  2XSJ C;  4BDZ A;  3NEU A;  4UY8 I;  5DD4 A;  3OYM A;  2IT0 A;  1KYW A;  2AS5 F;  3GTQ J;  2ISZ A;  1UG2 A;  4II2 A;  1YSF A;  4KNY A;  1XSX A;  4PGH A;  2A69 F;  4IOC F;  1K61 A;  3LA2 A;  5C4J J;  3BR1 A;  1F1Z A;  1U5T C;  1WFX A;  2Z33 A;  1U8B A;  5LLQ A;  3MKL A;  3HKZ A;  2HQ5 A;  1KA8 A;  2JZY A;  2LSO A;  5DCM A;  2WY7 Q;  4NQW B;  1JTX A;  1MJ9 A;  4CYC A;  3U1D A;  2KIU A;  4A3K J;  3KEQ A;  3E5Q A;  2QQ9 A;  4UUT A;  2CJJ A;  5E18 F;  4RB2 C;  3GLX A;  4UV9 A;  1FSE A;  2EIN H;  4CZZ A;  5IYB J;  3MZ8 A;  5M5X J;  1W0U A;  4BAC A;  1YIJ I;  2A68 F;  3CTA A;  3CF2 A;  3TND B;  2STW A;  1YTY A;  4PDK A;  2BE5 F;  3FXO A;  5EGO A;  3GZ5 A;  4UUV A;  3PQK A;  4BJ5 C;  4QTR A;  2CFX A;  2FOK A;  3BRO A;  4JDO A;  1ENH A;  4HDU A;  4KDP A;  4OOI A;  1S72 I;  3P9C A;  2EV0 A;  4YFK F;  2CV2 A;  1MMN A;  1ZEL A;  4FCY A;  1Y6I A;  5L3C A;  5K1Y A;  3MKW B;  4ZDO A;  3GFM A;  3RCO A;  5D6F A;  4BU2 A;  1DQU A;  1A35 A;  1XDU A;  3KEO A;  3RJP A;  5IYD J;  2F5E A;  3GFL A;  5KCM A;  1VQP I;  4DYR A;  4C2U A;  5J47 A;  1DU6 A;  2K02 A;  3DTI A;  1IF1 A;  3WHB A;  1T08 B;  1NTC A;  1EF4 A;  2DA1 A;  5FD5 A;  2F5D A;  2BW3 B;  3Q9V A;  3CES A;  4WWC A;  3ABM H;  3HOS A;  4C3H J;  2XGC A;  1T0F A;  2ESH A;  3J7Z I;  5KAF C;  1BC7 C;  1MBE A;  4BQQ A;  3PO2 J;  5FLM J;  4ESJ A;  2DO7 A;  4IPA A;  2IA1 A;  5LD2 C;  1IUF A;  3N97 A;  5LGU A;  2X4H A;  4CZC A;  2FUG 2;  2FBK A;  5B5E C;  4NQW A;  2LF8 A;  3S8P A;  5DUI A;  2JK3 A;  3FX3 A;  1OCP A;  4LG3 A;  2K9M A;  4G9Y A;  1BL0 A;  2V9V A;  4L5E A;  3IRR A;  4X0G A;  3AL0 C;  3FK7 A;  1J0R A;  3BR2 A;  2VOP A;  3KPH A;  4EGZ A;  1ON1 A;  2CW0 F;  2KZV A;  2X6X A;  2XPW A;  2CUJ A;  1IW7 F;  1W5T A;  5EF6 A;  2FOW A;  3KP3 A;  3OR1 C;  5LEK A;  3K1M A;  4XRS A;  3CCQ I;  4UB6 C;  5CVU A;  1U3E M;  3CLQ A;  3V8L A;  3OYK A;  1XMX A;  3OMY A;  1Z0X A;  1TLH B;  3H3U A;  4MFD A;  2OQG A;  2Y2Z A;  2P5K A;  1QO0 D;  3B6C A;  3DKX A;  3ZMZ A;  1KU2 A;  4OWR B;  5IP9 J;  1FTT A;  2DK5 A;  4JOM A;  3IUO A;  2R7Q A;  1T98 A;  2KRH A;  4CCM A;  2RO5 A;  3QP5 A;  2MC3 A;  2WA0 A;  1W0T A;  1R00 A;  5HS8 A;  3BG6 A;  5M5Y J;  1ZGW A;  3VYR B;  1Z6T A;  4MQ9 F;  2H8R A;  4IOA F;  2XGE A;  4ANJ A;  4UV8 A;  3EYI A;  2OTJ I;  5D5V B;  2IVM A;  4G7Z F;  5M3F J;  2QSG X;  3NRV A;  5F0F A;  4RLQ A;  5HOD A;  2O61 A;  4P9F A;  4ZH4 F;  4LLL A;  3O6B B;  1GHC A;  4BHB A;  3GF2 A;  4OIP F;  3AKZ A;  4HLX A;  4BJT A;  3ABU A;  4OMY A;  4E6K G;  2PBI A;  2DI3 A;  3DF8 A;  4A2U A;  1Z0R A;  1HC8 A;  4NC8 A;  2DQR A;  3BTC A;  4RGU A;  3OR2 C;  1X1P A;  2W24 A;  1I3A A;  3VYS B;  5EG0 A;  1DU0 A;  1ZRD A;  1VQ5 I;  1D1C A;  3QYB A;  4XRM A;  4DZP A;  3JRA A;  3BJ6 A;  3CD6 I;  2CS3 A;  1RR7 A;  2DA6 A;  1U2W A;  3CUO A;  1IJW C;  2CQQ A;  2W4S A;  1HOM A;  3HBL A;  1BJZ A;  1ERD A;  5J4Y A;  4RGR A;  4GYG A;  4RS8 A;  2BY3 A;  1OR7 C;  3T1B A;  4YRV A;  2I5U A;  4KIC A;  2HYJ A;  1IZ1 A;  4A6D A;  3WOD F;  1XS9 A;  1OQY A;  3R4K A;  3RKQ A;  3H3V K;  2B63 J;  2ZKZ A;  2X6Y A;  3TDU C;  2Z1D A;  1SVL A;  5DM6 F;  4HOB A;  1XC5 A;  2HQN A;  3E7L A;  4H4K C;  2OA4 A;  5HDK A;  1WJE A;  2L7K A;  4CXF A;  2R5Y B;  1XTA A;  4FTH A;  1FBQ A;  3OYB A;  3S93 A;  2ZFW A;  5E8I A;  2K4B A;  3WTU C;  2DAO A;  2M3A A;  1JHH A;  1IN8 A;  5EEG A;  4M3D A;  3IH4 A;  2EV5 A;  2P6T A;  2LY9 A;  1L0O C;  2RAE A;  5F64 A;  4DBQ A;  5ILU A;  1RKW A;  4E70 A;  1AKH A;  4NB5 A;  2CV1 A;  1FOY A;  3BTJ A;  1ZTR A;  3G3Z A;  1Z3X A;  4CCN A;  4XSX F;  3L2U A;  1SC7 A;  2ECC A;  2ZME A;  5JVG F;  1PDN C;  1YFH A;  2VJJ A;  4RB3 C;  4XKB A;  1WCM J;  2NVT J;  1I50 J;  1TQM A;  1Z21 A;  2XF5 A;  4IZZ A;  1G2H A;  2JRM A;  3IKT A;  3O3K A;  1MMD A;  5EJC A;  2HI3 A;  1OKR A;  4XKW A;  3Q0V A;  5E3N A;  3BR5 A;  1YO5 C;  4EJT A;  1MNE A;  2H6B A;  2L7M P;  2ZJP F;  2IEK A;  3OWT A;  1YFB A;  2HOE A;  3PFI A;  2LKP A;  4EJV A;  3DEW A;  2M0C A;  1SFU A;  2LG4 A;  4A3E J;  1A6I A;  4U7D A;  4MNU A;  1GXP A;  4S05 A;  4N9I A;  3FM3 A;  1KZH A;  2DPD A;  1X1D A;  2JPB A;  3QQA A;  1LVA A;  5GPC A;  4OIO F;  3J7A Y;  5IYC J;  2VKV A;  3OIQ A;  3SZT A;  4AC0 A;  5GAH J;  2M7B A;  1XMK A;  4YEJ A;  1ZG5 A;  1FJL A;  1JJ6 C;  1AOY A;  2W7N A;  1O3T A;  1TQI A;  3OOU A;  3PSI A;  4OAZ A;  5HLT A;  2R5Y A;  4G7O F;  1I6H J;  1RZ4 A;  3C1D A;  3VOD A;  3B02 A;  1G8X A;  2PMZ N;  2LKX A;  2GWR A;  1YX5 A;  4IO9 F;  3PO3 J;  4XK4 A;  2QF7 A;  3SDG A;  3KZI C;  4XSZ F;  4R8H A;  2KIF A;  2W00 A;  4PCQ A;  2PMH A;  2M9H A;  5E17 F;  3G71 I;  3L2Q A;  3V7R A;  4D5F A;  3DEU A;  1U5T B;  4BQA A;  1I3Q J;  1EKE A;  2CMP A;  1XSD A;  3OYF A;  3RYR A;  3E5X A;  2O3F A;  1JKR C;  4F7Z A;  2LNB A;  3C7J A;  3EPZ A;  3HC7 A;  5IP6 A;  1P4X A;  1SD7 A;  4D7M A;  3MZH A;  3BPV A;  4A3L J;  4P55 A;  3JRF A;  4PK4 A;  4EJO A;  4V19 K;  1A6Q A;  4XON A;  3WTY C;  3BLY A;  2NOG A;  1P6R A;  4OIN F;  2R0Q C;  2OU2 A;  2EH3 A;  3RSN A;  5ICC A;  2EBI A;  3VPR A;  1JT6 A;  1R5I D;  2QVO A;  2JJ7 A;  4KMF A;  5FJ8 J;  5FLX Z;  1WZ2 A;  3C2G A;  1JHF A;  1XG1 A;  1TT0 A;  1YE9 A;  4C2M J;  4HYE A;  5B66 C;  5EZH A;  5ITJ A;  5J3L A;  2VKE A;  2YX7 A;  1XPX A;  1TWA J;  4DOZ A;  1K4T A;  4M9Z A;  1UCR A;  3LOC A;  3M07 A;  2CSO A;  3PIO F;  2L9R A;  5ILV A;  1SFK A;  4OU0 A;  1WI9 A;  4G12 A;  1OMI A;  4HSR A;  3I54 A;  2A6T A;  4L9N A;  3ZMT A;  4BHP A;  1IRG A;  3WTW C;  1O7F A;  3ZRG A;  1GT0 C;  1J9I A;  1CF7 B;  2Q1Z B;  4C9Y A;  1N25 A;  2H6C A;  1T0F C;  1FX7 A;  1V5F A;  3GFJ A;  1K79 A;  4LB6 B;  3R6S A;  2DMQ A;  4WK8 F;  2HPM A;  4U87 A;  2PI0 A;  1ZG3 A;  3QPL A;  3BY6 A;  2KP6 A;  2HU9 A;  2XF7 A;  2BHZ A;  3ULQ B;  4LD5 A;  2GLO A;  2WV1 A;  4KMU X;  2H27 A;  5DEQ A;  1LE8 A;  5CPR B;  3SDB A;  2V26 A;  2DTZ A;  2LC2 A;  5D8L B;  1HDP A;  2BOL A;  3AG2 H;  3SXY A;  2Y9Z A;  2DA2 A;  3JSP A;  4LB5 A;  3CC7 I;  2ZXW H;  2ZC2 A;  2WWY A;  2R92 J;  2DDA A;  1OLT A;  2R7D A;  2Y75 A;  2XPV A;  2O8K A;  4A3B J;  3EQL F;  4Y17 A;  4AU7 A;  2ZXJ A;  1VF9 A;  3BQY A;  4XOT A;  1NK2 P;  4AYB N;  4F91 B;  3FWE A;  1S7E A;  4UB8 C;  3IKV A;  4DGW B;  3CDH A;  1OCC H;  2MG4 A;  4HA8 A;  4ESB A;  2A6E F;  1I1S A;  2HPI A;  1WWX A;  2OCE A;  3DCF A;  2A6H F;  4U0V A;  5BQT A;  5GAD J;  3KYC B;  1T56 A;  5JR3 A;  3CCU I;  4IXA A;  2CQ7 A;  4XRF A;  2HOT A;  3DLA A;  4HX8 A;  1JI8 A;  4L9J A;  1P4A A;  2F4O B;  1KON A;  2M8E A;  4ZTJ A;  3FHN A;  2DYR H;  1HSJ A;  2NOJ B;  4AD9 A;  3ISP A;  3ASN H;  4RBO A;  2NVU B;  2DN0 A;  5FKL A;  2VBZ A;  4AYB A;  3HRM A;  3K2A A;  5CQG A;  2EQR A;  3RYP A;  1Y0N A;  1GVJ A;  4I02 A;  5DDG A;  4HST A;  3HM5 A;  2P5L C;  3BWG A;  3DPU A;  1Z6R A;  1EV7 A;  2VBW A;  4KIF A;  5D5X B;  1JKQ C;  1KU3 A;  4JBA A;  3CMY A;  2HQR A;  4BS9 A;  2WV0 A;  4IKF A;  1NG6 A;  4ASN A;  2PJP A;  3C2B A;  2JQ7 A;  1BR2 A;  1RET A;  5J1U A;  2GQQ A;  2W48 A;  2BBY A;  1WPK A;  2VJ5 A;  4EEF G;  4Y13 A;  1YJW I;  2E7W A;  4WXC A;  1MNM C;  1J5Y A;  3E3V A;  1WI3 A;  3KP6 A;  4PFO A;  1YHQ I;  3HOZ J;  5L3D A;  2WAD A;  3M8J A;  4OMZ A;  3IAS 2;  3DLL F;  1BC8 C;  3C2H A;  3RZD J;  2AXT C;  1PP8 F;  1F9N A;  3DTE A;  1A36 A;  1JXS A;  4O6J A;  3H9Q A;  5K5O A;  4A3F J;  1FZP B;  3PNT A;  3LSI A;  3OOP A;  2RO4 A;  2VXZ A;  1OCR H;  2NYX A;  2KL4 A;  3SFI A;  2EFQ A;  3OYI A;  1I5Z A;  1ETY A;  3BJO A;  4BEH A;  1QGP A;  1UMQ A;  3JRG A;  3E6C C;  3RKW A;  1D5V A;  3BQZ A;  1XGO A;  2BEO A;  2OAZ A;  5LHG A;  3CF5 F;  1ETV A;  3J7Y J;  1GV5 A;  2LDU A;  5JI6 A;  1MSF C;  3OYA A;  3LSK A;  3MKZ A;  1KU7 A;  1S5L C;  2KJC A;  1XX5 A;  4MTE A;  3C3W A;  5FLX K;  1ZAR A;  3ZMD A;  5LHI A;  2JPC A;  3HPH A;  3N05 A;  1VQ8 I;  2L7Z A;  4CIC A;  4BYY A;  1FY7 A;  1T38 A;  3A4C A;  4NNJ A;  5FGM A;  3TW6 A;  3CCE I;  1WH5 A;  3ELK A;  2ZME C;  1YOV B;  4IRI A;  4PGG A;  3RPU D;  1K78 B;  1Z3Y A;  2X0L A;  3M8E A;  1QHH D;  3VEP A;  2M1B A;  3IWF A;  2JA2 A;  2KLO A;  3D5L A;  3QOE A;  1FEX A;  3BC8 A;  4HNU A;  2Y9Y A;  1BI0 A;  1YS6 A;  1ZRC A;  1RES A;  2X1D A;  1DGW Y;  4M6V A;  4XLE A;  1HF0 A;  4XIC A;  4CCK A;  5TJJ A;  2GBY A;  3G6E I;  2A07 F;  4MEY F;  2XKP A;  1K6Y A;  2DFF A;  4KIS A;  4ZYE A;  1ZGJ A;  3FM5 A;  1IV6 A;  1RPW A;  1T6S A;  1PP7 U;  3PQJ A;  1LEB A;  3H35 A;  1VQM I;  2P0W A;  4GFB A;  3BZ6 A;  5E79 C;  2ESN A;  1X1C A;  2M4G A;  3OS0 A;  2FU4 A;  3G1L A;  5IOY A;  3FXR A;  5HLH A;  2FNP A;  1RRJ A;  2OQR A;  4RGX A;  1X19 A;  2GAU A;  2O0Y A;  1FC3 A;  1G3Y A;  3GVA A;  4F55 A;  2V1N A;  2LRD A;  1OYW A;  5FRN A;  3S2D J;  3MVP A;  2OD5 A;  1LDJ A;  3FXK A;  3KIO A;  2QKL B;  5E1W A;  1IXC A;  4BKX A;  3ZPL A;  2QGU A;  2XB5 A;  1AA7 A;  2K9Q A;  2VB6 A;  4Q4Z F;  3FXJ A;  1B9M A;  2UWM A;  5C44 J;  5KNL A;  2Q2E B;  5BS6 A;  4M3F A;  2M8G X;  3CDI A;  1U0J A;  2YUS A;  1K78 A;  1N77 A;  3LA7 A;  2STT A;  3V8K A;  3ECH A;  3U9G A;  3TGN A;  2XSD C;  4RDU A;  1ZKG A;  2AXL A;  2XRN A;  3JCU C;  1MND A;  5EGO B;  4NC6 A;  2QSH X;  2JA6 J;  2R7T A;  2VKH A;  3L00 A;  4V2F A;  2FMY A;  2W85 A;  4DW6 A;  1WJF A;  2W1T B;  2F6C A;  4XOR A;  2M34 A;  5C3E J;  1ZR4 A;  3CCJ I;  1MBJ A;  2CGP A;  2EA4 A;  4B43 A;  3W6V A;  3GTL J;  2TCT A;  4M3G A;  3RPQ A;  4E7S A;  4HDV A;  2CQK A;  1QHG A;  5TGT A;  4CYD A;  1VQN I;  1FWZ A;  2Z3Y A;  2FE3 A;  2XUB A;  2HZD A;  2KPM A;  1R9T J;  1FYK A;  4NDL A;  2HDC A;  3PIP F;  3V7S A;  1BR1 A;  2NVQ J;  3WU0 A;  5E8G A;  2Z9O A;  2V1X A;  3CQZ J;  3A0H C;  3DU5 A;  3R60 A;  1I39 A;  1W36 D;  2DJN A;  4YG2 F;  1TW3 A;  3WTX C;  4EVI A;  4CA0 A;  3HGY A;  5H6R A;  4DJA A;  1UHM A;  2L9S A;  4G6Q A;  2I8D A;  1DUX C;  4IHY A;  5J1Y A;  3DEE A;  1YJ9 I;  3HDD A;  4XKV A;  2Q2E A;  1Z7L A;  4B44 A;  9ANT A;  1XDS A;  1QZZ A;  3AG1 H;  2HEO A;  4G6D A;  2HDW A;  5J1R A;  1NHA A;  3JAM Z;  1BI3 A;  2P6S A;  3ZQI A;  1VQL I;  3K4J A;  5JVT A;  2W1O A;  4Y33 A;  2K9L A;  3CCL I;  5L3G A;  2D1H A;  2HKO A;  3CP2 A; 
#chains in the Genus database with same CATH homology
 1VQM I;  4V19 K;  2ZJR F;  3J7Z I;  5DM6 F;  2W1T A;  1FOW A;  1YIT I;  1YI2 I;  3I56 I;  1MMS A;  2QEX I;  5ITM A;  1QA6 A;  2ZJQ F;  3CME I;  5ITJ A;  2L66 A;  1MVF D;  1Y39 A;  2JQ7 A;  3O27 A;  4JDM A;  3PIO F;  3CCM I;  1YJW I;  2H8W A;  3CCS I;  2OTL I;  1FOY A;  1YHQ I;  3CCQ I;  2FOW A;  3CCR I;  3DLL F;  2K3F A;  1ACI A;  5JVG F;  1VQO I;  1UB4 C;  2FY9 A;  4UY8 I;  2E34 A;  1VQ6 I;  2RO4 A;  2NXN B;  1YJN I;  1YSF A;  2RO5 A;  2W1T B;  4IOC F;  2ZJP F;  1YFB A;  3CCJ I;  3CF5 F;  3CC2 I;  3J7Y J;  5GAE J;  4IOA F;  5DM7 F;  2OTJ I;  3CCV I;  1VQN I;  1VQ8 I;  5GAH J;  3PIP F;  3CCE I;  3CC7 I;  1YIJ I;  1FOX A;  5GAG J;  3TND B;  4IO9 F;  2GLW A;  4JDO A;  1Z0R A;  1VQ9 I;  1HC8 A;  3G71 I;  1YJ9 I;  1VQ7 I;  3CJT B;  1S72 I;  3CMA I;  2E35 A;  2K1N A;  2RO3 A;  1VQK I;  2E36 A;  1VQ5 I;  3CD6 I;  3CC4 I;  5GAD J;  1VQL I;  3G6E I;  1VQ4 I;  3CCU I;  1VQP I;  3CCL I;  3I55 I;  2QA4 I;  3G4S I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...