2QA4I

A more complete structure of the the l7/l12 stalk of the haloarcula marismortui 50s large ribosomal subunit
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
126
structure length
118
Chain Sequence
IEVLVPGGEANPGPPLGPELPVDVQAVVQEINDQTAEVPVTVKYDDDGSFEIEVGVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title Structure of the base of the L7/L12 stalk of the Haloarcula marismortui large ribosomal subunit: Analysis of L11 movements
pubmed doi rcsb
molecule tags Ribosome
total genus 13
structure length 118
sequence length 126
ec nomenclature
pdb deposition date 2007-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 2qa4I02
2.10.260.30 Mainly Beta Ribbon Pemi-like Protein 1; Chain: D Pemi-like Protein 1; Chain: D 2qa4I01
1VQ5I 3I56I 3J7ZI 1VQ6I 2JQ7A 3PIOF 3DLLF 3CCQI 3CCRI 3CF5F 1VQPI 1VQNI 3CC4I 3CC2I 1Y39A 4IOCF 3CMEI 1YJ9I 5GAGJ 1FOWA 2E36A 3CMAI 3CCUI 2ZJQF 1FOYA 2OTJI 5GAEJ 3G4SI 5GAHJ 1YI2I 3CD6I 5JVGF 2OTLI 1VQOI 1YJWI 2QEXI 5GADJ 2QA4I 3I55I 3CCLI 1VQ7I 3CCEI 2FOWA 1VQ8I 1MMSA 1S72I 1FOXA 4IO9F 1YITI 1YIJI 1VQKI 3CCSI 3CC7I 4UY8I 1HC8A 3CCMI 4V19K 3CCVI 1ACIA 1YJNI 1VQLI 3G71I 3CJTB 5DM6F 2H8WA 1VQ9I 1QA6A 2E35A 4IOAF 2ZJRF 1VQMI 1YHQI 5DM7F 2E34A 1VQ4I 2NXNB 3G6EI 3CCJI 3PIPF 2K3FA 2ZJPF 3J7YJ
chains in the Genus database with same CATH superfamily
1VQ5I 4IQ4A 9ANTA 3BR1A 3HRSA 2DA3A 3KEOA 3F0CA 2X48A 1EH8A 2KHMA 3L7WA 1Y56A 2HOSA 2X51A 1W7PA 3FKIJ 1SFOJ 3K2AA 2DFEA 1T98A 2ZXIA 4F3QA 1A35A 3CC2I 1U0JA 4BEHB 2ZMEC 2X6YA 4D7NA 3MMYB 3OYEA 2B0LA 1YJ9I 2IW5A 4NNJA 2ADUA 1PVEA 2CUZA 2IAIA 5FKKA 4ANJA 1F9NA 5J4VA 1XTAA 2VC0A 2W4SA 3CCUI 2QGUA 5HLTA 2DMTA 2DODA 1MNEA 1TNSA 4RLFA 1LFBA 5E3MA 2NNNA 2W7NA 3TOBA 1LDKB 1YJWI 2EIKH 1G3TA 3R61A 2JA7J 4A5NA 3ONQA 1YIOA 2P8TA 3ZMZA 5EDNA 2BY0A 3I0TA 5LEJA 4ESJA 1WJAA 5TJJA 3KLNA 1KU7A 2E1MB 3OYMA 4UVAA 3FXOA 1NH3A 4BXFA 1X1DA 4CH7A 3J7AY 2BGCA 1Z1DA 4BS9A 4CZZA 3OIPA 4UXNA 4QIWN 3H3VK 3SZPA 3HIFA 3MQ0A 1OYIA 1E3PA 2HGCA 4Q5SF 1POGA 1MNMC 1O3SA 4FHTA 3QWLA 1Z9CA 5EZGA 1YJNI 1DP3A 1PUEE 3Q9VA 4JX6A 6PAXA 2BHZA 2KQRA 1SD7A 3MKYB 3S17J 2LMDA 1B1BA 3H1CA 1UG0A 4C30A 4EM0B 4AIDA 3ZOBA 1K4TA 2STTA 4L5JA 2M0CA 2K02A 3TP3A 1JUMA 1IF1A 3B73A 2JA6J 2NOGA 3FM3A 4HAMA 2Y31A 2Y48A 3PNTA 5IPAA 4EJOA 2QQBA 2EB7A 2L54A 3M1CA 2NXNB 2CUFA 1FMWA 3A03A 3C2GA 3EQLF 3WTYC 5AIPA 2XASA 1A6IA 3A0BC 1P4WA 1E3OC 5A2QK 2L4AA 4GYGA 2RGVA 1FC3A 4UUVA 3IWZA 2F6CA 3K4JA 4YFXF 1V5GA 4XOTA 1I1SA 2P6TA 1X58A 4MHGA 2NVQJ 1GXPA 4A3LJ 5M5WJ 1TQMA 1RZ4A 5F08A 3OWTA 4CGZA 3DFGA 5K7FA 1X1CA 1YOVB 3T8RA 1N25A 3BWGA 4IL6C 3GF2A 2XAFA 4E7JA 4M73A 2VLAA 2R7SA 4HF2A 2HDCA 4GFBA 1ITYA 1ZLJA 3KP5A 3S1RJ 4DZJA 4ENMA 2A6TA 4LG0B 3WTZA 1JKRC 3G73A 5JHFA 4BE1A 1SFEA 5KHDA 4ZYAA 1Y1VJ 2LP0A 2KZVA 3HSRA 2O0YA 4IHTA 3E6BA 2L02A 3T0YA 1X1AA 5EG0B 2VE8A 5JVGF 4OAYA 1IDZA 2ELJA 3OSFA 3K4BA 1RESA 3ERMA 2GZWA 1TT0A 4LLLA 3GO5A 3LQQA 2K9NA 1R49A 1FBQA 1QHHD 5FLMJ 2Y0SA 5DV5A 2G7HA 3BTJA 2K86A 3B6AA 3CO6C 1JT0A 2K5CA 5CYVA 2JPBA 1WJFA 3C3WA 2R93J 4M6VA 1MMSA 4E7LA 1AKHB 4HQMA 1O7LA 2AXLA 5IT9Z 2YUSA 4P9UA 4XKBA 1NK2P 1IRXA 1DDNA 3S1NJ 2FJ1A 4HNVA 3CCSI 1SMYF 3LL7A 1O3RA 3T1BA 1U5TA 3JCUC 2IGNA 4V19K 2P7CB 2QLZA 4C2UA 2P81A 3GFIA 1HKTA 3I4MJ 1G3SA 5ICFA 3SXYA 1XDUA 3KEYA 1ETVA 1IO2A 4I0AA 4DQ2A 3ABLH 4XRSA 2CYYA 5EGOB 1BI3A 1X4OA 4U7DA 2KL4A 2VONA 1XGNA 1G2HA 2L0KA 3VWBA 4LITA 4IRGA 3LSRA 1BC7C 3CJNA 3E97A 2FNPA 1JHFA 4DIQA 3BG9A 4Q47A 1LFUP 3BJ6A 1BR4A 1B59A 2DJNA 1YRNA 2MD5A 3DCFA 4LGWA 2L9VA 2DFIA 3CJRB 1I39A 1LVAA 3FMRA 1ETYA 4G6TB 1J5YA 2OQGA 4ZYDA 4LG3A 2G0EA 2FA5A 1GDTA 2F5CA 2QENA 1ULYA 3DLAA 2RDPA 5EEGA 3F23A 2FNAA 3RKXA 2JN6A 2H94A 4XLAA 4BY7J 2E2IJ 1W0UA 3LSJA 3M07A 1CF7B 1WWXA 1IG7A 2EPFA 4KIBA 1O4XA 5HOOA 1SD4A 5D5UB 1MBGA 5HODA 2HPMA 1QGPA 4OIPF 3A01B 2XV4S 3QOPA 1JGSA 2A3SA 2EV0A 4MFEA 5K5OA 2BVMA 4Z2YA 1Z67A 4RAYA 2ME0A 3OS2A 2R92J 1I6HJ 1AOYA 2M0MA 2V79A 3HTUA 2W1TB 3U1DA 2G7UA 3MKLA 1ZRCA 1E0EA 4F7ZA 2R7ZJ 3FWEA 2OC6A 2H6CA 2HWVA 1PUFA 2QBYA 2X85A 1X2NA 1RUOA 3DBRB 2DK5A 1S7EA 2KRFA 3OYGA 3I55I 3CTAA 2DA4A 3DPUA 3E6MA 1ONVA 4B3AA 1IN8A 1Y8RB 2WC2A 4M3DA 2WAQA 4Y3OA 5LFAA 4QLCU 4XLFA 2X0LA 3KP4A 2ID3A 4Y7NJ 4NB5A 2LKXA 3K4KA 3VOEA 5CVVA 4M6YA 5H2FC 2DBBA 4BE0A 1V3FA 1IZ1A 3OIOA 4UUTA 4PJLA 2ISYA 4KITB 1SVOA 3Q3SA 2KISA 4JYKA 1T8IA 1HC8A 4X6AJ 1R1TA 2DPDA 3FBNB 4CXFA 1ZG1A 2AO9A 1F4KA 5IYDJ 3ZCOA 3FMSA 2LF7A 5FRMA 1IGNA 1HXDA 5E3LA 1R22A 4XORA 3QPTA 2KIMA 1OCCH 2F5DA 2WB1N 1NHAA 1Z05A 3FM5A 5ITMA 3S1MJ 2QQ9A 4XQFA 3VYRB 3WGHA 4BJ6C 3D5RC 3QP6A 1ZHFA 1MBJA 2XKOA 2VOOA 1FOKA 2V9KA 1FSEA 1X1BA 3L00A 3S1QJ 2OD5A 2PQ8A 2L7MP 4JP0A 2ZJRF 4KMUX 1MKMA 3KP2A 5D5WB 1QPMA 2DTZA 2HZTA 4U7BA 5BS6A 2P5KA 4OIRF 2E71A 2V26A 5A2QZ 2HOAA 4BBRJ 3RKWA 1E2XA 4O3MA 4XK4A 3BY6A 3V8LA 2TCTA 3CUQB 3PO2J 3FZVA 1K78B 4OINF 3L2RA 2F5EA 1QZYA 5DCFA 1W5TA 4FE7A 3O6BB 4HRIA 3KYCB 2K9LA 3ZPLA 3O2PE 3TMOA 2N8GA 3BJOA 4GXOA 3HHGA 2OU2A 4LK1F 1QPIA 3AL0B 2X1CA 2K9SA 3SYTA 2RV8A 3ZGKA 3O8GA 3U9GA 4A3EJ 4IHXA 3HKZN 5DCMB 2PG4A 4HF1A 2JUCA 4C3JJ 2EK5A 3CMAI 1B8IA 5DD4A 1KGSA 1CQTA 2L3DA 2CW0F 4BKXA 3L2QA 2PBIA 2R0QC 3BR3A 4KMFA 5HS9A 1X3ZB 3I64A 5GAEJ 3F8NA 3G4SI 3OYHA 1K6OA 3RYRA 1FYLA 4IEJA 2Y0MA 3DXJF 2VT3A 3KFWX 2OTLI 2OUMA 2VC1A 3C1DA 4ESFA 1P92A 1DGWY 3ZQ7A 1X1PA 5LLQA 4GCVA 2HQ5A 3NWTA 4CUGA 1VTNC 1DGRM 1I6XA 2HDWA 3ABKH 4UB8C 5EZHA 5HDKA 2ESNA 1ZELA 2HYGD 4RB2C 3CCLI 3CCEI 5E17F 4M9SA 1RI7A 2X6XA 1HF0A 1JTXA 2EFWA 1XMKA 2JRTA 1B9NA 3KE2A 3NEUA 5DTDA 2EZHA 2K40A 5HS7A 1SFUA 4EJTA 2OPTA 4LIUA 1R5GA 2M30A 1ZH5A 2ELKA 5DDGA 2QYOA 2L4MA 5LHIA 5FROA 2PFBA 3WTVC 2QSGX 4U0WA 1JKPC 3TDUC 5IP7J 4ASNA 5F04A 2CFOA 3KP3A 3QYEA 1W36C 5CKTA 2HNHA 5FLXK 3L1PA 2ELHA 2F4MB 1JJ8C 4E4HA 2BE5F 2EFNA 3R0AA 1XGMA 2VKVA 3IWFA 1SMTA 4MEYF 3BC8A 4CCOA 1IAWA 2BY1A 5DYMA 1S9HA 3SEZA 2QF7A 3E5QA 5C4XJ 2DN0A 5GPAA 1UMQA 4HW0A 1FP2A 2O7OA 3RPUA 4LIVA 3C2BA 2V6CA 3HBLA 2IS1A 2CQ7A 2EINH 1RC9A 4AYBN 1XG1A 2L01A 3KYDB 2UWMA 3F8CA 3OYAA 2ZFWA 2NS8A 4AWXB 1IUYA 3BR5A 1FWZA 2NVTJ 2DOFA 1ZRFA 1KU2A 3QU3A 2IPQX 2RNGA 1B72B 1TLHB 2JVGA 2ECBA 3FK6A 5J3LA 3IRQA 2A5WA 1VFCA 2G9WA 2DXIA 4XKWA 2F5FA 3OY9A 1HDPA 1U6GA 1QNTA 3LQRA 3VPRA 3ZQLA 2LREA 3CCRI 5BPDA 2HVSA 3CF5F 3FF5A 4MTDA 1LE8B 1VQNI 2IGKA 2XPWA 5J8CA 3DU5A 1MMDA 4J01A 1Y39A 2XKPA 1C0WA 4B44A 1N77A 1WKMA 4LMYA 3K4LA 4OIQF 4HOBA 3E6CC 1HSJA 4P5OA 5E3OA 1JTYA 5E1XA 4JK1X 2GWRA 1R6RA 3F8MA 4V2GA 4EGYA 3A2KA 4IQJA 5E1WA 4LOCA 3K7AJ 3WGIA 3NRVA 1H0MA 1LB2A 2YX7A 3SQNA 2IS2A 4RMNA 3HUGB 2FMYA 1MMGA 4EQQA 2ZXWH 1YI2I 2JA2A 5ILVA 2JA8J 5CLSA 4RB0A 4ZYEA 3FXRA 1WJEA 3DWLE 3M8JA 2E60A 2QA4I 1L0OC 2OQRA 1JGGA 1GV5A 2KZGA 2HYFA 1ODDA 2JTVA 1EKEA 4EM1A 1OCTC 1V55H 2XGEA 3CZ6A 2V6EA 1D8JA 2VB6A 2XAUA 4EMSA 3RTRA 2BY3A 1S72I 3FHZA 3H5RA 4BACA 1S7AA 1UJ8A 2L5QA 3W6VA 4X1EA 3MKWB 2DQRA 2MC4A 2NRAC 4U88A 2L7ZA 4HYEA 3MCZA 1DPRA 2EA2A 5LGNA 3QQAA 4S0HB 3BLYA 3M7GA 3K4MA 2DMUA 3PFIA 2DDBA 3HZJA 1U2WA 1J7KA 4IHSA 4IJAA 2ZMEB 3BTIA 2F48A 3KETA 4OAZA 4CDGA 2VUMJ 3AG2H 4HA8A 1GVDA 2M87A 3S3MA 4RLQA 1IV8A 5M3MJ 3HOWJ 5E8GA 4UUSB 5HDNA 2PMZA 1RR7A 2CFXA 1FY7A 4WF2A 4MEXF 3ASNH 2K7LA 3MVPA 1JHHA 2E35A 4P1WA 4B43A 5B5EC 5B3SH 2E19A 4YELA 4L9NA 5JHUA 3GLLA 4X0GA 3A0HC 1AA7A 1GV2A 4N9HA 1VI0A 5D6EA 2JJ7A 3P5JA 1UG2A 3JSPA 1Z77A 2EQRA 1FMVA 1P7JA 3J80K 1WI9A 2P6SA 3REOA 3V4GA 3N97A 1MGTA 2XC7A 4Y52J 1WQ2A 4LD5A 1RR8C 2WAFA 4OWRB 2KJCA 3L2CA 2DCEA 4Z6YA 4BDZA 5BOXA 2H1LA 3ELKA 3ABUA 1Y6IA 3LOCA 2UV1A 3E5XA 2ZB9A 2OV7A 1TC3C 2JSPA 2OCCH 2DA6A 3DTEA 3LMMA 1XD7A 4JX5A 1BN5A 3RIRA 3RDIA 2VPLA 1MJAA 2RQQA 1D1BA 4Y4RA 3QU6A 3L09A 3GVAA 2FEZA 4F52A 4RGUA 2EV5A 4C3HJ 1ON1A 1MMAA 3LA7A 1SAXA 3S15J 3OSGA 1ZR2A 1TBXA 2EFQA 3H9JA 2ZJQF 1SFKA 1U9NA 1O7FA 2JT1A 4ZDLA 3RPUD 5EF6A 1LEBA 2ZJ2A 1ETKA 2HOEA 2VKDA 1W7PB 3OYBA 4GDFA 1X4PA 3D5LA 1RKWA 1YQAA 3PSFA 3FK7A 3IKVA 3H3UA 3CMMA 4DW6A 2UXNA 2DT6A 2WV0A 2CH0A 4QSHA 4AVPA 1SC7A 1G8XA 3RZOJ 2LKSA 1N75A 4IXAA 2RO3A 2XB5A 1WJCA 4KICA 1TWAJ 2JK3A 4GO1A 2D45A 1DPUA 4XN3A 2M3AA 1DQUA 1KZHA 2BZTA 3GZ6A 2FU4A 4A3BJ 3HOSA 5IOZA 2FX0A 1D1CA 3W2WA 5IYBJ 2LD5A 2CQNA 3KZZA 1H8AC 3WU1B 2DOEA 3C2HA 2E1CA 2Q0OA 3MZHA 3KP6A 4QWQA 5CPRB 3ML6A 3PFYA 2NOJB 1HKQA 1QZEA 3ZQIA 3BR6A 1VF9A 2W48A 2F2EA 3M8FA 5LEKA 2GOMA 3K4NA 3RZDJ 1JKOC 1UAAA 3FXMA 3V7CA 1CGPA 1SD5A 2IS6A 4BEHA 1ACIA 3BG5A 1VQLI 2H6BA 1T6SA 1ZREA 1XGOA 4WK8F 3OYKA 2RREA 4M72A 3JRIA 1I1GA 4L0YB 2XAJA 3DPTA 1AU7A 1XGSA 3IH2A 2H8WA 3GZNB 2A05A 2DFHA 3KIOA 5L3GA 3VDXA 2EIMH 2DJIA 2P7VB 2LFBA 3DU6A 1J9IA 1APLC 5ITJA 3EUKL 2KJBA 3ROUA 4C2TA 3H5AA 1JUPA 2CS3A 4J00A 2VQHA 1SFXA 3L2UA 1JT6A 3K70D 1RPWA 1UELB 1HBXG 4FQGA 2QSHX 1WI3A 1FZPB 3U1KA 5FLVA 1QO0D 2VKEA 2VE9A 4H0EA 2KP6A 3CESA 4PSXA 2RN7A 4HQEA 2VJ4A 3DEUA 2ZCWA 5TRDA 2UXXA 3P9CA 1HW2A 2K4BA 2FF4A 1VQPI 4CA0A 4I09A 2KDOA 1D0XA 3CC4I 4NC8A 4KUMA 5AONA 2W24A 2PJRB 2R7OA 4ENKA 2ZC2A 4M9ZA 1KONA 4YEJA 2WV1A 2H1KA 3IAS2 2KDZA 1GXQA 4DZPA 5IP9J 3K1MA 5K7HA 4L9JA 1BA5A 1GVJA 1JUSA 3OR1C 1Y8QB 3VSLA 1PP7U 1ZR4A 3B02A 2VJJA 3TOAA 3T8TA 3CLQA 5FKNA 3JAMZ 1IN7A 2M4GA 4EGZA 1ENHA 2KRHA 5M5XJ 1N78A 1OMIA 1FX7A 1Q1VA 1UHMA 2Q2EA 3ZRGA 5HNHA 3ZMVA 3K4CA 5JR3A 5E18F 3KCCA 3OS0A 2DA7A 5BQTA 3ABMH 1GT0C 4ZDOA 2DYRH 3DEEA 3W2VA 3MAJA 3F21A 3IUOA 2M34A 3DTKA 3A1YA 3EYYA 1IJWC 4IO9F 3PO3J 4RDUA 3D0SA 1B6AA 3HRMA 4HDVA 4ZTFA 1UHSA 1W1WE 1K4SA 1OISA 1IRZA 2XRNA 4IF4A 4AIJA 2LK2A 2LF8A 5D8LB 4QPOA 3GTLJ 4D7MA 2E2JJ 3GFJA 3KZIC 2IA2A 2Y9ZA 4QPQA 3DV8A 4PJ0C 5KAFC 3CCMI 4WWCA 3G1LA 4RAZA 1XPXA 1Z0RA 1H88C 2R4GA 3CLOA 2OA4A 3S8PA 4LG0A 3H3ZA 4CCJA 2RNJA 3OMYA 2X9DA 4Y33A 1STZA 5EEHA 3Q5FA 4M9XA 4EJWA 1T2KA 1Q1HA 4M3BA 2K1NA 1HQCA 1LQ1A 3RSNA 3BQZA 5EG0A 2J5OA 5KVRA 4E70A 3HOUJ 3JW4A 1A6QA 1LFPA 5JLXA 1ZGAA 2VBZA 4TV7A 5HVQC 3ZQHA 4U0VA 1FP1D 4S04A 3F6OA 3FIWA 1BBYA 5FD6A 5L3BA 3J7YJ 3OS1A 3BZ6A 2R7XA 2WAEA 3H9GA 1A36A 1HOMA 2BW3A 3J7ZI 3BR2A 3WGGA 2BXZA 4WXDA 2MLGA 1AKHA 3HGYA 4H4KC 4CYCB 4FETA 3PQJA 3AG3H 1XCBA 1IN6A 2DDAA 1MH4A 3K6GA 2QSFX 2GA2A 2CMPA 4A69C 4L0ZB 2Y75A 3QAHA 3GYHX 1OJLA 1IUFA 1X2MA 1A04A 4WXHA 1QZZA 2LR8A 2WY8Q 3FXUA 2DK8A 4NQWB 5LBQA 2XGCA 5J6XA 3C7JA 1LVKA 2CSOA 1ZN2A 2FE3A 1YRNB 2TRTA 2HS5A 2LKPA 1T08B 2HU9A 2K85A 4NC6A 1REPC 4L9TA 4HX8A 3D5SC 4XKCA 4EATA 5J1YA 1BOBA 1IV6A 2GXAA 1V5FA 4IKFA 2E5NA 5EGOA 2OTJI 1UHWA 4F92B 3LAPA 1ZGWA 1RNLA 5LGTA 3K2ZA 4AIKA 2L9SA 2EFOA 2P0WA 2RC4A 2RQPA 2XHKA 4FASD 1VQOI 3ERED 3GXOA 2ZNZA 1S6LA 2LG4A 4LK0F 4P96A 5L3FA 5DEQA 3SZGA 5GADJ 4FX4A 1NTCA 2A61A 4BNCA 2O8XA 3CCYA 3W3CA 2LNBA 4HBLA 3ZMDA 3ZR8X 2LOOA 4FX0A 4R79A 2IGOA 3GTPJ 3HXLA 1PJRA 3RJPA 1YS6A 1BJAA 2HTJA 5J8FA 4G7ZF 5FKMA 3ECHA 3EUHA 1BW6A 1LDDA 4MNUA 2XVCA 5FFZA 1MSEC 2LTPA 4O5VA 4A3JJ 4DBRA 4UVBA 3AFHA 2AHQA 1FTZA 4MFDA 3GZ5A 4ZC3A 2MLKA 3OV8A 1CF7A 1TWGJ 1R5ID 1XMAA 4LJZF 3CCVI 1U5TC 2XAGA 1W5CC 2JSCA 2OZUA 2RO4A 4WX9A 3WG9A 1F43A 5ILUA 1RIOH 4OIOF 2Z99A 3SDBA 3WU2C 1EJ9A 3BPXA 4P55A 1ZTRA 3CP8A 2W1TA 1QA6A 3FKJA 4XLCA 1DU0A 5EJCA 4IOAF 3BJAA 1VQMI 4IX7A 3FX3A 3RKYA 2ZNYA 4E7ZA 1WZ2A 1X3WB 1R23A 5D5VB 4HG2A 2W00A 2HQNA 1D5VA 1YFBA 3PIPF 2HEOA 1WCMJ 2Y0SN 1R4MB 2GXBA 1R36A 3X2QH 5IOYA 2KPMA 3S93A 2WWYA 3HDDA 1R1VA 1OKRA 3MFKA 2HI3A 3PIOF 1A31A 2CGPA 1SD6A 2BYVE 3V42A 3F6VA 3FDYA 2R5YB 3ZP5A 1WHUA 3NWSA 3WG7H 4EV0A 1WVRA 5C44J 1G3WA 1S7OA 3J81K 1TZLA 5KCMA 2YU9J 1UB4C 2HR3A 4IOCF 2HVQA 5ILSA 3E7LA 3L2VA 3FXQA 3LSKA 2OAZA 4R8HA 4A3CJ 2Z16A 5GTIC 1HDDC 3DPLC 2P5LC 2VPRA 5K5QA 1PP8F 1K61A 2DU9A 2IXSA 1V54H 1Z7LA 3LSMA 1OYYA 2CRGA 4KNYA 5CJ9A 1FOYA 4IHVA 2HKXA 2ZBKA 1YS7A 3I54A 3COAC 5D5XB 4UV8A 4I6ZA 1OPCA 2VBWA 2KKOA 1YSFA 5FFXA 4B8XA 1ZGJA 5HS8A 2YSRA 5L3DA 1HSTA 1TT5B 3CMYA 5EYRA 3BP8A 2RO5A 3A02A 4HX4A 4D9JA 3CJQB 3TDZC 5IT3A 3WE2A 3D1NI 1FLIA 1HW1A 4YFKF 2LSOA 4CYDA 4JBAA 1MJBA 4PK4A 2GOXB 4M71A 2DMNA 5JLWA 2GLOA 1WPKA 1LEAA 3TO7A 3S32A 4EJVA 5J1RA 4A3IJ 2M9HA 2O6GE 2CW7A 1FOXA 2V7FA 4RGRA 1QRYA 1RKTA 1OCRH 2OZ6A 4YFNF 3HOTA 4G9YA 1YIJI 1H89C 3P7NA 2O61A 4EJUA 4N9IA 3ZMSA 1MVFD 2FOKA 1KQ9A 4KIFA 3DQVC 4BHBA 2CO5A 5DCMA 5TISC 3GUDA 2IS4A 3H36A 1R5HA 3LNQA 2LRDA 4F93B 1TP4A 3QPHA 2XUBA 1WFXA 4A93J 3CDLA 3HSEA 3N4MA 1WJ5A 3KPHA 2VQCA 3H9QA 2XAHA 3I59A 4Y17A 5DM6F 3GFMA 3DBHB 3GTQJ 4BQAA 2EFPA 1I27A 2WADA 2K9MA 5J40A 1P7IA 3PQKA 4XICA 3AAFA 1YHQI 2H27A 4NHJA 3E0JB 4BXXJ 4PDKA 1BW5A 4BUPA 1VQ4I 3OOUA 4KT6A 2IP2A 4IRHA 3ABTA 3IRRA 4BJ5C 4EVIA 3DTIA 3IP4B 3RYPA 2WAQN 4I01A 3G3ZA 3PJRA 3TBIA 1BC8C 3I9V2 3ISPA 1O57A 4G12A 2HFHA 4MQVA 3CQZJ 5IP6A 1HCRA 5E79C 1MDMB 1MSFC 2FSWA 3JRFA 1G4DA 4I2OA 2M8GX 2BY2A 2HVRA 5F27A 1QBJA 1ERDA 4ZYHA 3UNGC 3FXJA 4A12A 2CWEA 1MH3A 3EYIA 4KIGA 4FISA 4I99C 5B1AH 3CMEI 2EWNA 4M74A 5F6FA 1K79A 4XRFA 2V1UA 2GAUA 3MEXA 1S8NA 3EETA 4PCQA 4AUXA 1E17A 3PL8A 4BQOA 4KDPA 2I10A 4LFUA 3RKQA 2GXGA 2I8DA 4XMYA 5FGMA 2HXIA 2NS7A 3NARA 5LRRA 1QVTA 1TQIA 2YX4A 4IPAA 2FQ4A 5IY5H 3F72A 4A5MA 2IRFG 3JSOA 2CW8A 3BDDA 3H0GJ 4N4OB 2QKLB 5K7ZA 1ETQA 1B72A 1VQ7I 3DKXA 2DTRA 4XM3A 5ICGA 2VQLA 3GBGA 3EDPA 1YO5C 3JTGA 4ESBA 1G3YA 1I3AA 1ON2A 2XRLA 3BTLA 1MBEA 2LY9A 2AS5F 2L7KA 1OYWA 3BCAA 3LSIA 4ITVA 4G7OF 4DBQA 1ZKGA 2CV0A 1LDJA 4DOZA 4U87A 2F5VA 2CQKA 3S2WA 1LE8A 1WH5A 1R58A 2L7FP 2W57A 2W85A 4G94A 4UHTA 2PN6A 5ICCA 3I3LA 4BQNA 2XF6A 3G71I 4BGDA 3VSKA 4DGWB 3OYCA 2R7RA 4G6QA 2VOPA 2OBPA 3ZN1A 5BMZA 2PEXA 4A0YA 5BPIA 2A68F 3O8HA 3OYFA 3WU0A 5C4JJ 4B09A 1VQ9I 1BI1A 3HRUA 3HUGA 1MMNA 1Y0UA 1IXCA 5DM7F 2R5ZA 1WGXA 2E34A 2EH3A 2HYJA 3WODF 2JWTA 1JXSA 2QWWA 3BG3A 3WTUC 4KN4X 4RS8A 3F22A 1S3JA 4A3GJ 2CU7A 2ZXJA 3DF8A 4RM3A 4DYCA 3VYSB 3MD2A 1WSUA 3GMEA 4ZDPA 3V7RA 4HV5A 2JUGA 4ZH4F 4D1QA 2Y2ZA 2ZO4A 1LNWA 3DLLF 2LBFB 3I4NJ 3HPHA 2A5YB 4HF0A 2FXAA 1P9QC 1AWCA 5ED4A 3V8JA 3VEPA 3QOEA 2DLLA 4HV6A 2NNYA 1GLNA 2Z1DA 4XKVA 5E1ZB 4IZZA 2KIUA 4V2FA 2Z2SB 4HLXA 3E3VA 1KA8A 3TW6A 3GWZA 1I3QJ 4C2MJ 3LSGA 1ZG3A 2ZMEA 4AIHA 2XDVA 1D0ZA 1TW2A 2CUEA 2DYSH 2DT7B 2ECCA 2E36A 2L2OA 3WTXC 1NK3P 4XLEA 4BE2A 2LVSA 5L3CA 2X6OA 3TGNA 1USTA 2E5ZA 4HSRA 3LSPA 3OIQA 2XSDC 3GW2A 3IH3A 3WHBA 4HLYA 3CD6I 3KX2A 5IT9K 3IKTA 1QVUA 4G7HF 2VXDA 2PMUA 2AQFA 2DI3A 3RQIA 5E20A 2ICWG 4XR6A 4PJJA 1B4AA 3PUBA 3UKGA 4Y13A 2ZFUA 3H5NA 3HGGA 3IHUA 5D8KB 3TW7A 3ZQFA 4K2EA 3K70C 2E7XA 4A3FJ 1T0FA 2O3FA 3WE3A 1XCVA 4N0BA 2CG4A 2ME6A 4XRSG 4AVZA 3W2AA 2XPVA 3Q0WA 4HZFA 2AXTC 3G1MA 4RBOA 3GTOJ 2DMQA 1O3TA 4A3MJ 3H35A 1R9TJ 2TDXA 3I5UA 3I58A 2STWA 3K1NA 1WJDA 4CCKA 3SZTA 3L2WA 2MH9A 2HOTA 2WBMA 1PYVA 4BH9A 2X1EA 2DMPA 2D1HA 3F8BA 3K10A 3GX4X 4I76A 1IN4A 1NG7A 1FBSA 1YLFA 4IVNA 4R1HA 5CVUA 3BTCA 4B3XA 1IXSB 2P5VA 5JVTA 5FLXZ 1OFCX 2DA5A 4OMYA 2V1NA 3OL4A 5DUIA 1BI0A 1EV7A 1Z6TA 5FO5A 4D5CA 3AG1H 2B9SA 2V4JC 1YX3A 2NYXA 2QKMB 4HNUA 5M5YJ 4BYYA 1D8KA 2JQ7A 1DP7P 5CVJA 5H20A 1KYWA 1MBFA 1OR7A 3ZMUA 4KYWA 1GUUA 3TL4X 4RGSA 4GYIA 4Y15A 4ZJZA 2OF7A 1XC5A 3GEZA 1KU3A 1TQPA 5CVRA 2Z9OA 5H6RA 1DU6A 5L3EA 3IAM2 5E3NA 4C3IJ 2V9PA 3HC7A 3HSFA 4DYRA 1YX5A 2HXOA 3DKWA 4QTRA 2GIZA 2LH9A 2PMZN 4O6JA 1AHDP 4UB6C 4LLNA 2NVXJ 4RGXA 3R4KA 2CQQA 4NDLA 2QUFA 1FBUA 2D2WA 2V1XA 4NBQA 5FD5A 2GLWA 1ZARA 1T0FC 3LWFA 1WRJA 2EA4A 3VB2A 3BPVA 2XGXA 2JPCA 4BQQA 2XROA 3O3KA 3VYUB 2KRCA 2FBKA 2NS0A 4I0BA 2M1BA 2JMWA 1Y0NA 5ERIA 3SHFA 1T38A 2Z3YA 5HDGA 2XF5A 5FKOA 1TTYA 5ICEA 4JOMA 3JRBA 5GPCA 1B9MA 4ABZA 1G59A 4GRIA 5B1BH 3Q0VA 5IYCJ 4YG2F 2DA1A 3RCOA 5J47A 2R7DA 2PJPA 1W0TA 2F4IA 1JJ6C 2ESHA 2OJED 2YPRA 4HSTA 2DQLA 3M9AA 2L66A 1UB9A 3BG7A 1D3YA 1S29A 1Z3YA 1T33A 4NC7A 3SFZA 3HOVJ 3TKYA 2M4KA 2R3SA 2RAEA 2A69F 3UR3C 5D4RA 1KU9A 2PJRA 2Q2EB 2BVLA 1R7JA 3ZQCA 4OMZA 3OYJA 2DO7A 1FSHA 2IVMA 1BJZA 1MBKA 4PFOA 4LB5A 1QQIA 1BI2A 1V4RA 1L3LA 3HG9A 2C6YA 2WA0A 2QM3A 1G6NA 1BM9A 3FMQA 1OR7C 2GQQA 1P4AA 1R4NB 4PUSA 3KP7A 2DOAA 5E8IA 4A6DA 1T56A 4ENJA 2VXZA 3DEWA 3ZQGA 2ZJPF 1H9TA 1FEXA 2E1MC 4MO7A 1BIAA 3H0DA 3OYLA 2QZ8A 3M1EA 3BZCA 1SAUA 2XAQA 3OOPA 2NAZA 3DBLB 2M2EA 3GLXA 4EEFG 5AIQA 1VZ0A 1EA3A 1XS9A 1ZAOA 4BY1J 2DAOA 4YIIA 3TQNA 1ZQ3P 4YRVA 2KFDA 3RPQA 4XBFA 2QQ8A 2HQAA 2PX9A 3MKZA 1LUJB 2QQAA 4I7HA 2VJ5A 2YU3A 2EIJH 1J75A 4FTHA 4WCGA 1U5TB 3J80Z 4II2A 3SEQA 3OYNA 1ETXA 1UFMA 3SJMA 4BDYA 1FOWA 4BHPA 1W7PD 5DUKA 5B66C 3S3OA 2BW3B 1PDNC 5M3FJ 2RKHA 2Q1ZB 1ZRDA 2WB1A 3GTKJ 2A07F 4HX7A 2LLKA 2FMLA 4A3KJ 1XSDA 4XL9A 1TWHJ 4ZYGA 2VASA 1P6RA 1BR2A 1FYKA 4P9FA 2HDDA 4PJMA 2L9RA 4XLNF 3CF2A 1Y1WJ 1Z6RA 3I4PA 3LFUA 1D5YA 3MZYA 2NVUB 2K9QA 1W4MA 1BR1A 1XB4A 2CV2A 2Z33A 4B48A 4D0PA 5C3EJ 3MWMA 1JI8A 4UVCA 1T39A 1VQ8I 1LJ9A 1FPQA 1W5SA 1ETWA 3BT9A 4I02A 2QCOA 4XOPA 3DP7A 4CYCA 3J7AO 2MD0A 3PSIA 1YITI 4J19A 3HPGA 1A5JA 3LFKA 2XGDA 3OR2C 4BHCA 3AKZA 4A3DJ 2FRHA 4MQ9F 1IRGA 4IHYA 3ZN0A 4UY8I 4KA4A 1KYZA 1XX5A 4NQWA 1IN5A 2FQ3A 4B1RA 3P9KA 3HKZA 1J59A 2LDUA 2M7AA 1YYVA 1YFHA 1R1UA 4E7SA 2E7WA 1JE8A 4RAFA 4FCYA 1T95A 4W97A 1EH6A 2CJJA 1MNDA 2ISZA 2XIGA 3KZYA 4XLPF 3JTHA 5CQEA 3TP0A 2Y9YA 3NQOA 4BU2A 3HOYJ 3V8KA 1MJ9A 3WHCA 3QYFA 1PUFB 2QBYB 1XMXA 4EM2A 5D6FA 1I5ZA 3E5UA 3HB9A 2H8RA 1Z91A 3CCJI 3U21A 4RAGA 3S2HJ 3OYIA 2MH2A 1GHCA 3A01A 2KMUA 2VL8A 1TW3A 2IT0A 3HEFA 1U8BA 1FTTA 1IRFA 5H6QA 3LSHA 3OL3A 1Z7UA 2PLYA 3RI4A 5JI6A 4LLGF 2BHYA 1D0YA 4N4NB 4PZJA 1WH7A 3VFZA 1RRJA 4KJZA 1QU3A 3R0JA 3E1SA 2EBIA 4E6KG 4ETSA 4F91B 1V5EA 3IL2A 2HTSA 1SVLA 4U0YA 3JRGA 1FYMA 5F0HA 3VODA 3S3NA 1F5TA 3BG6A 1IXRC 2V9VA 2JA5J 3TEDA 3LAJA 2ACJA 3S16J 4PGGA 4RB3C 2R7TA 3G1OA 1OQYA 4KISA 2COBA 4PGHA 4FT8A 3SFIA 5FRNA 5J1UA 2O9LA 2MA3A 3PNVA 4CCLA 1P4XA 2DW4A 2LY2A 4E7IA 1HKSA 1SEUA 2IGMA 2A6HF 3I71A 2E2HJ 3A4CA 5K1YA 2VI6A 1YG2A 4JDMA 4Q4ZF 1XSXA 3P9IA 3LA2A 3F8FA 5LRSA 1ORKA 2R7QA 4AYBA 3V7SA 2COMA 1FIAA 1YW9A 1YE9A 3JRCA 4UNOA 2NVYJ 5CQGA 1HW5A 4MTEA 4XIDA 3QYBA 2Y30A 2MBFA 2X4HA 2VKHA 4BBSJ 4OU0A 1OCOH 4M6XA 4XNFA 1M1EB 5BNGA 3EUHC 2E1OA 3HJEA 5D4SA 4LB6B 2R5YA 2B63J 1SVMA 4JX4A 1OCPA 1VQKI 3CUOA 4G6DA 2HPIA 2KIQA 3CDIA 4NUBA 1YTYA 2PI0A 1KQ0A 1MBHA 4KFCA 5HLIA 3W6JB 1R00A 3CUQA 4M3GA 2EZLA 1S5LC 1K78A 4B47A 1B8IB 1TWCJ 1WJBA 2HKOA 4AU7A 5KNLA 5KAIC 3M3YJ 2ETHA 4RA2A 3WTSC 1U3EM 2M5WA 3K9TA 2CV1A 2EZIA 3IV5A 1TL8A 2XF7A 1EF4A 3IH4A 3FBIB 4Q48A 3FXKA 1MD0A 3G2BA 2D5VA 2GM4A 3AG4H 2MG4A 3QP5A 1K6YA 4L18B 5F0CA 4ENNA 3HHHA 3TNDB 5K5RA 4GGGA 3GFLA 1XSVA 3TO6A 1Z3XA 4CCMA 2K3FA 1ZG5A 3SDGA 3WTTC 3BCBA 5LHHA 2BEOA 2M8EA 2LC2A 3HM5A 1RETA 3LSTA 5F64A 2M45A 3I59B 3ZXSA 1X3UA 1YW7A 5HLHA 2VBXA 3CCQI 3HTSB 1YW8A 2FY9A 1JKQC 3F9KA 3Q0UA 2CUJA 1ETOA 4FE4A 3ESWB 4CZCA 5J4YA 4YIRX 3MN2A 4E7KA 5LD2C 2W82A 2J5PA 4B4CA 1ZLKA 3S14J 2QVOA 4CCNA 5F0FA 4S05A 3FXLA 3FHNA 1FNNA 2EV6A 2F4OB 5GAGJ 3H92A 2MGQA 4JDOA 3HOXJ 4IRIA 4HEA2 5JFRA 4CSWA 2EJRA 4CO8A 2DA2A 2YR2A 4OOIA 2BOLA 4M3EA 4XSZF 4CHUA 1SANA 3B6CA 2Y69H 1Z21A 2RVCA 5GAHJ 3VYTB 4CICA 3S2DJ 1D1AA 1LPQA 1QHGA 2JZYA 2ZXHA 3CDHA 4L9VA 1BL0A 5FKLA 1H9GA 1NG6A 4II3A 1I50J 3QODA 2AQEA 1F36A 4W1UA 2K4JA 1ZYRF 4E7HA 3CUQC 4XONA 3T5XA 5F1RA 4A2UA 3JRAA 2VBYA 3QRFF 3PUFA 3M4OJ 1BIBA 2IJLA 1MDMA 2I5UA 2FBIA 2VJIA 3GCMA 3JREA 4MLOA 2ZSHB 3AL0C 4I98B 4A0XA 4M3FA 4XN0A 2KLOA 5KK1A 4IHWA 2O03A 4KN7X 3PNYA 3W6KB 3GTJJ 2DPUA 5FB2A 1IC8A 3ASOH 3WTWC 2X6WA 4HNTA 1F1ZA 2DT5A 5GTHC 4JQFA 2CQXA 3CJTB 2LY1A 4L5IA 3GTGJ 3K1PA 1FT9A 2XB0X 2H09A 1MIJA 2EZKA 2W25A 2BV6A 3E6DA 3JRHA 5DD8A 4XLHA 2JVHA 3CP2A 4A0ZA 1MW7A 5HLGA 1O3QA 2ZKZA 4UV9A 4BJTA 4BL0B 1J2XA 1HA8A 5HNFA 4AD9A 2MFZA 3G6EI 3BROA 3CO7C 2BBYA 2FUG2 1TWFJ 1HLVA 5TGTA 2A6EF 3I56I 4BAYA 1VQ6I 3I53A 3Q9SA 3F3XA 2MYSA 2O8KA 2R7UA 3FISA 1BOAA 2VT2A 3R60A 2IBDA 1TNTA 1FJLA 2OCEA 3K69A 4DNCA 1W36D 4MIMA 2R5ZB 5FJ8J 3M8EA 2WTEA 2LYCA 4DYQA 2HZDA 3GTMJ 4F55A 1U78A 2GIVA 2D1VA 2VODA 2MW8A 3JAMK 4A6EA 3BQYA 3PM1A 3KEQA 4YIFA 2B7EA 2JRMA 1J09A 5GP9A 1UZCA 4PJNA 2X1DA 4RM2A 4PSWA 2MSYA 4MGRA 3ECOA 3L9FA 1K7AA 1ZK8A 2IEKA 4L5EA 2IA1A 4HDUA 3ZQQA 2BXYA 5LHGA 1U8RA 1U9OA 2Q8KA 2GBYA 2O5RA 3J81Z 2MC3A 2GA1A 1R71A 3EPZA 1IW7F 2VQGA 4XRMA 3BR0A 2FD5A 1OLTA 1Z0XA 3LA3A 3HRTA 3ZMTA 4C9YA 2QEXI 3EUAA 5LGUA 3MZ8A 1X19A 4ZTJA 1J0RA 1KQ8A 4D5FA 1UCRA 4ON0A 2V1DA 2UUZA 2XSJC 3KYLA 2IA0A 2R7WA 2FOWA 4KT5C 3O27A 3RQ4A 3OYDA 1USSA 2LBFA 4UUSA 1XDSA 1DUXC 1VNDA 1P2FA 5F1JA 4WXCA 2VIXA 3U2RA 5CVIA 4AC0A 3HL2A 3HYIA 2PMHA 2FBHA 2R7VA 5DS9A 4ZZDA 2UZKA 3CC7I 2L9NA 3N05A 2EILH 4XSXF 1LKXA 3JR9A 2KIFA 2WY7Q 1K83J 1XN7A 2K27A 2R7FA 2M7BA 3IC7A 2MABA 2Z5UA 3K0LA 3ULQB 4RB1A 4DJAA 1RUNA 4AM3A 2ZSIB 2KT0A 1EH7A 1FIPA 3BZKA 3NAUA 3TO9A 2YS9A 3DKYA 3KLOA 2W84A 4G8XA 3BOQA 2K3PA 2E1NA 3R6SA 3QPLA 2DFFA 4HPQA 3JRDA 2HQRA 5EEAA 3C18A 3QPSA 4ZZLA 1IDYA 1E3HA 2VN2A 4PFPA 1OCZH 1MZBA 2ID6A 4BXUA 2W1OA 2P4WA 2XPUA 3HOZJ
chains in the Genus database with same CATH topology
1VQ5I 3I56I 3J7ZI 1VQ6I 2JQ7A 3PIOF 3DLLF 3CCQI 2FY9A 3CCRI 3CF5F 1VQPI 1VQNI 3CC4I 3CC2I 1Y39A 1UB4C 4IOCF 3CMEI 1YJ9I 5GAGJ 1FOWA 2E36A 3CMAI 4JDOA 3CCUI 2ZJQF 1FOYA 2W1TB 2OTJI 5GAEJ 3G4SI 2GLWA 5GAHJ 1YI2I 3CD6I 1YSFA 5JVGF 2OTLI 1VQOI 1YJWI 4JDMA 2QEXI 5GADJ 2QA4I 2RO3A 2RO5A 3I55I 3CCLI 1VQ7I 3CCEI 2FOWA 3O27A 1VQ8I 1MMSA 1S72I 1FOXA 4IO9F 1YITI 2L66A 1YIJI 1VQKI 1MVFD 3CCSI 3CC7I 4UY8I 1HC8A 3CCMI 4V19K 3CCVI 1ACIA 1YJNI 1Z0RA 1VQLI 2RO4A 3G71I 3CJTB 5ITMA 5DM6F 2H8WA 1VQ9I 2W1TA 1QA6A 2E35A 2K1NA 4IOAF 2ZJRF 5ITJA 1VQMI 1YHQI 5DM7F 2E34A 1VQ4I 2NXNB 3G6EI 1YFBA 3TNDB 3CCJI 3PIPF 2K3FA 2ZJPF 3J7YJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ5 I;  3I56 I;  3J7Z I;  1VQ6 I;  2JQ7 A;  3PIO F;  3DLL F;  3CCQ I;  3CCR I;  3CF5 F;  1VQP I;  1VQN I;  3CC4 I;  3CC2 I;  1Y39 A;  4IOC F;  3CME I;  1YJ9 I;  5GAG J;  1FOW A;  2E36 A;  3CMA I;  3CCU I;  2ZJQ F;  1FOY A;  2OTJ I;  5GAE J;  3G4S I;  5GAH J;  1YI2 I;  3CD6 I;  5JVG F;  2OTL I;  1VQO I;  1YJW I;  2QEX I;  5GAD J;  2QA4 I;  3I55 I;  3CCL I;  1VQ7 I;  3CCE I;  2FOW A;  1VQ8 I;  1MMS A;  1S72 I;  1FOX A;  4IO9 F;  1YIT I;  1YIJ I;  1VQK I;  3CCS I;  3CC7 I;  4UY8 I;  1HC8 A;  3CCM I;  4V19 K;  3CCV I;  1ACI A;  1YJN I;  1VQL I;  3G71 I;  3CJT B;  5DM6 F;  2H8W A;  1VQ9 I;  1QA6 A;  2E35 A;  4IOA F;  2ZJR F;  1VQM I;  1YHQ I;  5DM7 F;  2E34 A;  1VQ4 I;  2NXN B;  3G6E I;  3CCJ I;  3PIP F;  2K3F A;  2ZJP F;  3J7Y J; 
#chains in the Genus database with same CATH topology
 1VQ5 I;  4IQ4 A;  9ANT A;  3BR1 A;  3HRS A;  2DA3 A;  3KEO A;  3F0C A;  2X48 A;  1EH8 A;  2KHM A;  3L7W A;  1Y56 A;  2HOS A;  2X51 A;  1W7P A;  3FKI J;  1SFO J;  3K2A A;  2DFE A;  1T98 A;  2ZXI A;  4F3Q A;  1A35 A;  3CC2 I;  1U0J A;  4BEH B;  2ZME C;  2X6Y A;  4D7N A;  3MMY B;  3OYE A;  2B0L A;  1YJ9 I;  2IW5 A;  4NNJ A;  2ADU A;  1PVE A;  2CUZ A;  2IAI A;  5FKK A;  4ANJ A;  1F9N A;  5J4V A;  1XTA A;  2VC0 A;  2W4S A;  3CCU I;  2QGU A;  5HLT A;  2DMT A;  2DOD A;  1MNE A;  1TNS A;  4RLF A;  1LFB A;  5E3M A;  2NNN A;  2W7N A;  3TOB A;  1LDK B;  1YJW I;  2EIK H;  1G3T A;  3R61 A;  2JA7 J;  4A5N A;  3ONQ A;  1YIO A;  2P8T A;  3ZMZ A;  5EDN A;  2BY0 A;  3I0T A;  5LEJ A;  4ESJ A;  1WJA A;  5TJJ A;  3KLN A;  1KU7 A;  2E1M B;  3OYM A;  4UVA A;  3FXO A;  1NH3 A;  4BXF A;  1X1D A;  4CH7 A;  3J7A Y;  2BGC A;  1Z1D A;  4BS9 A;  4CZZ A;  3OIP A;  4UXN A;  4QIW N;  3H3V K;  3SZP A;  3HIF A;  3MQ0 A;  1OYI A;  1E3P A;  2HGC A;  4Q5S F;  1POG A;  1MNM C;  1O3S A;  4FHT A;  3QWL A;  1Z9C A;  5EZG A;  1YJN I;  1DP3 A;  1PUE E;  3Q9V A;  4JX6 A;  6PAX A;  2BHZ A;  2KQR A;  1SD7 A;  3MKY B;  3S17 J;  2LMD A;  1B1B A;  3H1C A;  1UG0 A;  4C30 A;  4EM0 B;  4AID A;  3ZOB A;  1K4T A;  2STT A;  4L5J A;  2M0C A;  2K02 A;  3TP3 A;  1JUM A;  1IF1 A;  3B73 A;  2JA6 J;  2NOG A;  3FM3 A;  4HAM A;  2Y31 A;  2Y48 A;  3PNT A;  5IPA A;  4EJO A;  2QQB A;  2EB7 A;  2L54 A;  3M1C A;  2NXN B;  2CUF A;  1FMW A;  3A03 A;  3C2G A;  3EQL F;  3WTY C;  5AIP A;  2XAS A;  1A6I A;  3A0B C;  1P4W A;  1E3O C;  5A2Q K;  2L4A A;  4GYG A;  2RGV A;  1FC3 A;  4UUV A;  3IWZ A;  2F6C A;  3K4J A;  4YFX F;  1V5G A;  4XOT A;  1I1S A;  2P6T A;  1X58 A;  4MHG A;  2NVQ J;  1GXP A;  4A3L J;  5M5W J;  1TQM A;  1RZ4 A;  5F08 A;  3OWT A;  4CGZ A;  3DFG A;  5K7F A;  1X1C A;  1YOV B;  3T8R A;  1N25 A;  3BWG A;  4IL6 C;  3GF2 A;  2XAF A;  4E7J A;  4M73 A;  2VLA A;  2R7S A;  4HF2 A;  2HDC A;  4GFB A;  1ITY A;  1ZLJ A;  3KP5 A;  3S1R J;  4DZJ A;  4ENM A;  2A6T A;  4LG0 B;  3WTZ A;  1JKR C;  3G73 A;  5JHF A;  4BE1 A;  1SFE A;  5KHD A;  4ZYA A;  1Y1V J;  2LP0 A;  2KZV A;  3HSR A;  2O0Y A;  4IHT A;  3E6B A;  2L02 A;  3T0Y A;  1X1A A;  5EG0 B;  2VE8 A;  5JVG F;  4OAY A;  1IDZ A;  2ELJ A;  3OSF A;  3K4B A;  1RES A;  3ERM A;  2GZW A;  1TT0 A;  4LLL A;  3GO5 A;  3LQQ A;  2K9N A;  1R49 A;  1FBQ A;  1QHH D;  5FLM J;  2Y0S A;  5DV5 A;  2G7H A;  3BTJ A;  2K86 A;  3B6A A;  3CO6 C;  1JT0 A;  2K5C A;  5CYV A;  2JPB A;  1WJF A;  3C3W A;  2R93 J;  4M6V A;  1MMS A;  4E7L A;  1AKH B;  4HQM A;  1O7L A;  2AXL A;  5IT9 Z;  2YUS A;  4P9U A;  4XKB A;  1NK2 P;  1IRX A;  1DDN A;  3S1N J;  2FJ1 A;  4HNV A;  3CCS I;  1SMY F;  3LL7 A;  1O3R A;  3T1B A;  1U5T A;  3JCU C;  2IGN A;  4V19 K;  2P7C B;  2QLZ A;  4C2U A;  2P81 A;  3GFI A;  1HKT A;  3I4M J;  1G3S A;  5ICF A;  3SXY A;  1XDU A;  3KEY A;  1ETV A;  1IO2 A;  4I0A A;  4DQ2 A;  3ABL H;  4XRS A;  2CYY A;  5EGO B;  1BI3 A;  1X4O A;  4U7D A;  2KL4 A;  2VON A;  1XGN A;  1G2H A;  2L0K A;  3VWB A;  4LIT A;  4IRG A;  3LSR A;  1BC7 C;  3CJN A;  3E97 A;  2FNP A;  1JHF A;  4DIQ A;  3BG9 A;  4Q47 A;  1LFU P;  3BJ6 A;  1BR4 A;  1B59 A;  2DJN A;  1YRN A;  2MD5 A;  3DCF A;  4LGW A;  2L9V A;  2DFI A;  3CJR B;  1I39 A;  1LVA A;  3FMR A;  1ETY A;  4G6T B;  1J5Y A;  2OQG A;  4ZYD A;  4LG3 A;  2G0E A;  2FA5 A;  1GDT A;  2F5C A;  2QEN A;  1ULY A;  3DLA A;  2RDP A;  5EEG A;  3F23 A;  2FNA A;  3RKX A;  2JN6 A;  2H94 A;  4XLA A;  4BY7 J;  2E2I J;  1W0U A;  3LSJ A;  3M07 A;  1CF7 B;  1WWX A;  1IG7 A;  2EPF A;  4KIB A;  1O4X A;  5HOO A;  1SD4 A;  5D5U B;  1MBG A;  5HOD A;  2HPM A;  1QGP A;  4OIP F;  3A01 B;  2XV4 S;  3QOP A;  1JGS A;  2A3S A;  2EV0 A;  4MFE A;  5K5O A;  2BVM A;  4Z2Y A;  1Z67 A;  4RAY A;  2ME0 A;  3OS2 A;  2R92 J;  1I6H J;  1AOY A;  2M0M A;  2V79 A;  3HTU A;  2W1T B;  3U1D A;  2G7U A;  3MKL A;  1ZRC A;  1E0E A;  4F7Z A;  2R7Z J;  3FWE A;  2OC6 A;  2H6C A;  2HWV A;  1PUF A;  2QBY A;  2X85 A;  1X2N A;  1RUO A;  3DBR B;  2DK5 A;  1S7E A;  2KRF A;  3OYG A;  3I55 I;  3CTA A;  2DA4 A;  3DPU A;  3E6M A;  1ONV A;  4B3A A;  1IN8 A;  1Y8R B;  2WC2 A;  4M3D A;  2WAQ A;  4Y3O A;  5LFA A;  4QLC U;  4XLF A;  2X0L A;  3KP4 A;  2ID3 A;  4Y7N J;  4NB5 A;  2LKX A;  3K4K A;  3VOE A;  5CVV A;  4M6Y A;  5H2F C;  2DBB A;  4BE0 A;  1V3F A;  1IZ1 A;  3OIO A;  4UUT A;  4PJL A;  2ISY A;  4KIT B;  1SVO A;  3Q3S A;  2KIS A;  4JYK A;  1T8I A;  1HC8 A;  4X6A J;  1R1T A;  2DPD A;  3FBN B;  4CXF A;  1ZG1 A;  2AO9 A;  1F4K A;  5IYD J;  3ZCO A;  3FMS A;  2LF7 A;  5FRM A;  1IGN A;  1HXD A;  5E3L A;  1R22 A;  4XOR A;  3QPT A;  2KIM A;  1OCC H;  2F5D A;  2WB1 N;  1NHA A;  1Z05 A;  3FM5 A;  5ITM A;  3S1M J;  2QQ9 A;  4XQF A;  3VYR B;  3WGH A;  4BJ6 C;  3D5R C;  3QP6 A;  1ZHF A;  1MBJ A;  2XKO A;  2VOO A;  1FOK A;  2V9K A;  1FSE A;  1X1B A;  3L00 A;  3S1Q J;  2OD5 A;  2PQ8 A;  2L7M P;  4JP0 A;  2ZJR F;  4KMU X;  1MKM A;  3KP2 A;  5D5W B;  1QPM A;  2DTZ A;  2HZT A;  4U7B A;  5BS6 A;  2P5K A;  4OIR F;  2E71 A;  2V26 A;  5A2Q Z;  2HOA A;  4BBR J;  3RKW A;  1E2X A;  4O3M A;  4XK4 A;  3BY6 A;  3V8L A;  2TCT A;  3CUQ B;  3PO2 J;  3FZV A;  1K78 B;  4OIN F;  3L2R A;  2F5E A;  1QZY A;  5DCF A;  1W5T A;  4FE7 A;  3O6B B;  4HRI A;  3KYC B;  2K9L A;  3ZPL A;  3O2P E;  3TMO A;  2N8G A;  3BJO A;  4GXO A;  3HHG A;  2OU2 A;  4LK1 F;  1QPI A;  3AL0 B;  2X1C A;  2K9S A;  3SYT A;  2RV8 A;  3ZGK A;  3O8G A;  3U9G A;  4A3E J;  4IHX A;  3HKZ N;  5DCM B;  2PG4 A;  4HF1 A;  2JUC A;  4C3J J;  2EK5 A;  3CMA I;  1B8I A;  5DD4 A;  1KGS A;  1CQT A;  2L3D A;  2CW0 F;  4BKX A;  3L2Q A;  2PBI A;  2R0Q C;  3BR3 A;  4KMF A;  5HS9 A;  1X3Z B;  3I64 A;  5GAE J;  3F8N A;  3G4S I;  3OYH A;  1K6O A;  3RYR A;  1FYL A;  4IEJ A;  2Y0M A;  3DXJ F;  2VT3 A;  3KFW X;  2OTL I;  2OUM A;  2VC1 A;  3C1D A;  4ESF A;  1P92 A;  1DGW Y;  3ZQ7 A;  1X1P A;  5LLQ A;  4GCV A;  2HQ5 A;  3NWT A;  4CUG A;  1VTN C;  1DGR M;  1I6X A;  2HDW A;  3ABK H;  4UB8 C;  5EZH A;  5HDK A;  2ESN A;  1ZEL A;  2HYG D;  4RB2 C;  3CCL I;  3CCE I;  5E17 F;  4M9S A;  1RI7 A;  2X6X A;  1HF0 A;  1JTX A;  2EFW A;  1XMK A;  2JRT A;  1B9N A;  3KE2 A;  3NEU A;  5DTD A;  2EZH A;  2K40 A;  5HS7 A;  1SFU A;  4EJT A;  2OPT A;  4LIU A;  1R5G A;  2M30 A;  1ZH5 A;  2ELK A;  5DDG A;  2QYO A;  2L4M A;  5LHI A;  5FRO A;  2PFB A;  3WTV C;  2QSG X;  4U0W A;  1JKP C;  3TDU C;  5IP7 J;  4ASN A;  5F04 A;  2CFO A;  3KP3 A;  3QYE A;  1W36 C;  5CKT A;  2HNH A;  5FLX K;  3L1P A;  2ELH A;  2F4M B;  1JJ8 C;  4E4H A;  2BE5 F;  2EFN A;  3R0A A;  1XGM A;  2VKV A;  3IWF A;  1SMT A;  4MEY F;  3BC8 A;  4CCO A;  1IAW A;  2BY1 A;  5DYM A;  1S9H A;  3SEZ A;  2QF7 A;  3E5Q A;  5C4X J;  2DN0 A;  5GPA A;  1UMQ A;  4HW0 A;  1FP2 A;  2O7O A;  3RPU A;  4LIV A;  3C2B A;  2V6C A;  3HBL A;  2IS1 A;  2CQ7 A;  2EIN H;  1RC9 A;  4AYB N;  1XG1 A;  2L01 A;  3KYD B;  2UWM A;  3F8C A;  3OYA A;  2ZFW A;  2NS8 A;  4AWX B;  1IUY A;  3BR5 A;  1FWZ A;  2NVT J;  2DOF A;  1ZRF A;  1KU2 A;  3QU3 A;  2IPQ X;  2RNG A;  1B72 B;  1TLH B;  2JVG A;  2ECB A;  3FK6 A;  5J3L A;  3IRQ A;  2A5W A;  1VFC A;  2G9W A;  2DXI A;  4XKW A;  2F5F A;  3OY9 A;  1HDP A;  1U6G A;  1QNT A;  3LQR A;  3VPR A;  3ZQL A;  2LRE A;  3CCR I;  5BPD A;  2HVS A;  3CF5 F;  3FF5 A;  4MTD A;  1LE8 B;  1VQN I;  2IGK A;  2XPW A;  5J8C A;  3DU5 A;  1MMD A;  4J01 A;  1Y39 A;  2XKP A;  1C0W A;  4B44 A;  1N77 A;  1WKM A;  4LMY A;  3K4L A;  4OIQ F;  4HOB A;  3E6C C;  1HSJ A;  4P5O A;  5E3O A;  1JTY A;  5E1X A;  4JK1 X;  2GWR A;  1R6R A;  3F8M A;  4V2G A;  4EGY A;  3A2K A;  4IQJ A;  5E1W A;  4LOC A;  3K7A J;  3WGI A;  3NRV A;  1H0M A;  1LB2 A;  2YX7 A;  3SQN A;  2IS2 A;  4RMN A;  3HUG B;  2FMY A;  1MMG A;  4EQQ A;  2ZXW H;  1YI2 I;  2JA2 A;  5ILV A;  2JA8 J;  5CLS A;  4RB0 A;  4ZYE A;  3FXR A;  1WJE A;  3DWL E;  3M8J A;  2E60 A;  2QA4 I;  1L0O C;  2OQR A;  1JGG A;  1GV5 A;  2KZG A;  2HYF A;  1ODD A;  2JTV A;  1EKE A;  4EM1 A;  1OCT C;  1V55 H;  2XGE A;  3CZ6 A;  2V6E A;  1D8J A;  2VB6 A;  2XAU A;  4EMS A;  3RTR A;  2BY3 A;  1S72 I;  3FHZ A;  3H5R A;  4BAC A;  1S7A A;  1UJ8 A;  2L5Q A;  3W6V A;  4X1E A;  3MKW B;  2DQR A;  2MC4 A;  2NRA C;  4U88 A;  2L7Z A;  4HYE A;  3MCZ A;  1DPR A;  2EA2 A;  5LGN A;  3QQA A;  4S0H B;  3BLY A;  3M7G A;  3K4M A;  2DMU A;  3PFI A;  2DDB A;  3HZJ A;  1U2W A;  1J7K A;  4IHS A;  4IJA A;  2ZME B;  3BTI A;  2F48 A;  3KET A;  4OAZ A;  4CDG A;  2VUM J;  3AG2 H;  4HA8 A;  1GVD A;  2M87 A;  3S3M A;  4RLQ A;  1IV8 A;  5M3M J;  3HOW J;  5E8G A;  4UUS B;  5HDN A;  2PMZ A;  1RR7 A;  2CFX A;  1FY7 A;  4WF2 A;  4MEX F;  3ASN H;  2K7L A;  3MVP A;  1JHH A;  2E35 A;  4P1W A;  4B43 A;  5B5E C;  5B3S H;  2E19 A;  4YEL A;  4L9N A;  5JHU A;  3GLL A;  4X0G A;  3A0H C;  1AA7 A;  1GV2 A;  4N9H A;  1VI0 A;  5D6E A;  2JJ7 A;  3P5J A;  1UG2 A;  3JSP A;  1Z77 A;  2EQR A;  1FMV A;  1P7J A;  3J80 K;  1WI9 A;  2P6S A;  3REO A;  3V4G A;  3N97 A;  1MGT A;  2XC7 A;  4Y52 J;  1WQ2 A;  4LD5 A;  1RR8 C;  2WAF A;  4OWR B;  2KJC A;  3L2C A;  2DCE A;  4Z6Y A;  4BDZ A;  5BOX A;  2H1L A;  3ELK A;  3ABU A;  1Y6I A;  3LOC A;  2UV1 A;  3E5X A;  2ZB9 A;  2OV7 A;  1TC3 C;  2JSP A;  2OCC H;  2DA6 A;  3DTE A;  3LMM A;  1XD7 A;  4JX5 A;  1BN5 A;  3RIR A;  3RDI A;  2VPL A;  1MJA A;  2RQQ A;  1D1B A;  4Y4R A;  3QU6 A;  3L09 A;  3GVA A;  2FEZ A;  4F52 A;  4RGU A;  2EV5 A;  4C3H J;  1ON1 A;  1MMA A;  3LA7 A;  1SAX A;  3S15 J;  3OSG A;  1ZR2 A;  1TBX A;  2EFQ A;  3H9J A;  2ZJQ F;  1SFK A;  1U9N A;  1O7F A;  2JT1 A;  4ZDL A;  3RPU D;  5EF6 A;  1LEB A;  2ZJ2 A;  1ETK A;  2HOE A;  2VKD A;  1W7P B;  3OYB A;  4GDF A;  1X4P A;  3D5L A;  1RKW A;  1YQA A;  3PSF A;  3FK7 A;  3IKV A;  3H3U A;  3CMM A;  4DW6 A;  2UXN A;  2DT6 A;  2WV0 A;  2CH0 A;  4QSH A;  4AVP A;  1SC7 A;  1G8X A;  3RZO J;  2LKS A;  1N75 A;  4IXA A;  2RO3 A;  2XB5 A;  1WJC A;  4KIC A;  1TWA J;  2JK3 A;  4GO1 A;  2D45 A;  1DPU A;  4XN3 A;  2M3A A;  1DQU A;  1KZH A;  2BZT A;  3GZ6 A;  2FU4 A;  4A3B J;  3HOS A;  5IOZ A;  2FX0 A;  1D1C A;  3W2W A;  5IYB J;  2LD5 A;  2CQN A;  3KZZ A;  1H8A C;  3WU1 B;  2DOE A;  3C2H A;  2E1C A;  2Q0O A;  3MZH A;  3KP6 A;  4QWQ A;  5CPR B;  3ML6 A;  3PFY A;  2NOJ B;  1HKQ A;  1QZE A;  3ZQI A;  3BR6 A;  1VF9 A;  2W48 A;  2F2E A;  3M8F A;  5LEK A;  2GOM A;  3K4N A;  3RZD J;  1JKO C;  1UAA A;  3FXM A;  3V7C A;  1CGP A;  1SD5 A;  2IS6 A;  4BEH A;  1ACI A;  3BG5 A;  1VQL I;  2H6B A;  1T6S A;  1ZRE A;  1XGO A;  4WK8 F;  3OYK A;  2RRE A;  4M72 A;  3JRI A;  1I1G A;  4L0Y B;  2XAJ A;  3DPT A;  1AU7 A;  1XGS A;  3IH2 A;  2H8W A;  3GZN B;  2A05 A;  2DFH A;  3KIO A;  5L3G A;  3VDX A;  2EIM H;  2DJI A;  2P7V B;  2LFB A;  3DU6 A;  1J9I A;  1APL C;  5ITJ A;  3EUK L;  2KJB A;  3ROU A;  4C2T A;  3H5A A;  1JUP A;  2CS3 A;  4J00 A;  2VQH A;  1SFX A;  3L2U A;  1JT6 A;  3K70 D;  1RPW A;  1UEL B;  1HBX G;  4FQG A;  2QSH X;  1WI3 A;  1FZP B;  3U1K A;  5FLV A;  1QO0 D;  2VKE A;  2VE9 A;  4H0E A;  2KP6 A;  3CES A;  4PSX A;  2RN7 A;  4HQE A;  2VJ4 A;  3DEU A;  2ZCW A;  5TRD A;  2UXX A;  3P9C A;  1HW2 A;  2K4B A;  2FF4 A;  1VQP I;  4CA0 A;  4I09 A;  2KDO A;  1D0X A;  3CC4 I;  4NC8 A;  4KUM A;  5AON A;  2W24 A;  2PJR B;  2R7O A;  4ENK A;  2ZC2 A;  4M9Z A;  1KON A;  4YEJ A;  2WV1 A;  2H1K A;  3IAS 2;  2KDZ A;  1GXQ A;  4DZP A;  5IP9 J;  3K1M A;  5K7H A;  4L9J A;  1BA5 A;  1GVJ A;  1JUS A;  3OR1 C;  1Y8Q B;  3VSL A;  1PP7 U;  1ZR4 A;  3B02 A;  2VJJ A;  3TOA A;  3T8T A;  3CLQ A;  5FKN A;  3JAM Z;  1IN7 A;  2M4G A;  4EGZ A;  1ENH A;  2KRH A;  5M5X J;  1N78 A;  1OMI A;  1FX7 A;  1Q1V A;  1UHM A;  2Q2E A;  3ZRG A;  5HNH A;  3ZMV A;  3K4C A;  5JR3 A;  5E18 F;  3KCC A;  3OS0 A;  2DA7 A;  5BQT A;  3ABM H;  1GT0 C;  4ZDO A;  2DYR H;  3DEE A;  3W2V A;  3MAJ A;  3F21 A;  3IUO A;  2M34 A;  3DTK A;  3A1Y A;  3EYY A;  1IJW C;  4IO9 F;  3PO3 J;  4RDU A;  3D0S A;  1B6A A;  3HRM A;  4HDV A;  4ZTF A;  1UHS A;  1W1W E;  1K4S A;  1OIS A;  1IRZ A;  2XRN A;  4IF4 A;  4AIJ A;  2LK2 A;  2LF8 A;  5D8L B;  4QPO A;  3GTL J;  4D7M A;  2E2J J;  3GFJ A;  3KZI C;  2IA2 A;  2Y9Z A;  4QPQ A;  3DV8 A;  4PJ0 C;  5KAF C;  3CCM I;  4WWC A;  3G1L A;  4RAZ A;  1XPX A;  1Z0R A;  1H88 C;  2R4G A;  3CLO A;  2OA4 A;  3S8P A;  4LG0 A;  3H3Z A;  4CCJ A;  2RNJ A;  3OMY A;  2X9D A;  4Y33 A;  1STZ A;  5EEH A;  3Q5F A;  4M9X A;  4EJW A;  1T2K A;  1Q1H A;  4M3B A;  2K1N A;  1HQC A;  1LQ1 A;  3RSN A;  3BQZ A;  5EG0 A;  2J5O A;  5KVR A;  4E70 A;  3HOU J;  3JW4 A;  1A6Q A;  1LFP A;  5JLX A;  1ZGA A;  2VBZ A;  4TV7 A;  5HVQ C;  3ZQH A;  4U0V A;  1FP1 D;  4S04 A;  3F6O A;  3FIW A;  1BBY A;  5FD6 A;  5L3B A;  3J7Y J;  3OS1 A;  3BZ6 A;  2R7X A;  2WAE A;  3H9G A;  1A36 A;  1HOM A;  2BW3 A;  3J7Z I;  3BR2 A;  3WGG A;  2BXZ A;  4WXD A;  2MLG A;  1AKH A;  3HGY A;  4H4K C;  4CYC B;  4FET A;  3PQJ A;  3AG3 H;  1XCB A;  1IN6 A;  2DDA A;  1MH4 A;  3K6G A;  2QSF X;  2GA2 A;  2CMP A;  4A69 C;  4L0Z B;  2Y75 A;  3QAH A;  3GYH X;  1OJL A;  1IUF A;  1X2M A;  1A04 A;  4WXH A;  1QZZ A;  2LR8 A;  2WY8 Q;  3FXU A;  2DK8 A;  4NQW B;  5LBQ A;  2XGC A;  5J6X A;  3C7J A;  1LVK A;  2CSO A;  1ZN2 A;  2FE3 A;  1YRN B;  2TRT A;  2HS5 A;  2LKP A;  1T08 B;  2HU9 A;  2K85 A;  4NC6 A;  1REP C;  4L9T A;  4HX8 A;  3D5S C;  4XKC A;  4EAT A;  5J1Y A;  1BOB A;  1IV6 A;  2GXA A;  1V5F A;  4IKF A;  2E5N A;  5EGO A;  2OTJ I;  1UHW A;  4F92 B;  3LAP A;  1ZGW A;  1RNL A;  5LGT A;  3K2Z A;  4AIK A;  2L9S A;  2EFO A;  2P0W A;  2RC4 A;  2RQP A;  2XHK A;  4FAS D;  1VQO I;  3ERE D;  3GXO A;  2ZNZ A;  1S6L A;  2LG4 A;  4LK0 F;  4P96 A;  5L3F A;  5DEQ A;  3SZG A;  5GAD J;  4FX4 A;  1NTC A;  2A61 A;  4BNC A;  2O8X A;  3CCY A;  3W3C A;  2LNB A;  4HBL A;  3ZMD A;  3ZR8 X;  2LOO A;  4FX0 A;  4R79 A;  2IGO A;  3GTP J;  3HXL A;  1PJR A;  3RJP A;  1YS6 A;  1BJA A;  2HTJ A;  5J8F A;  4G7Z F;  5FKM A;  3ECH A;  3EUH A;  1BW6 A;  1LDD A;  4MNU A;  2XVC A;  5FFZ A;  1MSE C;  2LTP A;  4O5V A;  4A3J J;  4DBR A;  4UVB A;  3AFH A;  2AHQ A;  1FTZ A;  4MFD A;  3GZ5 A;  4ZC3 A;  2MLK A;  3OV8 A;  1CF7 A;  1TWG J;  1R5I D;  1XMA A;  4LJZ F;  3CCV I;  1U5T C;  2XAG A;  1W5C C;  2JSC A;  2OZU A;  2RO4 A;  4WX9 A;  3WG9 A;  1F43 A;  5ILU A;  1RIO H;  4OIO F;  2Z99 A;  3SDB A;  3WU2 C;  1EJ9 A;  3BPX A;  4P55 A;  1ZTR A;  3CP8 A;  2W1T A;  1QA6 A;  3FKJ A;  4XLC A;  1DU0 A;  5EJC A;  4IOA F;  3BJA A;  1VQM I;  4IX7 A;  3FX3 A;  3RKY A;  2ZNY A;  4E7Z A;  1WZ2 A;  1X3W B;  1R23 A;  5D5V B;  4HG2 A;  2W00 A;  2HQN A;  1D5V A;  1YFB A;  3PIP F;  2HEO A;  1WCM J;  2Y0S N;  1R4M B;  2GXB A;  1R36 A;  3X2Q H;  5IOY A;  2KPM A;  3S93 A;  2WWY A;  3HDD A;  1R1V A;  1OKR A;  3MFK A;  2HI3 A;  3PIO F;  1A31 A;  2CGP A;  1SD6 A;  2BYV E;  3V42 A;  3F6V A;  3FDY A;  2R5Y B;  3ZP5 A;  1WHU A;  3NWS A;  3WG7 H;  4EV0 A;  1WVR A;  5C44 J;  1G3W A;  1S7O A;  3J81 K;  1TZL A;  5KCM A;  2YU9 J;  1UB4 C;  2HR3 A;  4IOC F;  2HVQ A;  5ILS A;  3E7L A;  3L2V A;  3FXQ A;  3LSK A;  2OAZ A;  4R8H A;  4A3C J;  2Z16 A;  5GTI C;  1HDD C;  3DPL C;  2P5L C;  2VPR A;  5K5Q A;  1PP8 F;  1K61 A;  2DU9 A;  2IXS A;  1V54 H;  1Z7L A;  3LSM A;  1OYY A;  2CRG A;  4KNY A;  5CJ9 A;  1FOY A;  4IHV A;  2HKX A;  2ZBK A;  1YS7 A;  3I54 A;  3COA C;  5D5X B;  4UV8 A;  4I6Z A;  1OPC A;  2VBW A;  2KKO A;  1YSF A;  5FFX A;  4B8X A;  1ZGJ A;  5HS8 A;  2YSR A;  5L3D A;  1HST A;  1TT5 B;  3CMY A;  5EYR A;  3BP8 A;  2RO5 A;  3A02 A;  4HX4 A;  4D9J A;  3CJQ B;  3TDZ C;  5IT3 A;  3WE2 A;  3D1N I;  1FLI A;  1HW1 A;  4YFK F;  2LSO A;  4CYD A;  4JBA A;  1MJB A;  4PK4 A;  2GOX B;  4M71 A;  2DMN A;  5JLW A;  2GLO A;  1WPK A;  1LEA A;  3TO7 A;  3S32 A;  4EJV A;  5J1R A;  4A3I J;  2M9H A;  2O6G E;  2CW7 A;  1FOX A;  2V7F A;  4RGR A;  1QRY A;  1RKT A;  1OCR H;  2OZ6 A;  4YFN F;  3HOT A;  4G9Y A;  1YIJ I;  1H89 C;  3P7N A;  2O61 A;  4EJU A;  4N9I A;  3ZMS A;  1MVF D;  2FOK A;  1KQ9 A;  4KIF A;  3DQV C;  4BHB A;  2CO5 A;  5DCM A;  5TIS C;  3GUD A;  2IS4 A;  3H36 A;  1R5H A;  3LNQ A;  2LRD A;  4F93 B;  1TP4 A;  3QPH A;  2XUB A;  1WFX A;  4A93 J;  3CDL A;  3HSE A;  3N4M A;  1WJ5 A;  3KPH A;  2VQC A;  3H9Q A;  2XAH A;  3I59 A;  4Y17 A;  5DM6 F;  3GFM A;  3DBH B;  3GTQ J;  4BQA A;  2EFP A;  1I27 A;  2WAD A;  2K9M A;  5J40 A;  1P7I A;  3PQK A;  4XIC A;  3AAF A;  1YHQ I;  2H27 A;  4NHJ A;  3E0J B;  4BXX J;  4PDK A;  1BW5 A;  4BUP A;  1VQ4 I;  3OOU A;  4KT6 A;  2IP2 A;  4IRH A;  3ABT A;  3IRR A;  4BJ5 C;  4EVI A;  3DTI A;  3IP4 B;  3RYP A;  2WAQ N;  4I01 A;  3G3Z A;  3PJR A;  3TBI A;  1BC8 C;  3I9V 2;  3ISP A;  1O57 A;  4G12 A;  2HFH A;  4MQV A;  3CQZ J;  5IP6 A;  1HCR A;  5E79 C;  1MDM B;  1MSF C;  2FSW A;  3JRF A;  1G4D A;  4I2O A;  2M8G X;  2BY2 A;  2HVR A;  5F27 A;  1QBJ A;  1ERD A;  4ZYH A;  3UNG C;  3FXJ A;  4A12 A;  2CWE A;  1MH3 A;  3EYI A;  4KIG A;  4FIS A;  4I99 C;  5B1A H;  3CME I;  2EWN A;  4M74 A;  5F6F A;  1K79 A;  4XRF A;  2V1U A;  2GAU A;  3MEX A;  1S8N A;  3EET A;  4PCQ A;  4AUX A;  1E17 A;  3PL8 A;  4BQO A;  4KDP A;  2I10 A;  4LFU A;  3RKQ A;  2GXG A;  2I8D A;  4XMY A;  5FGM A;  2HXI A;  2NS7 A;  3NAR A;  5LRR A;  1QVT A;  1TQI A;  2YX4 A;  4IPA A;  2FQ4 A;  5IY5 H;  3F72 A;  4A5M A;  2IRF G;  3JSO A;  2CW8 A;  3BDD A;  3H0G J;  4N4O B;  2QKL B;  5K7Z A;  1ETQ A;  1B72 A;  1VQ7 I;  3DKX A;  2DTR A;  4XM3 A;  5ICG A;  2VQL A;  3GBG A;  3EDP A;  1YO5 C;  3JTG A;  4ESB A;  1G3Y A;  1I3A A;  1ON2 A;  2XRL A;  3BTL A;  1MBE A;  2LY9 A;  2AS5 F;  2L7K A;  1OYW A;  3BCA A;  3LSI A;  4ITV A;  4G7O F;  4DBQ A;  1ZKG A;  2CV0 A;  1LDJ A;  4DOZ A;  4U87 A;  2F5V A;  2CQK A;  3S2W A;  1LE8 A;  1WH5 A;  1R58 A;  2L7F P;  2W57 A;  2W85 A;  4G94 A;  4UHT A;  2PN6 A;  5ICC A;  3I3L A;  4BQN A;  2XF6 A;  3G71 I;  4BGD A;  3VSK A;  4DGW B;  3OYC A;  2R7R A;  4G6Q A;  2VOP A;  2OBP A;  3ZN1 A;  5BMZ A;  2PEX A;  4A0Y A;  5BPI A;  2A68 F;  3O8H A;  3OYF A;  3WU0 A;  5C4J J;  4B09 A;  1VQ9 I;  1BI1 A;  3HRU A;  3HUG A;  1MMN A;  1Y0U A;  1IXC A;  5DM7 F;  2R5Z A;  1WGX A;  2E34 A;  2EH3 A;  2HYJ A;  3WOD F;  2JWT A;  1JXS A;  2QWW A;  3BG3 A;  3WTU C;  4KN4 X;  4RS8 A;  3F22 A;  1S3J A;  4A3G J;  2CU7 A;  2ZXJ A;  3DF8 A;  4RM3 A;  4DYC A;  3VYS B;  3MD2 A;  1WSU A;  3GME A;  4ZDP A;  3V7R A;  4HV5 A;  2JUG A;  4ZH4 F;  4D1Q A;  2Y2Z A;  2ZO4 A;  1LNW A;  3DLL F;  2LBF B;  3I4N J;  3HPH A;  2A5Y B;  4HF0 A;  2FXA A;  1P9Q C;  1AWC A;  5ED4 A;  3V8J A;  3VEP A;  3QOE A;  2DLL A;  4HV6 A;  2NNY A;  1GLN A;  2Z1D A;  4XKV A;  5E1Z B;  4IZZ A;  2KIU A;  4V2F A;  2Z2S B;  4HLX A;  3E3V A;  1KA8 A;  3TW6 A;  3GWZ A;  1I3Q J;  4C2M J;  3LSG A;  1ZG3 A;  2ZME A;  4AIH A;  2XDV A;  1D0Z A;  1TW2 A;  2CUE A;  2DYS H;  2DT7 B;  2ECC A;  2E36 A;  2L2O A;  3WTX C;  1NK3 P;  4XLE A;  4BE2 A;  2LVS A;  5L3C A;  2X6O A;  3TGN A;  1UST A;  2E5Z A;  4HSR A;  3LSP A;  3OIQ A;  2XSD C;  3GW2 A;  3IH3 A;  3WHB A;  4HLY A;  3CD6 I;  3KX2 A;  5IT9 K;  3IKT A;  1QVU A;  4G7H F;  2VXD A;  2PMU A;  2AQF A;  2DI3 A;  3RQI A;  5E20 A;  2ICW G;  4XR6 A;  4PJJ A;  1B4A A;  3PUB A;  3UKG A;  4Y13 A;  2ZFU A;  3H5N A;  3HGG A;  3IHU A;  5D8K B;  3TW7 A;  3ZQF A;  4K2E A;  3K70 C;  2E7X A;  4A3F J;  1T0F A;  2O3F A;  3WE3 A;  1XCV A;  4N0B A;  2CG4 A;  2ME6 A;  4XRS G;  4AVZ A;  3W2A A;  2XPV A;  3Q0W A;  4HZF A;  2AXT C;  3G1M A;  4RBO A;  3GTO J;  2DMQ A;  1O3T A;  4A3M J;  3H35 A;  1R9T J;  2TDX A;  3I5U A;  3I58 A;  2STW A;  3K1N A;  1WJD A;  4CCK A;  3SZT A;  3L2W A;  2MH9 A;  2HOT A;  2WBM A;  1PYV A;  4BH9 A;  2X1E A;  2DMP A;  2D1H A;  3F8B A;  3K10 A;  3GX4 X;  4I76 A;  1IN4 A;  1NG7 A;  1FBS A;  1YLF A;  4IVN A;  4R1H A;  5CVU A;  3BTC A;  4B3X A;  1IXS B;  2P5V A;  5JVT A;  5FLX Z;  1OFC X;  2DA5 A;  4OMY A;  2V1N A;  3OL4 A;  5DUI A;  1BI0 A;  1EV7 A;  1Z6T A;  5FO5 A;  4D5C A;  3AG1 H;  2B9S A;  2V4J C;  1YX3 A;  2NYX A;  2QKM B;  4HNU A;  5M5Y J;  4BYY A;  1D8K A;  2JQ7 A;  1DP7 P;  5CVJ A;  5H20 A;  1KYW A;  1MBF A;  1OR7 A;  3ZMU A;  4KYW A;  1GUU A;  3TL4 X;  4RGS A;  4GYI A;  4Y15 A;  4ZJZ A;  2OF7 A;  1XC5 A;  3GEZ A;  1KU3 A;  1TQP A;  5CVR A;  2Z9O A;  5H6R A;  1DU6 A;  5L3E A;  3IAM 2;  5E3N A;  4C3I J;  2V9P A;  3HC7 A;  3HSF A;  4DYR A;  1YX5 A;  2HXO A;  3DKW A;  4QTR A;  2GIZ A;  2LH9 A;  2PMZ N;  4O6J A;  1AHD P;  4UB6 C;  4LLN A;  2NVX J;  4RGX A;  3R4K A;  2CQQ A;  4NDL A;  2QUF A;  1FBU A;  2D2W A;  2V1X A;  4NBQ A;  5FD5 A;  2GLW A;  1ZAR A;  1T0F C;  3LWF A;  1WRJ A;  2EA4 A;  3VB2 A;  3BPV A;  2XGX A;  2JPC A;  4BQQ A;  2XRO A;  3O3K A;  3VYU B;  2KRC A;  2FBK A;  2NS0 A;  4I0B A;  2M1B A;  2JMW A;  1Y0N A;  5ERI A;  3SHF A;  1T38 A;  2Z3Y A;  5HDG A;  2XF5 A;  5FKO A;  1TTY A;  5ICE A;  4JOM A;  3JRB A;  5GPC A;  1B9M A;  4ABZ A;  1G59 A;  4GRI A;  5B1B H;  3Q0V A;  5IYC J;  4YG2 F;  2DA1 A;  3RCO A;  5J47 A;  2R7D A;  2PJP A;  1W0T A;  2F4I A;  1JJ6 C;  2ESH A;  2OJE D;  2YPR A;  4HST A;  2DQL A;  3M9A A;  2L66 A;  1UB9 A;  3BG7 A;  1D3Y A;  1S29 A;  1Z3Y A;  1T33 A;  4NC7 A;  3SFZ A;  3HOV J;  3TKY A;  2M4K A;  2R3S A;  2RAE A;  2A69 F;  3UR3 C;  5D4R A;  1KU9 A;  2PJR A;  2Q2E B;  2BVL A;  1R7J A;  3ZQC A;  4OMZ A;  3OYJ A;  2DO7 A;  1FSH A;  2IVM A;  1BJZ A;  1MBK A;  4PFO A;  4LB5 A;  1QQI A;  1BI2 A;  1V4R A;  1L3L A;  3HG9 A;  2C6Y A;  2WA0 A;  2QM3 A;  1G6N A;  1BM9 A;  3FMQ A;  1OR7 C;  2GQQ A;  1P4A A;  1R4N B;  4PUS A;  3KP7 A;  2DOA A;  5E8I A;  4A6D A;  1T56 A;  4ENJ A;  2VXZ A;  3DEW A;  3ZQG A;  2ZJP F;  1H9T A;  1FEX A;  2E1M C;  4MO7 A;  1BIA A;  3H0D A;  3OYL A;  2QZ8 A;  3M1E A;  3BZC A;  1SAU A;  2XAQ A;  3OOP A;  2NAZ A;  3DBL B;  2M2E A;  3GLX A;  4EEF G;  5AIQ A;  1VZ0 A;  1EA3 A;  1XS9 A;  1ZAO A;  4BY1 J;  2DAO A;  4YII A;  3TQN A;  1ZQ3 P;  4YRV A;  2KFD A;  3RPQ A;  4XBF A;  2QQ8 A;  2HQA A;  2PX9 A;  3MKZ A;  1LUJ B;  2QQA A;  4I7H A;  2VJ5 A;  2YU3 A;  2EIJ H;  1J75 A;  4FTH A;  4WCG A;  1U5T B;  3J80 Z;  4II2 A;  3SEQ A;  3OYN A;  1ETX A;  1UFM A;  3SJM A;  4BDY A;  1FOW A;  4BHP A;  1W7P D;  5DUK A;  5B66 C;  3S3O A;  2BW3 B;  1PDN C;  5M3F J;  2RKH A;  2Q1Z B;  1ZRD A;  2WB1 A;  3GTK J;  2A07 F;  4HX7 A;  2LLK A;  2FML A;  4A3K J;  1XSD A;  4XL9 A;  1TWH J;  4ZYG A;  2VAS A;  1P6R A;  1BR2 A;  1FYK A;  4P9F A;  2HDD A;  4PJM A;  2L9R A;  4XLN F;  3CF2 A;  1Y1W J;  1Z6R A;  3I4P A;  3LFU A;  1D5Y A;  3MZY A;  2NVU B;  2K9Q A;  1W4M A;  1BR1 A;  1XB4 A;  2CV2 A;  2Z33 A;  4B48 A;  4D0P A;  5C3E J;  3MWM A;  1JI8 A;  4UVC A;  1T39 A;  1VQ8 I;  1LJ9 A;  1FPQ A;  1W5S A;  1ETW A;  3BT9 A;  4I02 A;  2QCO A;  4XOP A;  3DP7 A;  4CYC A;  3J7A O;  2MD0 A;  3PSI A;  1YIT I;  4J19 A;  3HPG A;  1A5J A;  3LFK A;  2XGD A;  3OR2 C;  4BHC A;  3AKZ A;  4A3D J;  2FRH A;  4MQ9 F;  1IRG A;  4IHY A;  3ZN0 A;  4UY8 I;  4KA4 A;  1KYZ A;  1XX5 A;  4NQW A;  1IN5 A;  2FQ3 A;  4B1R A;  3P9K A;  3HKZ A;  1J59 A;  2LDU A;  2M7A A;  1YYV A;  1YFH A;  1R1U A;  4E7S A;  2E7W A;  1JE8 A;  4RAF A;  4FCY A;  1T95 A;  4W97 A;  1EH6 A;  2CJJ A;  1MND A;  2ISZ A;  2XIG A;  3KZY A;  4XLP F;  3JTH A;  5CQE A;  3TP0 A;  2Y9Y A;  3NQO A;  4BU2 A;  3HOY J;  3V8K A;  1MJ9 A;  3WHC A;  3QYF A;  1PUF B;  2QBY B;  1XMX A;  4EM2 A;  5D6F A;  1I5Z A;  3E5U A;  3HB9 A;  2H8R A;  1Z91 A;  3CCJ I;  3U21 A;  4RAG A;  3S2H J;  3OYI A;  2MH2 A;  1GHC A;  3A01 A;  2KMU A;  2VL8 A;  1TW3 A;  2IT0 A;  3HEF A;  1U8B A;  1FTT A;  1IRF A;  5H6Q A;  3LSH A;  3OL3 A;  1Z7U A;  2PLY A;  3RI4 A;  5JI6 A;  4LLG F;  2BHY A;  1D0Y A;  4N4N B;  4PZJ A;  1WH7 A;  3VFZ A;  1RRJ A;  4KJZ A;  1QU3 A;  3R0J A;  3E1S A;  2EBI A;  4E6K G;  4ETS A;  4F91 B;  1V5E A;  3IL2 A;  2HTS A;  1SVL A;  4U0Y A;  3JRG A;  1FYM A;  5F0H A;  3VOD A;  3S3N A;  1F5T A;  3BG6 A;  1IXR C;  2V9V A;  2JA5 J;  3TED A;  3LAJ A;  2ACJ A;  3S16 J;  4PGG A;  4RB3 C;  2R7T A;  3G1O A;  1OQY A;  4KIS A;  2COB A;  4PGH A;  4FT8 A;  3SFI A;  5FRN A;  5J1U A;  2O9L A;  2MA3 A;  3PNV A;  4CCL A;  1P4X A;  2DW4 A;  2LY2 A;  4E7I A;  1HKS A;  1SEU A;  2IGM A;  2A6H F;  3I71 A;  2E2H J;  3A4C A;  5K1Y A;  2VI6 A;  1YG2 A;  4JDM A;  4Q4Z F;  1XSX A;  3P9I A;  3LA2 A;  3F8F A;  5LRS A;  1ORK A;  2R7Q A;  4AYB A;  3V7S A;  2COM A;  1FIA A;  1YW9 A;  1YE9 A;  3JRC A;  4UNO A;  2NVY J;  5CQG A;  1HW5 A;  4MTE A;  4XID A;  3QYB A;  2Y30 A;  2MBF A;  2X4H A;  2VKH A;  4BBS J;  4OU0 A;  1OCO H;  4M6X A;  4XNF A;  1M1E B;  5BNG A;  3EUH C;  2E1O A;  3HJE A;  5D4S A;  4LB6 B;  2R5Y A;  2B63 J;  1SVM A;  4JX4 A;  1OCP A;  1VQK I;  3CUO A;  4G6D A;  2HPI A;  2KIQ A;  3CDI A;  4NUB A;  1YTY A;  2PI0 A;  1KQ0 A;  1MBH A;  4KFC A;  5HLI A;  3W6J B;  1R00 A;  3CUQ A;  4M3G A;  2EZL A;  1S5L C;  1K78 A;  4B47 A;  1B8I B;  1TWC J;  1WJB A;  2HKO A;  4AU7 A;  5KNL A;  5KAI C;  3M3Y J;  2ETH A;  4RA2 A;  3WTS C;  1U3E M;  2M5W A;  3K9T A;  2CV1 A;  2EZI A;  3IV5 A;  1TL8 A;  2XF7 A;  1EF4 A;  3IH4 A;  3FBI B;  4Q48 A;  3FXK A;  1MD0 A;  3G2B A;  2D5V A;  2GM4 A;  3AG4 H;  2MG4 A;  3QP5 A;  1K6Y A;  4L18 B;  5F0C A;  4ENN A;  3HHH A;  3TND B;  5K5R A;  4GGG A;  3GFL A;  1XSV A;  3TO6 A;  1Z3X A;  4CCM A;  2K3F A;  1ZG5 A;  3SDG A;  3WTT C;  3BCB A;  5LHH A;  2BEO A;  2M8E A;  2LC2 A;  3HM5 A;  1RET A;  3LST A;  5F64 A;  2M45 A;  3I59 B;  3ZXS A;  1X3U A;  1YW7 A;  5HLH A;  2VBX A;  3CCQ I;  3HTS B;  1YW8 A;  2FY9 A;  1JKQ C;  3F9K A;  3Q0U A;  2CUJ A;  1ETO A;  4FE4 A;  3ESW B;  4CZC A;  5J4Y A;  4YIR X;  3MN2 A;  4E7K A;  5LD2 C;  2W82 A;  2J5P A;  4B4C A;  1ZLK A;  3S14 J;  2QVO A;  4CCN A;  5F0F A;  4S05 A;  3FXL A;  3FHN A;  1FNN A;  2EV6 A;  2F4O B;  5GAG J;  3H92 A;  2MGQ A;  4JDO A;  3HOX J;  4IRI A;  4HEA 2;  5JFR A;  4CSW A;  2EJR A;  4CO8 A;  2DA2 A;  2YR2 A;  4OOI A;  2BOL A;  4M3E A;  4XSZ F;  4CHU A;  1SAN A;  3B6C A;  2Y69 H;  1Z21 A;  2RVC A;  5GAH J;  3VYT B;  4CIC A;  3S2D J;  1D1A A;  1LPQ A;  1QHG A;  2JZY A;  2ZXH A;  3CDH A;  4L9V A;  1BL0 A;  5FKL A;  1H9G A;  1NG6 A;  4II3 A;  1I50 J;  3QOD A;  2AQE A;  1F36 A;  4W1U A;  2K4J A;  1ZYR F;  4E7H A;  3CUQ C;  4XON A;  3T5X A;  5F1R A;  4A2U A;  3JRA A;  2VBY A;  3QRF F;  3PUF A;  3M4O J;  1BIB A;  2IJL A;  1MDM A;  2I5U A;  2FBI A;  2VJI A;  3GCM A;  3JRE A;  4MLO A;  2ZSH B;  3AL0 C;  4I98 B;  4A0X A;  4M3F A;  4XN0 A;  2KLO A;  5KK1 A;  4IHW A;  2O03 A;  4KN7 X;  3PNY A;  3W6K B;  3GTJ J;  2DPU A;  5FB2 A;  1IC8 A;  3ASO H;  3WTW C;  2X6W A;  4HNT A;  1F1Z A;  2DT5 A;  5GTH C;  4JQF A;  2CQX A;  3CJT B;  2LY1 A;  4L5I A;  3GTG J;  3K1P A;  1FT9 A;  2XB0 X;  2H09 A;  1MIJ A;  2EZK A;  2W25 A;  2BV6 A;  3E6D A;  3JRH A;  5DD8 A;  4XLH A;  2JVH A;  3CP2 A;  4A0Z A;  1MW7 A;  5HLG A;  1O3Q A;  2ZKZ A;  4UV9 A;  4BJT A;  4BL0 B;  1J2X A;  1HA8 A;  5HNF A;  4AD9 A;  2MFZ A;  3G6E I;  3BRO A;  3CO7 C;  2BBY A;  2FUG 2;  1TWF J;  1HLV A;  5TGT A;  2A6E F;  3I56 I;  4BAY A;  1VQ6 I;  3I53 A;  3Q9S A;  3F3X A;  2MYS A;  2O8K A;  2R7U A;  3FIS A;  1BOA A;  2VT2 A;  3R60 A;  2IBD A;  1TNT A;  1FJL A;  2OCE A;  3K69 A;  4DNC A;  1W36 D;  4MIM A;  2R5Z B;  5FJ8 J;  3M8E A;  2WTE A;  2LYC A;  4DYQ A;  2HZD A;  3GTM J;  4F55 A;  1U78 A;  2GIV A;  2D1V A;  2VOD A;  2MW8 A;  3JAM K;  4A6E A;  3BQY A;  3PM1 A;  3KEQ A;  4YIF A;  2B7E A;  2JRM A;  1J09 A;  5GP9 A;  1UZC A;  4PJN A;  2X1D A;  4RM2 A;  4PSW A;  2MSY A;  4MGR A;  3ECO A;  3L9F A;  1K7A A;  1ZK8 A;  2IEK A;  4L5E A;  2IA1 A;  4HDU A;  3ZQQ A;  2BXY A;  5LHG A;  1U8R A;  1U9O A;  2Q8K A;  2GBY A;  2O5R A;  3J81 Z;  2MC3 A;  2GA1 A;  1R71 A;  3EPZ A;  1IW7 F;  2VQG A;  4XRM A;  3BR0 A;  2FD5 A;  1OLT A;  1Z0X A;  3LA3 A;  3HRT A;  3ZMT A;  4C9Y A;  2QEX I;  3EUA A;  5LGU A;  3MZ8 A;  1X19 A;  4ZTJ A;  1J0R A;  1KQ8 A;  4D5F A;  1UCR A;  4ON0 A;  2V1D A;  2UUZ A;  2XSJ C;  3KYL A;  2IA0 A;  2R7W A;  2FOW A;  4KT5 C;  3O27 A;  3RQ4 A;  3OYD A;  1USS A;  2LBF A;  4UUS A;  1XDS A;  1DUX C;  1VND A;  1P2F A;  5F1J A;  4WXC A;  2VIX A;  3U2R A;  5CVI A;  4AC0 A;  3HL2 A;  3HYI A;  2PMH A;  2FBH A;  2R7V A;  5DS9 A;  4ZZD A;  2UZK A;  3CC7 I;  2L9N A;  3N05 A;  2EIL H;  4XSX F;  1LKX A;  3JR9 A;  2KIF A;  2WY7 Q;  1K83 J;  1XN7 A;  2K27 A;  2R7F A;  2M7B A;  3IC7 A;  2MAB A;  2Z5U A;  3K0L A;  3ULQ B;  4RB1 A;  4DJA A;  1RUN A;  4AM3 A;  2ZSI B;  2KT0 A;  1EH7 A;  1FIP A;  3BZK A;  3NAU A;  3TO9 A;  2YS9 A;  3DKY A;  3KLO A;  2W84 A;  4G8X A;  3BOQ A;  2K3P A;  2E1N A;  3R6S A;  3QPL A;  2DFF A;  4HPQ A;  3JRD A;  2HQR A;  5EEA A;  3C18 A;  3QPS A;  4ZZL A;  1IDY A;  1E3H A;  2VN2 A;  4PFP A;  1OCZ H;  1MZB A;  2ID6 A;  4BXU A;  2W1O A;  2P4W A;  2XPU A;  3HOZ J; 
#chains in the Genus database with same CATH homology
 1VQ5 I;  3I56 I;  3J7Z I;  1VQ6 I;  2JQ7 A;  3PIO F;  3DLL F;  3CCQ I;  2FY9 A;  3CCR I;  3CF5 F;  1VQP I;  1VQN I;  3CC4 I;  3CC2 I;  1Y39 A;  1UB4 C;  4IOC F;  3CME I;  1YJ9 I;  5GAG J;  1FOW A;  2E36 A;  3CMA I;  4JDO A;  3CCU I;  2ZJQ F;  1FOY A;  2W1T B;  2OTJ I;  5GAE J;  3G4S I;  2GLW A;  5GAH J;  1YI2 I;  3CD6 I;  1YSF A;  5JVG F;  2OTL I;  1VQO I;  1YJW I;  4JDM A;  2QEX I;  5GAD J;  2QA4 I;  2RO3 A;  2RO5 A;  3I55 I;  3CCL I;  1VQ7 I;  3CCE I;  2FOW A;  3O27 A;  1VQ8 I;  1MMS A;  1S72 I;  1FOX A;  4IO9 F;  1YIT I;  2L66 A;  1YIJ I;  1VQK I;  1MVF D;  3CCS I;  3CC7 I;  4UY8 I;  1HC8 A;  3CCM I;  4V19 K;  3CCV I;  1ACI A;  1YJN I;  1Z0R A;  1VQL I;  2RO4 A;  3G71 I;  3CJT B;  5ITM A;  5DM6 F;  2H8W A;  1VQ9 I;  2W1T A;  1QA6 A;  2E35 A;  2K1N A;  4IOA F;  2ZJR F;  5ITJ A;  1VQM I;  1YHQ I;  5DM7 F;  2E34 A;  1VQ4 I;  2NXN B;  3G6E I;  1YFB A;  3TND B;  3CCJ I;  3PIP F;  2K3F A;  2ZJP F;  3J7Y J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...