5CEBA

Bd3459 predatory endopeptidase from bdellovibrio bacteriovorus, k38m form
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
401
structure length
387
Chain Sequence
MVYLNSMCHMAANSKTQQIQGDDNKDDKFPLAAISKVVTTLWAVDRLGPDYRFKTKLHVTPTANGSYDIHIEGSRDPLFGRNMSYFLISELNRMKITKIEKLTFDENFLLAWLDTVEQQASIVRATLTSSFATAISPGYYTILKTKAARIGVQMSNRPKIDVRTISFVKKAEFQKNEKSTTMVLMSAPLKTILKRMNNQSNNYIADNLYWNLGGTEAFNAYIAGKMQADTSDIEFHNGSGNNEGSVAKPVYNEATCEMMIKVLYSLDKSLSAKGYDLSDVMAVAAKDKASTVGSYGGVMAGSTTAKTGSVNKAKTLMGSVSTKNGEIYFAVLMHTDYDKSRSDWGVASQQIKNKVSQLINQNGGPKAIKYTEQLPLPFDKYSYLTKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Bd3459
publication title Ankyrin-mediated self-protection during cell invasion by the bacterial predator Bdellovibrio bacteriovorus.
pubmed doi rcsb
source organism Bdellovibrio bacteriovorus (strain atcc 15356 / dsm 50701 / ncib 9529 / hd100)
total genus 134
structure length 387
sequence length 401
chains with identical sequence B
ec nomenclature ec 3.4.16.4: Serine-type D-Ala-D-Ala carboxypeptidase.
pdb deposition date 2015-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02113 Peptidase_S13 D-Ala-D-Ala carboxypeptidase 3 (S13) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5cebA01
3.50.80.20 Alpha Beta 3-Layer(bba) Sandwich D-tyrosyl-trna(Tyr) Deacylase; Chain: A; D-tyrosyl-trna(Tyr) Deacylase; Chain: A; 5cebA02
1NXYA 5EVLA 1Q2QA 4XXRA 4IBXA 5KSHA 2XGNA 2ZC4B 4DE3A 4ZJ1A 4B88A 1MBLA 1S6RA 5HAQA 1KVLA 3O87A 3FYZA 5HL1A 5EOEA 5I94A 3O86A 4MLLA 3FKVA 4L0LA 4EWFA 2V2FF 2XFTA 4X53A 1E4DA 5JYOA 3C5AA 4FH2A 4R4SA 5A93A 3HLCA 1K25A 3G31A 4UHUA 3BFFA 1DJAA 3HLFA 3V39A 4JXGA 3UDXA 5FATA 5GHYA 4B4ZA 1FSWA 2DRWA 2P74A 2Y91A 3PBOA 1TVFA 5FASA 5U47A 3VP1A 5FQKA 1CI8A 2WUQA 4WMCA 5E2EA 2XEPA 1PWDA 1G6AA 4MEZA 1OMEA 2BG1A 2WKHA 2V1ZA 2OLVA 3BFGA 5DTTA 4B4XA 1K54C 1K6RA 1BULA 2Y2MA 3O3VA 4C75A 1FOFA 1IKIA 4HBTA 1SDEA 1GCEA 3ZGAB 1EWZA 4DDSA 3CJMA 2IWDA 4R23A 3A3IA 3ZG0A 1LL5A 3FZCA 1EROA 4DE1A 3PAEA 5FQQA 4GDBA 2JE5A 1XA7A 4JF4A 4QB8A 4WELA 4LV2A 2EFUA 2G2WA 2Q9MA 4FD8A 3VOZA 4GDNA 3D4FA 4JF6A 3SOIA 2GDNA 4QY6A 3P98A 4WM9A 4S2IA 1BZAA 5DTSA 3WS1A 1XPBA 1MWSA 1KGEA 3OC2A 5TR7A 4KQRA 2Y2OA 3GMWA 1WYBA 2ZQAA 3MKFA 1IEMA 3P09A 2IWBA 4E6WA 3SH7A 4E3MA 4DE0A 1IELA 4OLGA 4OP8A 3IXGA 3OPLA 5E43A 3NBLA 3OCLA 1VM1A 4S2MA 1YLZA 4UA9A 3UY6A 1GHIA 1TEMA 4RVAA 1KGGA 3IH9A 3IWIA 1L2SA 1QMEA 3LY3A 4OPQA 4KZ6A 5JYPA 2HDSA 2IWCA 3IXDA 3MKEA 4KZ8A 3ZNYA 4H8RA 4OPYA 3NCKA 4ZDXA 4OPRA 4ZAMA 1XGJA 3BLMA 3N6IA 4N9KA 2G2UA 5E2GA 4K91A 5A90A 2ZC6B 2Y4AA 2XD5A 1ERQA 4Y0UA 1YT4A 3UDIA 1PW1A 1MPLA 2DNSA 3IT9A 5CGSA 5EPHA 1MY8A 4PM9A 3ZVWA 4QD4A 4U0XA 3DWKA 4OH0A 2H0TA 3OCNA 4S2NC 3Q1FA 2PBYA 3SS3A 5HW3A 4UA6A 1XP4A 5E2HA 2Y2LA 4LV3A 3VP4A 4IBRA 1HD8A 4JXVA 1ESIA 5EOOA 3HL9A 2J9OA 5KMWA 1BLCA 4U3TA 1C3BA 3O88A 2UWXA 3HVFA 3IF6C 1YMXA 4DKIA 3UE3A 5EUAA 1LL9A 5EVIC 2OV5A 3ZFZA 4PM5A 1ONHA 2Z2MB 1W79A 1CEGA 1XX2A 4KZ3A 3ZHHA 3GRJA 3NDGA 2QMIA 3A3EA 3CZDA 2Y2KA 3Q07A 4JKTA 1K57A 2H5SA 4JF5A 5TGFA 1N4OA 4OQ0A 1Q2PA 5GLCA 5AQ7A 1M6KA 3G34A 2JC7A 4OQGA 2ZD8A 3UPNA 1ZC2A 5FI2A 2EFXA 1CEFA 2C5WB 2ZM2A 1H8ZA 1DY6A 2WKIA 2ZQ7A 3C4PA 3G32A 3HBRA 5GLDA 4R3JA 5DF9A 4X55A 2EXBA 3BECA 3W4PA 1Y54A 4E3JA 3ZCZA 3HUMA 2WGVA 2X02A 3S4XA 2ZC5B 3BFDA 2XH9A 3C7VA 2HP6A 1PWCA 4QHCA 3ZG8B 5FI6A 4R0QA 1BLHA 4KQOA 4Y7PA 5FA7A 5FSRA 3LEZA 5EECA 1W8QA 3ISGA 3OPHA 1E3UD 4ZJ3A 2RL3A 5HAPA 3W4QA 2XD1A 3SH9A 4DF6A 3QNCA 2J7VA 3M6HA 1SHVA 2Y55A 1NRFA 1JWPA 3G35A 3PBQA 3GVBA 3EQUA 3M2KA 1NZOA 1KE4A 4EQIA 2XLNA 3GV9A 4WZ4A 4PM7A 1ALQA 2Z2LB 4YINA 1IKGA 3SS4A 3UPPA 2P9VB 5FQJA 1ESUA 4WEKA 5HARA 3UN7A 1I2WA 2EX2A 3E2LA 5CTMA 2H0YA 1ES2A 1MKIA 1EI5A 1W5DA 4WBGA 1NYYA 4OOYA 3HLBA 1ES3A 1PZOA 1K55A 1O7EA 4PM8A 4UAAA 4GB7A 2WZXA 4MBHA 3UE0A 3V50A 2FFYA 3B3XA 4ID4A 3PBRA 5F83A 2JBFA 4LV1A 5FDHA 3IH8A 1K55C 4BJPA 4OOMA 1MWUA 1GHMA 4GD8A 5AQBA 3CG5A 2ZQ8A 3Q7ZA 4E6XA 4K0XA 4KZBA 2XR0A 1RGYA 3DWZA 4OQHA 4UA7A 4N92A 3M6BA 5FAOA 4E3IA 5FAPA 1HVBA 3SH8A 3FV7A 3VSLA 1KGFA 1SKFA 1YLJA 2Y2JA 4JXSA 3IHBA 4HESA 4OP5A 3EQVA 3SS5A 1XKZA 3I7JA 2WK0A 3E2KA 4GN2A 3WWXA 4WZ5A 3ZG9B 1ONGA 3V5MA 5KZHA 5FI7A 2ZQ9A 1K6SA 1MWRA 4KZ9A 5E2FA 5EE8A 1PWGA 3PBTA 1J9MA 4HBUA 3HLEA 1M40A 1HZOA 2QZ6A 3MBZA 3QNBA 4KZ5A 4P0MA 3Q7VB 1E3UA 3N8RA 4P6BA 4KG5A 5FQIA 1K38A 4RX3A 3HUNA 1PIOA 1W7FA 4Y0OA 4WYYA 4FCFA 4N1HA 3AGFA 4NK3A 4ZJ2A 5F1FA 4R3BA 3S1YA 3RJUA 2I72A 1JTDA 4EBPA 1L0FA 5TFQA 4ZTKA 2ZQCA 2J9PA 1ERMA 1ZKJA 4MBKA 4N9LA 4KENB 3BEBA 2R9WA 4JXWA 4C3QA 4Z9QA 5CERA 2P9VA 3GSGA 1YLYA 4DXCA 3C7UA 3AGEA 4EV4A 4PM6A 3MZFA 4KZ4A 1S0WA 3MZEA 4OOLA 4X56A 1FSYA 4E3KA 5F1GA 5GLBA 5M19A 1JWZA 1IYQA 1JVJA 4O7DA 4QU3A 1FQGA 3M2JA 2XQZA 3IWQA 2Y2HA 2EXAA 3WS0A 4DRTA 3QHYA 3IF5A 2Q9NA 3VFFA 4BL2A 1PYYA 4R4RA 1SCWA 1ZG4A 3RXWA 1XXMA 5M18A 3VFHA 2ZC7A 1K57C 4Y0TA 4GZBA 1LLBA 3HLDA 1BUEA 1ES5A 2E8IA 3G30A 2XF3A 1CK3A 4M3KA 5CEDA 1E25A 1MXOA 1RP5A 1XGIA 1JWVA 3WS4A 4EBLA 1I2SA 4MBFA 4OVDA 3CMZA 1YQSA 4X6TA 3RXXA 1DJCA 1BTLA 4GD6A 4X68A 3WS5A 4RYEA 4KQQA 1BT5A 5BOHA 3VP3A 1TDGA 4CPKA 4IEDA 1WE4A 2WYXA 5HFOA 3ZVTA 1WYCA 4MNRA 4WEJA 1AXBA 4KZ7A 5GHXA 1KDSA 1LI9A 4R1GA 5CHMA 3ITAA 2Y2PA 4P87A 1LI0A 3Q7VA 1IYSA 2PU2A 1PI5A 2XK1A 5AQAA 4S2PA 4OONA 4LENA 4LCLA 3DTMA 3A3FA 4QJGA 2A3UA 4N1XA 1O07A 3BM6A 3BFEA 3UNWA 2Y59A 3VP2A 3IXBA 1XA1A 2QPNA 2DCFA 4S2JA 4E3LA 4ZBEA 1ES4A 4RA7A 3BRMA 4KG6A 5HX9A 2WAFA 3LY4A 1KVMA 1Z6FA 3UDFA 4U0TA 3MFDA 5FQMA 3NDEA 2Y2IA 3W4OA 2V20A 4BQMA 2CC1A 1JTGA 1RCJA 2BLSA 1G68A 2EX9A 2Y2NA 2WGWB 5DTKA 4BENA 3OPPA 3W8KA 1K4EA 2ZM0A 3TG9A 3WRTA 3WRZA 4XUZA 4P85A 3IF6B 1K54A 5J8XA 1IYPA 3MXRA 3N8SA 2ZJ9A 1I5QA 5EVIB 3VP0A 4LV0A 3ZNTA 3VOYA 4JBFA 4DE2A 2OSUA 4GOGA 4JLFA 3DW0A 1L0DA 2XDMA 3A3JA 4HEFA 1MWTA 5KSCA 5EVID 4JPMA 5F82A 1FR6A 1YM1A 1LHYA 2ZMAA 4KZAA 4OKPA 5CGXA 3S22A 1PI4A 2VGJA 5M1AA 4BD0A 4F94A 1NYMA 4YFMA 1K56D 2ZQDA 2FFFB 5CXWA 4S2KA 2ZM8A 3PBNA 1GA0A 1NZUA 2HDQA 3IWOA 1YLWA 4IVIA 2WZZA 3TSGA 4DXBA 2VGKA 1NY0A 2C6WB 2X71A 5CECA 1FCNA 4PPRA 1PZPA 3LCEA 2JCHA 2WGIA 5CHJA 4A5RA 4OQIA 3NC8A 3AGDA 3IXHA 4S2LA 5FQ9A 4CJNA 3NI9A 3WS2A 4GKUA 3HUOA 2XFSA 2B5RA 4QY5A 1YLPA 1U60A 3ZDJA 2OLUA 2Y2GA 4WZ5C 5DF7A 3G4PA 2WKEA 3OZHA 3Q81A 5CRFA 1L0EA 5HAIA 5CTNA 1GA9A 3A3DA 3HLWA 2ZLYA 5CHUA 1KE0A 2WAEA 3LO7A 4D2OA 3C4OA 3JYIA 1W8YA 2X01A 3UE1A 1FR1A 5AQ9A 1H5XA 1BSGA 1IYOA 1FCOA 2HDUA 5A92A 3Q82A 2J8YA 3NIAA 4DDYA 5D3OA 3FKWA 2EX8A 3VMAA 1FCMA 4FH4A 5L2FA 4IVKA 1GHPA 2ZC3B 4PMAA 3BFCA 3NY4A 1BLSA 3OPRA 3ZG7B 1YMSA 2RCXA 4S2NA 5CEBA 2R9XA 3FWLA 1N9BA 4K0WA 4LCMA 4OPZA 4BL3A 1H8YA 1TDLA 1VQQA 4EUZA 3PAGA 2WGWA 4Q8IA 3N8LA 4BLMA 3GR2A 4E3OA 4S2OA 4XUXA 2PU4A 3HREA 5A91A 3IF6A 1RGZA 2H10A 3UPOA 3PTEA 4WMCD 2EX6A 3N4IA 5G18A 1L0GA 5EVIA 4C6YA 3G2YA 1KE3A 3MZDA 4GNUA 2HPBA 3UO9A 4X69A 1YLTA 3VSKA 4E3NA 4KG2A 1K4FA 3BYDA 1K56A 3TOIA 4RX2A 3V3RA 3HLGA 5DVAA 5FAQA 4BD1A 3BLSA 1KDWA 1QMFA 3ITBA 1CI9A 3ZG5A 1DJBA 5CGWA 3IHAA 5GLAA 4EBNA 1HTZA 1SDNA 2Y2QA 3GTCA 1BLPA 5DF8A 3V3SA 4FSFA 3PBSA 5GHZA 2HP9A 3GQZA 3MXSA 2A49A 2HDRA 5GL9A 1NJ4A 1ZG6A 3G2ZA 3N7WA 2HP5A 4NETA 4OLDA 2WADA 1PW8A 5IHVA 3IQAA
chains in the Genus database with same CATH superfamily
1NXYA 4R6LA 2W0NA 1CQAA 4IBXA 5KSHA 3E4OA 2ZC4B 1P0ZA 2M7UA 3O87A 1P97A 3EEAA 4R4SA 1K25A 3G31A 3KYQA 4FTXA 4GW9A 4HJ3A 4II7A 2P74A 3NOPC 4GCZA 5FQKA 2WUQA 3GECA 4R38A 1PWDA 1CJFA 4MEZA 3BFGA 5DTTA 4HHDA 4B4XA 2Y2MA 3O3VA 1SDEA 1EWZA 3QP6A 2IWDA 3PAEA 2L4RA 4JF4A 4QB8A 3LR0A 2EFUA 4FD8A 5J61A 4YNRA 4WM9A 1UWPX 3BQ8A 4S2IA 1NWZA 5DTSA 5TR7A 4KQRA 2Y2OA 3LFVA 3MKFA 2ZOHA 3SH7A 1IELA 2HF6A 4S2MA 4UA9A 1L2SA 3T4SA 4NXEA 4M4XA 2IWCA 4KZ8A 4RQ9A 4H8RA 2FH5A 4ZDXA 3BLMA 3N6IA 4N9KA 2QYBA 5EPHA 2JHEA 3UB5P 3DWKA 4OH0A 2K2NA 2PBYA 3LGOA 5HW3A 4LV3A 1HD8A 3RTYA 5KMWA 2J9OA 2PT7A 1C3BA 1T19A 2UWXA 3UE3A 1GSXA 1MZUA 3ZFZA 1XX2A 4KZ3A 3NDGA 2Y2KA 4JKTA 2H5SA 2QJ7A 1N4OA 1Q2PA 2O9AA 1M6KA 3G34A 2JC7A 3UPNA 1ZC2A 1LSWA 2ZQ7A 1DY6A 3C4PA 4I39A 3H82B 3HBRA 1FILA 3D3OA 3W4PA 2HJEA 2WGVA 2X02A 4NXGA 2ZC5B 2J3WA 5EVEA 3ZG8B 4KUOA 3IBJA 1GSWA 4KQOA 3CPTB 5EECA 1W8QA 3W4QA 2XD1A 3QNCA 2J7VA 2Y55A 5DFXA 3GVBA 3M2KA 4EQIA 3GV9A 1ALQA 3SS4A 3SZTA 2P9VB 4WEKA 4WF0A 4EESA 3BY9A 1W5DA 4WBGA 3HLBA 1K55A 2VV8A 1YSPA 4NXBA 2M7VA 3TJZC 3IH8A 3FC7A 2HGVA 3IBRA 5F6AA 1G28A 1GHMA 3B42A 4ME4A 4KZBA 2XR0A 3DWZA 4UA7A 4N92A 1A0KA 3H82A 4RR7A 3TE8A 3SH8A 3MR0A 4O01A 4NBJA 4OP5A 4HESA 4RRFA 5G4YA 3I7JA 2PYRA 2WK0A 3NHQA 3ZG9B 3V5MA 2ZQ9A 1K6SA 3P01A 4KZ9A 2O9BA 1M40A 4P0MA 2P08A 4KZ5A 1E3UA 1OT6A 4P6BA 3T4LA 4RR6A 1W7FA 4N1HA 4ZJ2A 5F1FA 4MDZA 2I72A 1JTDA 4MBKA 4KENB 3B47A 4Z9QA 2P9VA 1XJ4A 5I5LA 4DXCA 4Y2FA 4BBVA 1BYWA 3MZFA 3CI6A 1S0WA 5DJUA 5GLBA 1JVJA 4QU3A 1LSVA 2XQZA 2HKZA 2EXAA 3S7QA 4RRKA 1N9LA 3VFFA 4HQAA 2OOLA 3NOUC 1ZG4A 5M18A 3HLDA 1ES5A 2E8IA 1Y4OA 1RP5A 1JWVA 3WS4A 4MBFA 3CMZA 3RXXA 1DJCA 1BTLA 1GSVA 1D06A 2GJ3A 3VP3A 1TDGA 4HP9A 4CPKA 2WYXA 5HFOA 3KSHA 4WEJA 3F1NB 5GHXA 1ZTUA 2KLIA 1LI9A 3LMTA 3DBAA 3T1SA 4P87A 1LI0A 2XK1A 5AQAA 3A0VA 4S2PA 2HL0A 2VX8A 4MN7A 3A3FA 3BM6A 3BFEA 3UNWA 2QPNA 5HL6A 2WAFA 1KVMA 3NDEA 2Y2IA 2K7SA 2BLSA 5DFYA 2UV0E 3P7NA 1T18A 1K4EA 3TG9A 4DMZA 3WRZA 3DTEA 3LYXA 1K54A 1IYPA 2VKSA 1I5QA 4LV0A 2OSUA 3LI8A 4GOGA 3FPVA 1L0DA 2ZMAA 4KZAA 4OKPA 1PI4A 4G3KA 4BD0A 5FEGA 4R3AA 5CXWA 3T1QB 2ZM8A 3PBNA 1NZUA 2HDQA 4IVIA 3TSGA 1NY0A 4WLAA 1PZPA 3FG8A 2VGLS 3LCEA 5CHJA 4CLCC 4BBUA 3NC8A 4CJNA 3IXHA 3WS2A 3NOTC 1YLPA 4F3LB 1L0EA 3KO4A 4Y15A 3HLWA 4S0KA 1KE0A 3JYIA 2W3GA 1H5XA 2Y8HA 3NIAA 3TW8A 4IVKA 2NUPC 1BLSA 2RCXA 3CITA 1XFQA 3FWLA 4K0WA 2WKQA 1PNEA 4Q8IA 2VLGA 4XUXA 1VETB 1SZVA 4WMCD 4Y13A 3N4IA 4E3NA 2NUTC 2OAP1 4NXFA 3B33A 5DVAA 4S0IA 3OLOA 2O9CA 3ZG5A 1DJBA 3IHAA 2W3HA 4EBNA 4MN5A 2JKRM 5J3WA 5DF8A 3GQZA 5L10A 1NRJA 4HJ6A 3CUEC 4NETA 1PW8A 1VB6A 5IHVA 4F3LA 5FDSA 3KO3A 3MQ0A 1S6RA 4R70A 1KVLA 5HL1A 5I94A 1TS0A 1TS7A 3LR4A 3FKVA 2XFTA 2PR6A 1E4DA 3C5AA 3HLCA 3VV4A 3V39A 3JVUA 1PRQA 1SKOB 3KSGA 4B4ZA 2QJ5A 2DRWA 4ESPA 4P6ZS 5HWWA 1N9NA 5U47A 1P9WA 3JVVA 5MC7A 3E98A 1G6AA 1VETA 3ICYA 3KODA 1GCEA 3ZGAB 1LL5A 1XA7A 3C38A 4LV2A 2G2WA 2Q9MA 2J3TC 3L9KA 2O99A 3CLOA 4JF6A 3P98A 3WS1A 3KSFA 3R7WB 2ZQAA 3P09A 4E6WA 4E3MA 3ULFA 4OLGA 3OPLA 3NBLA 1VM1A 3IH9A 3LY3A 1QMEA 4I38A 4KZ6A 3IXDA 3MKEA 4OPYA 3NCKA 2V0WA 3PXPA 3T4QA 5A90A 2Y4AA 1ERQA 4GJ4A 4BWIA 4QD4A 1SKOA 3T1XA 4GS9B 2HJ9C 4S2NC 2V8CA 3K3CA 4IBRA 4X25A 4LPZA 4JXVA 1ESIA 4EQ1A 4JGPA 3E0YA 3IF6C 4DKIA 1KOUA 1LL9A 5EVIC 5IT5A 4B9OA 2Z2MB 1CEGA 5EM0A 2XSSA 3Q07A 2W1TB 2VZWA 5AJGA 5TGFA 3MQQA 4LLOB 4OQGA 2A24B 2ZD8A 5FI2A 2EFXA 3S7NA 5TBMB 4LFUA 1OPXA 1N9OA 3U2AA 2EXBA 1Y54A 3PD2A 3R7WA 4CLCD 1XJ3A 3FPWA 3BFDA 3C7VA 4QHCA 3PD4A 5FI6A 4ZRRA 5C5KA 5HPIA 3ISGA 3JPUA 4ZJ3A 2RL3A 1P9RA 3SH9A 5HDDA 3M6HA 2QHKA 5TJJA 4IHQA 4PM7A 4GS9A 2YKFA 3UN7A 4Y17A 5CTMA 1ES2A 1MKIA 1S67L 2JKFA 3MMHA 1PZOA 3KSIA 4UAAA 5HD3A 3V50A 4GB7A 2WZXA 4MBHA 3HJIA 3B3XA 3PBRA 2JBFA 2JKTM 4LV1A 1K55C 2W1TA 4BJPA 4OOMA 1MWUA 2A24A 3M6BA 4PKYA 5TBMA 5IS1A 3F1PB 1KGFA 1YLJA 3IHBA 2ZMVA 2HL2A 3LMVA 2PDRA 3ZQ5A 3E2KA 3LIEA 4WZ5A 2W3FA 1D1JA 5KZHA 5FI7A 5E2FA 1PWGA 3PBTA 1J9MA 3HLEA 2FZ0A 3N8RA 5L09A 3S7OA 2J80A 2LB5A 1XFNA 4RRCA 3AGFA 4CQHA 2M1CA 4R3BA 2GZAA 1L0FA 5TFQA 4QWOA 2ZQCA 1ERMA 4JXWA 1YLYA 2OAQ1 3AGEA 4EV4A 4PM6A 4GLQA 4KZ4A 4X56A 4E3KA 5F1GA 5HPFA 4AFIA 4O7DA 1T1AA 1FQGA 3M2JA 3IWQA 3PHYA 4YWZA 3QHYA 4DRTA 2KDKA 4X1LA 2LB9A 4BL2A 2AVXA 2ZC7A 1K57C 5L8MA 1BUEA 2VGLM 2XF3A 4M3KA 1OJ5A 3F1PA 3SW1A 1V9YA 1YQSA 4X6TA 3LUQA 2J3TD 4RYEA 4KQQA 3KX0X 1BT5A 4BMWA 5BOHA 1FIKA 1WE4A 1TS8A 1WYCA 1KDSA 3MS6A 3LIBA 2Y2PA 2PU2A 4EERA 2GNXA 4S0LA 4LCLA 4Q0JA 3D9YA 1XA1A 4HOIA 4E3LA 4ZBEA 1ES4A 2Q0OA 3BRMA 4KG6A 1DRMA 3NJAA 1Z6FA 2CMNA 3T4TA 2V20A 1JTGA 1G68A 2ZM0A 3WRTA 3HJKA 1DP6A 3VP0A 3VOYA 4JBFA 4NEED 4DE2A 3A3JA 5KSCA 2W3DA 5EVID 1LHYA 4F94A 4LRYC 1K56D 4YFMA 2FFFB 1IOUA 4S2KA 2I9VA 3IWOA 3VE3A 2X71A 4JGRA 3EOIA 2JCHA 4OQIA 3AGDA 5FQ9A 3KO9A 3NI9A 1U60A 1H3QA 3ZDJA 2OLUA 2Y2GA 5HAIA 4RRMA 1GA9A 4JGQA 3A3DA 4B93A 3LO7A 4D2OA 3C4OA 2X01A 3UE1A 4IUHA 1IYOA 3T1RA 4DDYA 4P6ZM 3FKWA 4UQIS 2EX8A 3LIDA 2ZC3B 4PMAA 3NY4A 3ZG7B 5CEBA 1H8YA 1TDLA 3PAGA 3A0SA 3TRCA 2K31A 4BLMA 3GR2A 4WUJA 1RGZA 3UPOA 3PTEA 5J4EA 1L0GA 2DBOA 4C6YA 3W2ZA 1KE3A 3UO9A 4X69A 1YLTA 3VSKA 1K4FA 4RX2A 2L1MA 5HDSA 3HLGA 2ZOIA 5FAQA 3BLSA 4BD1A 1KDWA 4KUKA 5CGWA 5GLAA 3HCYA 1HTZA 3GTCA 1BLPA 4EU0A 4FSFA 2HP9A 3C2WA 2A49A 2HDRA 3GDIA 1NJ4A 3G2ZA 5FEFA 1J7GA 2WADA 1EW0A 4I5SA 2VK3A 5EVLA 3DAVA 1OT9A 4XXRA 1YAXA 2XGNA 3VE4A 5AVFA 2VV7A 1IFQA 3FYZA 5EOEA 3RH8B 4L0LA 4EWFA 4X53A 5JYOA 4FH2A 5A93A 4HJ4A 1VHMA 3HLFA 4MMNA 3UB8A 5GHYA 1F98A 4H6JB 3T50A 1FSWA 4EUVA 4FOFA 3PBOA 1TVFA 5FASA 4O0PA 3VP1A 1CI8A 4WMCA 3LR5A 2ZBBA 2XEPA 2BG1A 2JKGA 2OLVA 4KQDA 1K6RA 1OTBA 3CJMA 4R23A 3ZG0A 4S0JA 4DE1A 1EROA 3OOVA 5FQQA 2JE5A 4RRJA 3VOZA 4PAUA 4GDNA 5EFWA 1BZAA 1MWSA 1KGEA 3OC2A 5EM1A 3GMWA 4IJGA 5DKLA 2IWBA 4JGOA 4DE0A 2V1AA 4OP8A 3UY6A 1GHIA 4RVAA 3IWIA 4OPQA 3LR3A 5JYPA 2HDSA 3ZNYA 2V8FA 3LI9A 2G2UA 3ZYTA 2XD5A 1YT4A 3UDIA 1PW1A 1MPLA 2XROA 2PAVP 4H6JA 3Q1FA 3SS3A 1XP4A 3VP4A 1VEUA 1BLCA 4U3TA 3BY8A 3O88A 2Y79A 1NLZA 1YMXA 2OV5A 4PM5A 5HWTA 3ZHHA 3A3EA 2Z6DA 4K08A 3E4PA 4OQ0A 5GLCA 5AQ7A 4S03A 2W1RA 1MC0A 2C5WB 3G32A 2WKIA 4XT2B 1LL8A 1S4SA 4R3JA 4X55A 4CLCB 1NLYA 3BJNA 4RRGA 3BECA 5F69A 4E3JA 3ZCZA 1PFLA 2L0WA 2XH9A 3PD3A 2HP6A 4I3AA 1PWCA 1WA9A 4R0QA 4RRRA 3V67A 1BLHA 3LIFA 5FA7A 4DJ2A 3LEZA 4L9GA 3OPHA 3LICA 5HAPA 1NRFA 1JWPA 2V1BA 2O0YA 4I3JA 3QP5A 3EQUA 1NZOA 2XLNA 4WZ4A 2Z2LB 2E8JA 2XA7S 3UE6A 5HARA 3E2LA 2H0YA 4OOYA 1ES3A 4RRHA 1O7EA 2HZ5A 3UE0A 1ACFA 5IU1A 4HH3A 4GD8A 3CG5A 2WKPA 4HIAA 3Q7ZA 1H8MA 1RGYA 4E3IA 5FAPA 4XT2A 3VSLA 3FV7A 4CLCA 2Y2JA 4JXSA 3EQVA 1AWIA 5EV0A 4RRDA 5EE8A 5A8BA 3O5YA 3MBZA 3Q7VB 1F9IA 5FQIA 1K38A 4RX3A 3QP8A 3HUNA 1PIOA 4Y0OA 4LGWA 3MJQA 4FCFA 1YKDA 3S1YA 4EBPA 1Y28A 3EGXC 2ACGA 2J9PA 3KOBA 4YOFA 4PKYG 2PRFA 3GSGA 5HWVA 3MFXA 2PD7A 4Q0IA 4CLCE 2BASA 2Y2HA 3MXQA 4NG2A 3WS0A 3IF5A 2Q9NA 1PYYA 3C30A 4R4RA 2VA0A 4Y0TA 4DN0A 5L07A 1LLBA 3NULA 4HP4A 4S02A 1CK3A 3BQAA 1MXOA 1XGIA 3UMEA 4EBLA 1I2SA 4HI4A 4GD6A 4X68A 3WS5A 3CUEA 4IEDA 1XJ2A 1AXBA 3U4LP 3Q7VA 1IYSA 1PI5A 4LENA 1HLUP 4UQIM 3DTMA 4QJGA 4N1XA 3UMDA 2Y59A 3VP2A 3H9WA 2DCFA 4S2JA 5HZHA 2INWA 2VJWA 4RA7A 4DJ3A 2HV1A 3PR6A 5G4ZA 3LY4A 2MJ6A 3UDFA 3MFDA 4RRLA 2CC1A 3KO6A 3UB6A 3W8KA 4XUZA 3IF6B 5J8XA 3MXRA 3N8SA 3VOLA 5EVIB 3T4OA 1TF1A 2KOIA 4HH2A 4HEFA 3EEHA 4MCWA 4JPMA 5CGXA 3QP1A 3KNPA 1GA0A 1YLWA 2PHYA 2WZZA 2VGKA 4ETZA 4Y3IA 5CECA 1FCNA 4PPRA 3KNFA 2WGIA 4A5RA 3HUOA 2XFSA 2IA2A 2WKEA 3NECA 3KO7A 2ZLYA 5CX7A 1TC5A 2WAEA 1FR1A 5AQ9A 4RRAA 1FCOA 3T12B 2HDUA 5A92A 1Z09A 5D3OA 1FCMA 3BFCA 5J7EA 1YMSA 3UB9A 4S2NA 2R9XA 4LCMA 4BL3A 3OBFA 2P04A 1VQQA 3N8LA 4E3OA 4S2OA 2H28A 4EW7A 3HREA 5A91A 3IF6A 5EVIA 3G2YA 3MZDA 1XJ6A 1K56A 4ETXA 2D02A 4RRBA 4X1MA 1QMFA 3ITBA 1CI9A 3IX4A 2R78A 1K0KA 1SDNA 4RRQA 2A2LA 5GHZA 3T4JA 1OTDA 1ZG6A 4K0XA 1Q2QA 2XRNA 3C8CA 4DE3A 4ZJ1A 4RR8A 4B88A 1MBLA 5HAQA 4WN5A 3O86A 4MLLA 5HDCA 2V2FF 4BBTA 4UHUA 4Y5FA 3BFFA 1DP8A 1DJAA 4JXGA 3UDXA 5FATA 3K2NA 2V0UA 2PD8A 2Y91A 5E2EA 3PD5A 2W27A 1OMEA 2WKHA 2V1ZA 3QP4A 1K54C 1BULA 1UWNX 3PYPA 3LIAA 4C75A 1FOFA 4HBTA 4DDSA 3A3IA 1F5MA 3FZCA 4GDBA 4RRIA 4IUKA 2G7UA 4WELA 4GHIB 3IS2B 2W3EA 5F68A 3D4FA 3SOIA 2GDNA 4QY6A 1XPBA 2OWJA 4ARZB 1WYBA 1IEMA 3KYZA 5LBRA 3LEQA 3IXGA 5E43A 3OCLA 4FUWA 1YLZA 2PR5A 3IX3A 1TEMA 1KGGA 2QKPA 5HSQA 1T1BA 2EWWA 5K5BA 4OPRA 4QPRA 4ZAMA 1XGJA 5E2GA 3CPTA 4K91A 2ZC6B 4Y0UA 3BWLA 2XA7M 2DNSA 3IT9A 5CGSA 1MY8A 4PM9A 3ZVWA 4U0XA 2H0TA 3OCNA 1S66L 4UA6A 5E2HA 2Y2LA 1CF0A 1OJGA 5EOOA 3HL9A 4LRZE 4E04A 3HVFA 4HY8A 1G6OA 5EUAA 1ONHA 2B18A 1W79A 3GRJA 2QMIA 3CZDA 1K57A 1TS6A 4JF5A 1F2KA 4GHIA 2VEAA 4O8GA 3IS2A 1CEFA 2ZM2A 5DJTA 1H8ZA 5GLDA 5DF9A 4ARZA 3HUMA 3S4XA 3QP2A 2ZL1B 3A0RA 4Y7PA 5FSRA 4EEPA 3D72A 1E3UD 2Z6CA 2ZMFA 4DF6A 1JKEA 1SHVA 3G35A 3PBQA 2DMWA 2OKVA 1KE4A 1VEUB 2PYPA 4YINA 1IKGA 3UPPA 3MQOA 5FQJA 1ESUA 3MF0A 4D60A 1I2WA 2EX2A 1EI5A 1NYYA 4PM8A 1W63Q 2FFYA 4ID4A 2HL1A 5F83A 5FDHA 3G6OA 1D7EA 2EA9A 4WL9A 5AQBA 2ZQ8A 4E6XA 4OQHA 3L7HA 5FAOA 2GX5A 1UGUA 1HVBA 2P7JA 1SKFA 1T1CA 3DTKA 3SS5A 1L3LA 1XKZA 4GN2A 4PHTA 3T4KA 3WWXA 4EXOA 1ONGA 3RFBA 5AVEA 1MWRA 2V9AA 4HBUA 2ZL1A 2QZ6A 1HZOA 3QNBA 2JKRI 2BTFP 3F1NA 4Q0HA 4KG5A 2EWVA 4WYYA 4NK3A 5FL3A 3K3DA 3RJUA 3BW6A 3IX8A 1S1ZA 4ZTKA 1W63M 3UB7A 2WKRA 3CAXA 1ZKJA 4HNBA 4N9LA 3BEBA 2R9WA 4EETB 2B95A 4C3QA 5CERA 1X0OA 3C7UA 3CWFA 4Z1WA 3MZEA 1G5UA 4OOLA 2PBDP 1FSYA 5M19A 1JWZA 1IYQA 2KX6A 1OTIA 1SCWA 3RXWA 1XXMA 1DP9A 3VFHA 4GZBA 2YKHA 3G30A 5CEDA 1E25A 4UEYA 4OVDA 3EWKA 3KOCA 1J3WA 3R4KA 3ZVTA 1YPRA 4MNRA 4KZ7A 4R1GA 5CHMA 3ITAA 2D01A 4OONA 2A3UA 1O07A 4LRXC 1LT0A 3IXBA 4EEUA 5HX9A 4U0TA 5FQMA 1LSXA 3E4QA 3W4OA 2VV6A 2EX9A 4BQMA 1RCJA 3DTIA 2Y2NA 1ZHHB 2WGWB 5DTKA 4BENA 3H7WB 3OPPA 1Y2QA 1MKMA 4G3WA 4MN6A 4P85A 2QWSA 2ZJ9A 3ZNTA 3F1OB 1ODVA 4JLFA 3DW0A 2XDMA 3KO5A 1MWTA 5F82A 1FR6A 1YM1A 5DKKA 3S22A 2VGJA 1TD5A 5M1AA 1NYMA 2ZQDA 4DXBA 2C6WB 4S2LA 2OWHA 4GKUA 4QY5A 2B5RA 4G3VA 2B02A 4WZ5C 5DF7A 3G4PA 1S1YA 5HD5A 3OZHA 3Q81A 5CRFA 4NKPA 5F5YA 1S4RA 5CTNA 5CHUA 5KIZA 1W8YA 3KYEA 1BSGA 3CHWP 3Q82A 2J8YA 3VMAA 4FH4A 5L2FA 1YSQA 1GHPA 2JN7A 4NBIA 3OPRA 3MSHA 1N9BA 4OPZA 3LMUA 4EUZA 2WGWA 3H7WA 2PU4A 4RR9A 2H10A 4I3IA 2EX6A 5G18A 3F1OA 4GNUA 2HPBA 3EGDC 4KG2A 3BYDA 3TOIA 3V3RA 1STZA 1H0MA 1JNUA 1V9ZA 1OTEA 1OTAA 2Y2QA 2JKTI 3V3SA 4L9FA 5GL9A 3PBSA 3MXSA 3S7PA 3N7WA 2HP5A 4L9EA 4OLDA 1IKIA 3IQAA
chains in the Genus database with same CATH topology
1NXYA 5EVLA 3KO3A 1Q2QA 4XXRA 4IBXA 5KSHA 2XGNA 2ZC4B 4DE3A 4ZJ1A 4RR8A 4B88A 1MBLA 1S6RA 5HAQA 1KVLA 3O87A 3FYZA 5HL1A 5EOEA 5I94A 3O86A 4MLLA 3FKVA 4L0LA 4EWFA 2V2FF 2XFTA 4X53A 1E4DA 5JYOA 3C5AA 4FH2A 4R4SA 5A93A 3HLCA 1K25A 3G31A 4UHUA 3BFFA 1DJAA 3HLFA 3V39A 4JXGA 3UDXA 5FATA 5GHYA 4B4ZA 1FSWA 2DRWA 2P74A 2Y91A 3PBOA 1TVFA 5FASA 5U47A 3VP1A 5FQKA 1CI8A 2WUQA 4WMCA 5E2EA 3PD5A 2XEPA 1PWDA 1G6AA 4MEZA 1OMEA 2BG1A 2WKHA 2V1ZA 2OLVA 3BFGA 5DTTA 4B4XA 1K54C 1K6RA 1BULA 2Y2MA 3O3VA 4C75A 1FOFA 1IKIA 4HBTA 3KODA 1SDEA 1GCEA 3ZGAB 1EWZA 4DDSA 3CJMA 2IWDA 4R23A 3A3IA 3ZG0A 1LL5A 4S0JA 3FZCA 1EROA 4DE1A 3PAEA 5FQQA 4GDBA 4RRIA 2JE5A 1XA7A 4JF4A 4QB8A 4RRJA 4WELA 4LV2A 2EFUA 2G2WA 2Q9MA 4FD8A 3VOZA 4GDNA 5J61A 3D4FA 4JF6A 3SOIA 2GDNA 4QY6A 3P98A 4WM9A 4S2IA 1BZAA 5DTSA 3WS1A 1XPBA 1MWSA 1KGEA 3OC2A 5TR7A 4KQRA 2Y2OA 3GMWA 1WYBA 2ZQAA 3MKFA 1IEMA 3P09A 2IWBA 4E6WA 3SH7A 4E3MA 4DE0A 1IELA 4OLGA 4OP8A 3IXGA 3OPLA 5E43A 3NBLA 3OCLA 1VM1A 4S2MA 1YLZA 4UA9A 3UY6A 1GHIA 1TEMA 4RVAA 1KGGA 3IH9A 3IWIA 1L2SA 1QMEA 3LY3A 4OPQA 4KZ6A 5JYPA 2HDSA 2IWCA 3IXDA 3MKEA 4KZ8A 3ZNYA 4H8RA 4OPYA 3NCKA 4ZDXA 4OPRA 4ZAMA 1XGJA 3BLMA 3N6IA 4N9KA 2G2UA 5E2GA 4K91A 5A90A 2ZC6B 2Y4AA 2XD5A 1ERQA 4Y0UA 1YT4A 3UDIA 1PW1A 1MPLA 2DNSA 3IT9A 5CGSA 5EPHA 1MY8A 4PM9A 3ZVWA 4QD4A 4U0XA 3DWKA 4OH0A 2H0TA 3OCNA 4S2NC 3Q1FA 2PBYA 3SS3A 5HW3A 4UA6A 1XP4A 5E2HA 2Y2LA 4LV3A 3VP4A 4IBRA 1HD8A 4JXVA 1ESIA 5EOOA 3HL9A 2J9OA 5KMWA 1BLCA 4U3TA 1C3BA 3O88A 2UWXA 3HVFA 3IF6C 1YMXA 4DKIA 3UE3A 5EUAA 1LL9A 5EVIC 2OV5A 3ZFZA 4PM5A 1ONHA 2Z2MB 1W79A 1CEGA 1XX2A 4KZ3A 3ZHHA 3GRJA 3NDGA 2QMIA 3A3EA 3CZDA 2Y2KA 3Q07A 4JKTA 1K57A 2H5SA 4JF5A 5TGFA 1N4OA 4OQ0A 1Q2PA 5GLCA 5AQ7A 1M6KA 3G34A 2JC7A 4OQGA 2ZD8A 4S03A 3UPNA 1ZC2A 5FI2A 2EFXA 1CEFA 2C5WB 2ZM2A 1H8ZA 1DY6A 2WKIA 2ZQ7A 3C4PA 3G32A 3HBRA 5GLDA 4R3JA 5DF9A 4X55A 4RRGA 2EXBA 3BECA 3W4PA 1Y54A 3PD2A 4E3JA 3ZCZA 3HUMA 2WGVA 2X02A 3S4XA 2ZC5B 3BFDA 2XH9A 3PD3A 3C7VA 2HP6A 1PWCA 4QHCA 3ZG8B 3PD4A 5FI6A 4R0QA 4RRRA 1BLHA 4KQOA 4Y7PA 5FA7A 5FSRA 3LEZA 5EECA 1W8QA 3ISGA 3OPHA 1E3UD 4ZJ3A 2RL3A 5HAPA 3W4QA 2XD1A 3SH9A 4DF6A 3QNCA 2J7VA 3M6HA 1JKEA 1SHVA 2Y55A 1NRFA 1JWPA 3G35A 3PBQA 3GVBA 3EQUA 3M2KA 1NZOA 2OKVA 1KE4A 4EQIA 2XLNA 3GV9A 4WZ4A 4PM7A 1ALQA 2Z2LB 4YINA 1IKGA 3SS4A 3UPPA 2P9VB 5FQJA 1ESUA 4WEKA 5HARA 3UN7A 1I2WA 2EX2A 3E2LA 5CTMA 2H0YA 1ES2A 1MKIA 1EI5A 1W5DA 4WBGA 1NYYA 4OOYA 3HLBA 1ES3A 4RRHA 1PZOA 1K55A 1O7EA 4PM8A 4UAAA 4GB7A 2WZXA 4MBHA 3UE0A 3V50A 2FFYA 3B3XA 4ID4A 3PBRA 2HL1A 5F83A 2JBFA 4LV1A 5FDHA 3IH8A 1K55C 4BJPA 4OOMA 1MWUA 1GHMA 4GD8A 5AQBA 3CG5A 2ZQ8A 3Q7ZA 4E6XA 4K0XA 4KZBA 2XR0A 1RGYA 3DWZA 4OQHA 4UA7A 4N92A 3M6BA 5FAOA 4E3IA 5FAPA 4RR7A 1HVBA 3SH8A 3FV7A 3VSLA 1KGFA 1SKFA 1YLJA 2Y2JA 4JXSA 4NBJA 3IHBA 4HESA 4OP5A 3EQVA 3SS5A 2HL2A 3LMVA 4RRFA 1XKZA 3I7JA 2WK0A 3E2KA 4GN2A 4RRDA 3WWXA 4WZ5A 3ZG9B 1ONGA 3V5MA 5KZHA 5FI7A 2ZQ9A 1K6SA 1MWRA 4KZ9A 5E2FA 5EE8A 1PWGA 3PBTA 1J9MA 4HBUA 3HLEA 1M40A 1HZOA 2QZ6A 3MBZA 3QNBA 4KZ5A 4P0MA 3Q7VB 1E3UA 3N8RA 4P6BA 4KG5A 5FQIA 1K38A 4RX3A 3HUNA 1PIOA 4RR6A 1W7FA 4Y0OA 4WYYA 4FCFA 4N1HA 3AGFA 4NK3A 4RRCA 4ZJ2A 5F1FA 4R3BA 3S1YA 3RJUA 2I72A 1JTDA 4EBPA 1L0FA 5TFQA 4ZTKA 2ZQCA 2J9PA 1ERMA 1ZKJA 4MBKA 4N9LA 4KENB 3BEBA 2R9WA 3KOBA 4JXWA 4C3QA 4Z9QA 5CERA 2P9VA 3GSGA 1YLYA 4DXCA 3C7UA 3AGEA 4EV4A 4PM6A 3MZFA 4KZ4A 1S0WA 3MZEA 4OOLA 4X56A 1FSYA 4E3KA 5F1GA 5GLBA 5M19A 1JWZA 1IYQA 1JVJA 4O7DA 4QU3A 1FQGA 3M2JA 2XQZA 3IWQA 2HKZA 2Y2HA 2EXAA 3WS0A 4DRTA 3QHYA 3IF5A 2Q9NA 3VFFA 4RRKA 4BL2A 1PYYA 4R4RA 1SCWA 1ZG4A 3RXWA 1XXMA 5M18A 3VFHA 2ZC7A 1K57C 4Y0TA 4GZBA 1LLBA 3HLDA 1BUEA 4S02A 1ES5A 2E8IA 3G30A 2XF3A 1CK3A 4M3KA 5CEDA 1E25A 1MXOA 1RP5A 1XGIA 1JWVA 3WS4A 4EBLA 1I2SA 4MBFA 4OVDA 3CMZA 1YQSA 4X6TA 3RXXA 1DJCA 1BTLA 4GD6A 4X68A 3WS5A 4RYEA 4KQQA 1BT5A 3KOCA 5BOHA 3VP3A 1TDGA 4CPKA 4IEDA 1WE4A 2WYXA 5HFOA 3ZVTA 1WYCA 4MNRA 4WEJA 1AXBA 4KZ7A 5GHXA 1KDSA 1LI9A 4R1GA 3LMTA 5CHMA 3ITAA 2Y2PA 4P87A 1LI0A 3Q7VA 1IYSA 2PU2A 1PI5A 2XK1A 5AQAA 4S2PA 4OONA 2HL0A 4S0LA 4LENA 4LCLA 3DTMA 3A3FA 4QJGA 2A3UA 4N1XA 1O07A 3BM6A 3BFEA 3UNWA 2Y59A 3VP2A 3IXBA 1XA1A 2QPNA 2DCFA 4S2JA 4E3LA 4ZBEA 1ES4A 4RA7A 3BRMA 4KG6A 5HX9A 2WAFA 3LY4A 1KVMA 1Z6FA 3UDFA 4U0TA 3MFDA 5FQMA 4RRLA 3NDEA 2Y2IA 3W4OA 2V20A 4BQMA 2CC1A 1JTGA 1RCJA 2BLSA 1G68A 2EX9A 2Y2NA 2WGWB 5DTKA 4BENA 3OPPA 3W8KA 1Y2QA 1K4EA 2ZM0A 3TG9A 3WRTA 3WRZA 4XUZA 4P85A 3IF6B 1K54A 5J8XA 1IYPA 3MXRA 3N8SA 2ZJ9A 1I5QA 5EVIB 3VP0A 4LV0A 3ZNTA 3VOYA 4JBFA 4DE2A 2OSUA 4GOGA 4JLFA 3DW0A 1L0DA 2XDMA 3A3JA 4HEFA 1MWTA 5KSCA 3KO5A 5EVID 4JPMA 5F82A 1FR6A 1YM1A 1LHYA 2ZMAA 4KZAA 4OKPA 5CGXA 3S22A 1PI4A 2VGJA 5M1AA 4BD0A 4F94A 1NYMA 4YFMA 1K56D 2ZQDA 2FFFB 5CXWA 4S2KA 2ZM8A 3PBNA 1GA0A 1NZUA 2HDQA 3IWOA 1YLWA 4IVIA 2WZZA 3TSGA 3KNPA 4DXBA 2VGKA 1NY0A 2C6WB 2X71A 5CECA 1FCNA 4PPRA 1PZPA 3KNFA 3LCEA 2JCHA 2WGIA 5CHJA 4A5RA 4OQIA 3NC8A 3AGDA 3IXHA 4S2LA 5FQ9A 4CJNA 3KO9A 3NI9A 3WS2A 4GKUA 3HUOA 2XFSA 2B5RA 4QY5A 1YLPA 1U60A 3ZDJA 2OLUA 2Y2GA 4WZ5C 5DF7A 3G4PA 2WKEA 3OZHA 3Q81A 5CRFA 1L0EA 5HAIA 3KO7A 4RRMA 5CTNA 1GA9A 3KO4A 3A3DA 3HLWA 4S0KA 2ZLYA 5CHUA 1TC5A 1KE0A 2WAEA 3LO7A 4D2OA 3C4OA 3JYIA 1W8YA 2X01A 3UE1A 1FR1A 5AQ9A 1H5XA 1BSGA 1IYOA 4RRAA 1FCOA 2HDUA 5A92A 3Q82A 2J8YA 3NIAA 4DDYA 5D3OA 3FKWA 2EX8A 3VMAA 1FCMA 4FH4A 5L2FA 4IVKA 1GHPA 2ZC3B 4PMAA 3BFCA 3NY4A 4NBIA 1BLSA 3OPRA 3ZG7B 1YMSA 2RCXA 4S2NA 5CEBA 2R9XA 3FWLA 1N9BA 4K0WA 4LCMA 4OPZA 4BL3A 1H8YA 1TDLA 1VQQA 3LMUA 4EUZA 3PAGA 2WGWA 4Q8IA 3N8LA 4BLMA 3GR2A 4E3OA 4S2OA 4XUXA 2PU4A 3HREA 5A91A 3IF6A 1RGZA 2H10A 4RR9A 3UPOA 3PTEA 4WMCD 2EX6A 3N4IA 5G18A 1L0GA 5EVIA 4C6YA 2DBOA 3G2YA 1KE3A 3MZDA 4GNUA 2HPBA 3UO9A 4X69A 1YLTA 3VSKA 4E3NA 4KG2A 1K4FA 3BYDA 1K56A 3TOIA 4RX2A 3V3RA 3HLGA 5DVAA 5FAQA 4BD1A 3BLSA 1KDWA 4S0IA 4RRBA 1QMFA 3ITBA 1CI9A 3ZG5A 1DJBA 5CGWA 3IHAA 5GLAA 4EBNA 1HTZA 1SDNA 4RRQA 2Y2QA 3GTCA 1BLPA 5DF8A 3V3SA 4FSFA 3PBSA 5GHZA 2HP9A 3GQZA 3MXSA 2A49A 2HDRA 5GL9A 1NJ4A 1ZG6A 3G2ZA 3N7WA 2HP5A 1J7GA 4NETA 4OLDA 2WADA 1PW8A 5IHVA 3IQAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NXY A;  5EVL A;  1Q2Q A;  4XXR A;  4IBX A;  5KSH A;  2XGN A;  2ZC4 B;  4DE3 A;  4ZJ1 A;  4B88 A;  1MBL A;  1S6R A;  5HAQ A;  1KVL A;  3O87 A;  3FYZ A;  5HL1 A;  5EOE A;  5I94 A;  3O86 A;  4MLL A;  3FKV A;  4L0L A;  4EWF A;  2V2F F;  2XFT A;  4X53 A;  1E4D A;  5JYO A;  3C5A A;  4FH2 A;  4R4S A;  5A93 A;  3HLC A;  1K25 A;  3G31 A;  4UHU A;  3BFF A;  1DJA A;  3HLF A;  3V39 A;  4JXG A;  3UDX A;  5FAT A;  5GHY A;  4B4Z A;  1FSW A;  2DRW A;  2P74 A;  2Y91 A;  3PBO A;  1TVF A;  5FAS A;  5U47 A;  3VP1 A;  5FQK A;  1CI8 A;  2WUQ A;  4WMC A;  5E2E A;  2XEP A;  1PWD A;  1G6A A;  4MEZ A;  1OME A;  2BG1 A;  2WKH A;  2V1Z A;  2OLV A;  3BFG A;  5DTT A;  4B4X A;  1K54 C;  1K6R A;  1BUL A;  2Y2M A;  3O3V A;  4C75 A;  1FOF A;  1IKI A;  4HBT A;  1SDE A;  1GCE A;  3ZGA B;  1EWZ A;  4DDS A;  3CJM A;  2IWD A;  4R23 A;  3A3I A;  3ZG0 A;  1LL5 A;  3FZC A;  1ERO A;  4DE1 A;  3PAE A;  5FQQ A;  4GDB A;  2JE5 A;  1XA7 A;  4JF4 A;  4QB8 A;  4WEL A;  4LV2 A;  2EFU A;  2G2W A;  2Q9M A;  4FD8 A;  3VOZ A;  4GDN A;  3D4F A;  4JF6 A;  3SOI A;  2GDN A;  4QY6 A;  3P98 A;  4WM9 A;  4S2I A;  1BZA A;  5DTS A;  3WS1 A;  1XPB A;  1MWS A;  1KGE A;  3OC2 A;  5TR7 A;  4KQR A;  2Y2O A;  3GMW A;  1WYB A;  2ZQA A;  3MKF A;  1IEM A;  3P09 A;  2IWB A;  4E6W A;  3SH7 A;  4E3M A;  4DE0 A;  1IEL A;  4OLG A;  4OP8 A;  3IXG A;  3OPL A;  5E43 A;  3NBL A;  3OCL A;  1VM1 A;  4S2M A;  1YLZ A;  4UA9 A;  3UY6 A;  1GHI A;  1TEM A;  4RVA A;  1KGG A;  3IH9 A;  3IWI A;  1L2S A;  1QME A;  3LY3 A;  4OPQ A;  4KZ6 A;  5JYP A;  2HDS A;  2IWC A;  3IXD A;  3MKE A;  4KZ8 A;  3ZNY A;  4H8R A;  4OPY A;  3NCK A;  4ZDX A;  4OPR A;  4ZAM A;  1XGJ A;  3BLM A;  3N6I A;  4N9K A;  2G2U A;  5E2G A;  4K91 A;  5A90 A;  2ZC6 B;  2Y4A A;  2XD5 A;  1ERQ A;  4Y0U A;  1YT4 A;  3UDI A;  1PW1 A;  1MPL A;  2DNS A;  3IT9 A;  5CGS A;  5EPH A;  1MY8 A;  4PM9 A;  3ZVW A;  4QD4 A;  4U0X A;  3DWK A;  4OH0 A;  2H0T A;  3OCN A;  4S2N C;  3Q1F A;  2PBY A;  3SS3 A;  5HW3 A;  4UA6 A;  1XP4 A;  5E2H A;  2Y2L A;  4LV3 A;  3VP4 A;  4IBR A;  1HD8 A;  4JXV A;  1ESI A;  5EOO A;  3HL9 A;  2J9O A;  5KMW A;  1BLC A;  4U3T A;  1C3B A;  3O88 A;  2UWX A;  3HVF A;  3IF6 C;  1YMX A;  4DKI A;  3UE3 A;  5EUA A;  1LL9 A;  5EVI C;  2OV5 A;  3ZFZ A;  4PM5 A;  1ONH A;  2Z2M B;  1W79 A;  1CEG A;  1XX2 A;  4KZ3 A;  3ZHH A;  3GRJ A;  3NDG A;  2QMI A;  3A3E A;  3CZD A;  2Y2K A;  3Q07 A;  4JKT A;  1K57 A;  2H5S A;  4JF5 A;  5TGF A;  1N4O A;  4OQ0 A;  1Q2P A;  5GLC A;  5AQ7 A;  1M6K A;  3G34 A;  2JC7 A;  4OQG A;  2ZD8 A;  3UPN A;  1ZC2 A;  5FI2 A;  2EFX A;  1CEF A;  2C5W B;  2ZM2 A;  1H8Z A;  1DY6 A;  2WKI A;  2ZQ7 A;  3C4P A;  3G32 A;  3HBR A;  5GLD A;  4R3J A;  5DF9 A;  4X55 A;  2EXB A;  3BEC A;  3W4P A;  1Y54 A;  4E3J A;  3ZCZ A;  3HUM A;  2WGV A;  2X02 A;  3S4X A;  2ZC5 B;  3BFD A;  2XH9 A;  3C7V A;  2HP6 A;  1PWC A;  4QHC A;  3ZG8 B;  5FI6 A;  4R0Q A;  1BLH A;  4KQO A;  4Y7P A;  5FA7 A;  5FSR A;  3LEZ A;  5EEC A;  1W8Q A;  3ISG A;  3OPH A;  1E3U D;  4ZJ3 A;  2RL3 A;  5HAP A;  3W4Q A;  2XD1 A;  3SH9 A;  4DF6 A;  3QNC A;  2J7V A;  3M6H A;  1SHV A;  2Y55 A;  1NRF A;  1JWP A;  3G35 A;  3PBQ A;  3GVB A;  3EQU A;  3M2K A;  1NZO A;  1KE4 A;  4EQI A;  2XLN A;  3GV9 A;  4WZ4 A;  4PM7 A;  1ALQ A;  2Z2L B;  4YIN A;  1IKG A;  3SS4 A;  3UPP A;  2P9V B;  5FQJ A;  1ESU A;  4WEK A;  5HAR A;  3UN7 A;  1I2W A;  2EX2 A;  3E2L A;  5CTM A;  2H0Y A;  1ES2 A;  1MKI A;  1EI5 A;  1W5D A;  4WBG A;  1NYY A;  4OOY A;  3HLB A;  1ES3 A;  1PZO A;  1K55 A;  1O7E A;  4PM8 A;  4UAA A;  4GB7 A;  2WZX A;  4MBH A;  3UE0 A;  3V50 A;  2FFY A;  3B3X A;  4ID4 A;  3PBR A;  5F83 A;  2JBF A;  4LV1 A;  5FDH A;  3IH8 A;  1K55 C;  4BJP A;  4OOM A;  1MWU A;  1GHM A;  4GD8 A;  5AQB A;  3CG5 A;  2ZQ8 A;  3Q7Z A;  4E6X A;  4K0X A;  4KZB A;  2XR0 A;  1RGY A;  3DWZ A;  4OQH A;  4UA7 A;  4N92 A;  3M6B A;  5FAO A;  4E3I A;  5FAP A;  1HVB A;  3SH8 A;  3FV7 A;  3VSL A;  1KGF A;  1SKF A;  1YLJ A;  2Y2J A;  4JXS A;  3IHB A;  4HES A;  4OP5 A;  3EQV A;  3SS5 A;  1XKZ A;  3I7J A;  2WK0 A;  3E2K A;  4GN2 A;  3WWX A;  4WZ5 A;  3ZG9 B;  1ONG A;  3V5M A;  5KZH A;  5FI7 A;  2ZQ9 A;  1K6S A;  1MWR A;  4KZ9 A;  5E2F A;  5EE8 A;  1PWG A;  3PBT A;  1J9M A;  4HBU A;  3HLE A;  1M40 A;  1HZO A;  2QZ6 A;  3MBZ A;  3QNB A;  4KZ5 A;  4P0M A;  3Q7V B;  1E3U A;  3N8R A;  4P6B A;  4KG5 A;  5FQI A;  1K38 A;  4RX3 A;  3HUN A;  1PIO A;  1W7F A;  4Y0O A;  4WYY A;  4FCF A;  4N1H A;  3AGF A;  4NK3 A;  4ZJ2 A;  5F1F A;  4R3B A;  3S1Y A;  3RJU A;  2I72 A;  1JTD A;  4EBP A;  1L0F A;  5TFQ A;  4ZTK A;  2ZQC A;  2J9P A;  1ERM A;  1ZKJ A;  4MBK A;  4N9L A;  4KEN B;  3BEB A;  2R9W A;  4JXW A;  4C3Q A;  4Z9Q A;  5CER A;  2P9V A;  3GSG A;  1YLY A;  4DXC A;  3C7U A;  3AGE A;  4EV4 A;  4PM6 A;  3MZF A;  4KZ4 A;  1S0W A;  3MZE A;  4OOL A;  4X56 A;  1FSY A;  4E3K A;  5F1G A;  5GLB A;  5M19 A;  1JWZ A;  1IYQ A;  1JVJ A;  4O7D A;  4QU3 A;  1FQG A;  3M2J A;  2XQZ A;  3IWQ A;  2Y2H A;  2EXA A;  3WS0 A;  4DRT A;  3QHY A;  3IF5 A;  2Q9N A;  3VFF A;  4BL2 A;  1PYY A;  4R4R A;  1SCW A;  1ZG4 A;  3RXW A;  1XXM A;  5M18 A;  3VFH A;  2ZC7 A;  1K57 C;  4Y0T A;  4GZB A;  1LLB A;  3HLD A;  1BUE A;  1ES5 A;  2E8I A;  3G30 A;  2XF3 A;  1CK3 A;  4M3K A;  5CED A;  1E25 A;  1MXO A;  1RP5 A;  1XGI A;  1JWV A;  3WS4 A;  4EBL A;  1I2S A;  4MBF A;  4OVD A;  3CMZ A;  1YQS A;  4X6T A;  3RXX A;  1DJC A;  1BTL A;  4GD6 A;  4X68 A;  3WS5 A;  4RYE A;  4KQQ A;  1BT5 A;  5BOH A;  3VP3 A;  1TDG A;  4CPK A;  4IED A;  1WE4 A;  2WYX A;  5HFO A;  3ZVT A;  1WYC A;  4MNR A;  4WEJ A;  1AXB A;  4KZ7 A;  5GHX A;  1KDS A;  1LI9 A;  4R1G A;  5CHM A;  3ITA A;  2Y2P A;  4P87 A;  1LI0 A;  3Q7V A;  1IYS A;  2PU2 A;  1PI5 A;  2XK1 A;  5AQA A;  4S2P A;  4OON A;  4LEN A;  4LCL A;  3DTM A;  3A3F A;  4QJG A;  2A3U A;  4N1X A;  1O07 A;  3BM6 A;  3BFE A;  3UNW A;  2Y59 A;  3VP2 A;  3IXB A;  1XA1 A;  2QPN A;  2DCF A;  4S2J A;  4E3L A;  4ZBE A;  1ES4 A;  4RA7 A;  3BRM A;  4KG6 A;  5HX9 A;  2WAF A;  3LY4 A;  1KVM A;  1Z6F A;  3UDF A;  4U0T A;  3MFD A;  5FQM A;  3NDE A;  2Y2I A;  3W4O A;  2V20 A;  4BQM A;  2CC1 A;  1JTG A;  1RCJ A;  2BLS A;  1G68 A;  2EX9 A;  2Y2N A;  2WGW B;  5DTK A;  4BEN A;  3OPP A;  3W8K A;  1K4E A;  2ZM0 A;  3TG9 A;  3WRT A;  3WRZ A;  4XUZ A;  4P85 A;  3IF6 B;  1K54 A;  5J8X A;  1IYP A;  3MXR A;  3N8S A;  2ZJ9 A;  1I5Q A;  5EVI B;  3VP0 A;  4LV0 A;  3ZNT A;  3VOY A;  4JBF A;  4DE2 A;  2OSU A;  4GOG A;  4JLF A;  3DW0 A;  1L0D A;  2XDM A;  3A3J A;  4HEF A;  1MWT A;  5KSC A;  5EVI D;  4JPM A;  5F82 A;  1FR6 A;  1YM1 A;  1LHY A;  2ZMA A;  4KZA A;  4OKP A;  5CGX A;  3S22 A;  1PI4 A;  2VGJ A;  5M1A A;  4BD0 A;  4F94 A;  1NYM A;  4YFM A;  1K56 D;  2ZQD A;  2FFF B;  5CXW A;  4S2K A;  2ZM8 A;  3PBN A;  1GA0 A;  1NZU A;  2HDQ A;  3IWO A;  1YLW A;  4IVI A;  2WZZ A;  3TSG A;  4DXB A;  2VGK A;  1NY0 A;  2C6W B;  2X71 A;  5CEC A;  1FCN A;  4PPR A;  1PZP A;  3LCE A;  2JCH A;  2WGI A;  5CHJ A;  4A5R A;  4OQI A;  3NC8 A;  3AGD A;  3IXH A;  4S2L A;  5FQ9 A;  4CJN A;  3NI9 A;  3WS2 A;  4GKU A;  3HUO A;  2XFS A;  2B5R A;  4QY5 A;  1YLP A;  1U60 A;  3ZDJ A;  2OLU A;  2Y2G A;  4WZ5 C;  5DF7 A;  3G4P A;  2WKE A;  3OZH A;  3Q81 A;  5CRF A;  1L0E A;  5HAI A;  5CTN A;  1GA9 A;  3A3D A;  3HLW A;  2ZLY A;  5CHU A;  1KE0 A;  2WAE A;  3LO7 A;  4D2O A;  3C4O A;  3JYI A;  1W8Y A;  2X01 A;  3UE1 A;  1FR1 A;  5AQ9 A;  1H5X A;  1BSG A;  1IYO A;  1FCO A;  2HDU A;  5A92 A;  3Q82 A;  2J8Y A;  3NIA A;  4DDY A;  5D3O A;  3FKW A;  2EX8 A;  3VMA A;  1FCM A;  4FH4 A;  5L2F A;  4IVK A;  1GHP A;  2ZC3 B;  4PMA A;  3BFC A;  3NY4 A;  1BLS A;  3OPR A;  3ZG7 B;  1YMS A;  2RCX A;  4S2N A;  5CEB A;  2R9X A;  3FWL A;  1N9B A;  4K0W A;  4LCM A;  4OPZ A;  4BL3 A;  1H8Y A;  1TDL A;  1VQQ A;  4EUZ A;  3PAG A;  2WGW A;  4Q8I A;  3N8L A;  4BLM A;  3GR2 A;  4E3O A;  4S2O A;  4XUX A;  2PU4 A;  3HRE A;  5A91 A;  3IF6 A;  1RGZ A;  2H10 A;  3UPO A;  3PTE A;  4WMC D;  2EX6 A;  3N4I A;  5G18 A;  1L0G A;  5EVI A;  4C6Y A;  3G2Y A;  1KE3 A;  3MZD A;  4GNU A;  2HPB A;  3UO9 A;  4X69 A;  1YLT A;  3VSK A;  4E3N A;  4KG2 A;  1K4F A;  3BYD A;  1K56 A;  3TOI A;  4RX2 A;  3V3R A;  3HLG A;  5DVA A;  5FAQ A;  4BD1 A;  3BLS A;  1KDW A;  1QMF A;  3ITB A;  1CI9 A;  3ZG5 A;  1DJB A;  5CGW A;  3IHA A;  5GLA A;  4EBN A;  1HTZ A;  1SDN A;  2Y2Q A;  3GTC A;  1BLP A;  5DF8 A;  3V3S A;  4FSF A;  3PBS A;  5GHZ A;  2HP9 A;  3GQZ A;  3MXS A;  2A49 A;  2HDR A;  5GL9 A;  1NJ4 A;  1ZG6 A;  3G2Z A;  3N7W A;  2HP5 A;  4NET A;  4OLD A;  2WAD A;  1PW8 A;  5IHV A;  3IQA A; 
#chains in the Genus database with same CATH topology
 1NXY A;  4R6L A;  2W0N A;  1CQA A;  4IBX A;  5KSH A;  3E4O A;  2ZC4 B;  1P0Z A;  2M7U A;  3O87 A;  1P97 A;  3EEA A;  4R4S A;  1K25 A;  3G31 A;  3KYQ A;  4FTX A;  4GW9 A;  4HJ3 A;  4II7 A;  2P74 A;  3NOP C;  4GCZ A;  5FQK A;  2WUQ A;  3GEC A;  4R38 A;  1PWD A;  1CJF A;  4MEZ A;  3BFG A;  5DTT A;  4HHD A;  4B4X A;  2Y2M A;  3O3V A;  1SDE A;  1EWZ A;  3QP6 A;  2IWD A;  3PAE A;  2L4R A;  4JF4 A;  4QB8 A;  3LR0 A;  2EFU A;  4FD8 A;  5J61 A;  4YNR A;  4WM9 A;  1UWP X;  3BQ8 A;  4S2I A;  1NWZ A;  5DTS A;  5TR7 A;  4KQR A;  2Y2O A;  3LFV A;  3MKF A;  2ZOH A;  3SH7 A;  1IEL A;  2HF6 A;  4S2M A;  4UA9 A;  1L2S A;  3T4S A;  4NXE A;  4M4X A;  2IWC A;  4KZ8 A;  4RQ9 A;  4H8R A;  2FH5 A;  4ZDX A;  3BLM A;  3N6I A;  4N9K A;  2QYB A;  5EPH A;  2JHE A;  3UB5 P;  3DWK A;  4OH0 A;  2K2N A;  2PBY A;  3LGO A;  5HW3 A;  4LV3 A;  1HD8 A;  3RTY A;  5KMW A;  2J9O A;  2PT7 A;  1C3B A;  1T19 A;  2UWX A;  3UE3 A;  1GSX A;  1MZU A;  3ZFZ A;  1XX2 A;  4KZ3 A;  3NDG A;  2Y2K A;  4JKT A;  2H5S A;  2QJ7 A;  1N4O A;  1Q2P A;  2O9A A;  1M6K A;  3G34 A;  2JC7 A;  3UPN A;  1ZC2 A;  1LSW A;  2ZQ7 A;  1DY6 A;  3C4P A;  4I39 A;  3H82 B;  3HBR A;  1FIL A;  3D3O A;  3W4P A;  2HJE A;  2WGV A;  2X02 A;  4NXG A;  2ZC5 B;  2J3W A;  5EVE A;  3ZG8 B;  4KUO A;  3IBJ A;  1GSW A;  4KQO A;  3CPT B;  5EEC A;  1W8Q A;  3W4Q A;  2XD1 A;  3QNC A;  2J7V A;  2Y55 A;  5DFX A;  3GVB A;  3M2K A;  4EQI A;  3GV9 A;  1ALQ A;  3SS4 A;  3SZT A;  2P9V B;  4WEK A;  4WF0 A;  4EES A;  3BY9 A;  1W5D A;  4WBG A;  3HLB A;  1K55 A;  2VV8 A;  1YSP A;  4NXB A;  2M7V A;  3TJZ C;  3IH8 A;  3FC7 A;  2HGV A;  3IBR A;  5F6A A;  1G28 A;  1GHM A;  3B42 A;  4ME4 A;  4KZB A;  2XR0 A;  3DWZ A;  4UA7 A;  4N92 A;  1A0K A;  3H82 A;  4RR7 A;  3TE8 A;  3SH8 A;  3MR0 A;  4O01 A;  4NBJ A;  4OP5 A;  4HES A;  4RRF A;  5G4Y A;  3I7J A;  2PYR A;  2WK0 A;  3NHQ A;  3ZG9 B;  3V5M A;  2ZQ9 A;  1K6S A;  3P01 A;  4KZ9 A;  2O9B A;  1M40 A;  4P0M A;  2P08 A;  4KZ5 A;  1E3U A;  1OT6 A;  4P6B A;  3T4L A;  4RR6 A;  1W7F A;  4N1H A;  4ZJ2 A;  5F1F A;  4MDZ A;  2I72 A;  1JTD A;  4MBK A;  4KEN B;  3B47 A;  4Z9Q A;  2P9V A;  1XJ4 A;  5I5L A;  4DXC A;  4Y2F A;  4BBV A;  1BYW A;  3MZF A;  3CI6 A;  1S0W A;  5DJU A;  5GLB A;  1JVJ A;  4QU3 A;  1LSV A;  2XQZ A;  2HKZ A;  2EXA A;  3S7Q A;  4RRK A;  1N9L A;  3VFF A;  4HQA A;  2OOL A;  3NOU C;  1ZG4 A;  5M18 A;  3HLD A;  1ES5 A;  2E8I A;  1Y4O A;  1RP5 A;  1JWV A;  3WS4 A;  4MBF A;  3CMZ A;  3RXX A;  1DJC A;  1BTL A;  1GSV A;  1D06 A;  2GJ3 A;  3VP3 A;  1TDG A;  4HP9 A;  4CPK A;  2WYX A;  5HFO A;  3KSH A;  4WEJ A;  3F1N B;  5GHX A;  1ZTU A;  2KLI A;  1LI9 A;  3LMT A;  3DBA A;  3T1S A;  4P87 A;  1LI0 A;  2XK1 A;  5AQA A;  3A0V A;  4S2P A;  2HL0 A;  2VX8 A;  4MN7 A;  3A3F A;  3BM6 A;  3BFE A;  3UNW A;  2QPN A;  5HL6 A;  2WAF A;  1KVM A;  3NDE A;  2Y2I A;  2K7S A;  2BLS A;  5DFY A;  2UV0 E;  3P7N A;  1T18 A;  1K4E A;  3TG9 A;  4DMZ A;  3WRZ A;  3DTE A;  3LYX A;  1K54 A;  1IYP A;  2VKS A;  1I5Q A;  4LV0 A;  2OSU A;  3LI8 A;  4GOG A;  3FPV A;  1L0D A;  2ZMA A;  4KZA A;  4OKP A;  1PI4 A;  4G3K A;  4BD0 A;  5FEG A;  4R3A A;  5CXW A;  3T1Q B;  2ZM8 A;  3PBN A;  1NZU A;  2HDQ A;  4IVI A;  3TSG A;  1NY0 A;  4WLA A;  1PZP A;  3FG8 A;  2VGL S;  3LCE A;  5CHJ A;  4CLC C;  4BBU A;  3NC8 A;  4CJN A;  3IXH A;  3WS2 A;  3NOT C;  1YLP A;  4F3L B;  1L0E A;  3KO4 A;  4Y15 A;  3HLW A;  4S0K A;  1KE0 A;  3JYI A;  2W3G A;  1H5X A;  2Y8H A;  3NIA A;  3TW8 A;  4IVK A;  2NUP C;  1BLS A;  2RCX A;  3CIT A;  1XFQ A;  3FWL A;  4K0W A;  2WKQ A;  1PNE A;  4Q8I A;  2VLG A;  4XUX A;  1VET B;  1SZV A;  4WMC D;  4Y13 A;  3N4I A;  4E3N A;  2NUT C;  2OAP 1;  4NXF A;  3B33 A;  5DVA A;  4S0I A;  3OLO A;  2O9C A;  3ZG5 A;  1DJB A;  3IHA A;  2W3H A;  4EBN A;  4MN5 A;  2JKR M;  5J3W A;  5DF8 A;  3GQZ A;  5L10 A;  1NRJ A;  4HJ6 A;  3CUE C;  4NET A;  1PW8 A;  1VB6 A;  5IHV A;  4F3L A;  5FDS A;  3KO3 A;  3MQ0 A;  1S6R A;  4R70 A;  1KVL A;  5HL1 A;  5I94 A;  1TS0 A;  1TS7 A;  3LR4 A;  3FKV A;  2XFT A;  2PR6 A;  1E4D A;  3C5A A;  3HLC A;  3VV4 A;  3V39 A;  3JVU A;  1PRQ A;  1SKO B;  3KSG A;  4B4Z A;  2QJ5 A;  2DRW A;  4ESP A;  4P6Z S;  5HWW A;  1N9N A;  5U47 A;  1P9W A;  3JVV A;  5MC7 A;  3E98 A;  1G6A A;  1VET A;  3ICY A;  3KOD A;  1GCE A;  3ZGA B;  1LL5 A;  1XA7 A;  3C38 A;  4LV2 A;  2G2W A;  2Q9M A;  2J3T C;  3L9K A;  2O99 A;  3CLO A;  4JF6 A;  3P98 A;  3WS1 A;  3KSF A;  3R7W B;  2ZQA A;  3P09 A;  4E6W A;  4E3M A;  3ULF A;  4OLG A;  3OPL A;  3NBL A;  1VM1 A;  3IH9 A;  3LY3 A;  1QME A;  4I38 A;  4KZ6 A;  3IXD A;  3MKE A;  4OPY A;  3NCK A;  2V0W A;  3PXP A;  3T4Q A;  5A90 A;  2Y4A A;  1ERQ A;  4GJ4 A;  4BWI A;  4QD4 A;  1SKO A;  3T1X A;  4GS9 B;  2HJ9 C;  4S2N C;  2V8C A;  3K3C A;  4IBR A;  4X25 A;  4LPZ A;  4JXV A;  1ESI A;  4EQ1 A;  4JGP A;  3E0Y A;  3IF6 C;  4DKI A;  1KOU A;  1LL9 A;  5EVI C;  5IT5 A;  4B9O A;  2Z2M B;  1CEG A;  5EM0 A;  2XSS A;  3Q07 A;  2W1T B;  2VZW A;  5AJG A;  5TGF A;  3MQQ A;  4LLO B;  4OQG A;  2A24 B;  2ZD8 A;  5FI2 A;  2EFX A;  3S7N A;  5TBM B;  4LFU A;  1OPX A;  1N9O A;  3U2A A;  2EXB A;  1Y54 A;  3PD2 A;  3R7W A;  4CLC D;  1XJ3 A;  3FPW A;  3BFD A;  3C7V A;  4QHC A;  3PD4 A;  5FI6 A;  4ZRR A;  5C5K A;  5HPI A;  3ISG A;  3JPU A;  4ZJ3 A;  2RL3 A;  1P9R A;  3SH9 A;  5HDD A;  3M6H A;  2QHK A;  5TJJ A;  4IHQ A;  4PM7 A;  4GS9 A;  2YKF A;  3UN7 A;  4Y17 A;  5CTM A;  1ES2 A;  1MKI A;  1S67 L;  2JKF A;  3MMH A;  1PZO A;  3KSI A;  4UAA A;  5HD3 A;  3V50 A;  4GB7 A;  2WZX A;  4MBH A;  3HJI A;  3B3X A;  3PBR A;  2JBF A;  2JKT M;  4LV1 A;  1K55 C;  2W1T A;  4BJP A;  4OOM A;  1MWU A;  2A24 A;  3M6B A;  4PKY A;  5TBM A;  5IS1 A;  3F1P B;  1KGF A;  1YLJ A;  3IHB A;  2ZMV A;  2HL2 A;  3LMV A;  2PDR A;  3ZQ5 A;  3E2K A;  3LIE A;  4WZ5 A;  2W3F A;  1D1J A;  5KZH A;  5FI7 A;  5E2F A;  1PWG A;  3PBT A;  1J9M A;  3HLE A;  2FZ0 A;  3N8R A;  5L09 A;  3S7O A;  2J80 A;  2LB5 A;  1XFN A;  4RRC A;  3AGF A;  4CQH A;  2M1C A;  4R3B A;  2GZA A;  1L0F A;  5TFQ A;  4QWO A;  2ZQC A;  1ERM A;  4JXW A;  1YLY A;  2OAQ 1;  3AGE A;  4EV4 A;  4PM6 A;  4GLQ A;  4KZ4 A;  4X56 A;  4E3K A;  5F1G A;  5HPF A;  4AFI A;  4O7D A;  1T1A A;  1FQG A;  3M2J A;  3IWQ A;  3PHY A;  4YWZ A;  3QHY A;  4DRT A;  2KDK A;  4X1L A;  2LB9 A;  4BL2 A;  2AVX A;  2ZC7 A;  1K57 C;  5L8M A;  1BUE A;  2VGL M;  2XF3 A;  4M3K A;  1OJ5 A;  3F1P A;  3SW1 A;  1V9Y A;  1YQS A;  4X6T A;  3LUQ A;  2J3T D;  4RYE A;  4KQQ A;  3KX0 X;  1BT5 A;  4BMW A;  5BOH A;  1FIK A;  1WE4 A;  1TS8 A;  1WYC A;  1KDS A;  3MS6 A;  3LIB A;  2Y2P A;  2PU2 A;  4EER A;  2GNX A;  4S0L A;  4LCL A;  4Q0J A;  3D9Y A;  1XA1 A;  4HOI A;  4E3L A;  4ZBE A;  1ES4 A;  2Q0O A;  3BRM A;  4KG6 A;  1DRM A;  3NJA A;  1Z6F A;  2CMN A;  3T4T A;  2V20 A;  1JTG A;  1G68 A;  2ZM0 A;  3WRT A;  3HJK A;  1DP6 A;  3VP0 A;  3VOY A;  4JBF A;  4NEE D;  4DE2 A;  3A3J A;  5KSC A;  2W3D A;  5EVI D;  1LHY A;  4F94 A;  4LRY C;  1K56 D;  4YFM A;  2FFF B;  1IOU A;  4S2K A;  2I9V A;  3IWO A;  3VE3 A;  2X71 A;  4JGR A;  3EOI A;  2JCH A;  4OQI A;  3AGD A;  5FQ9 A;  3KO9 A;  3NI9 A;  1U60 A;  1H3Q A;  3ZDJ A;  2OLU A;  2Y2G A;  5HAI A;  4RRM A;  1GA9 A;  4JGQ A;  3A3D A;  4B93 A;  3LO7 A;  4D2O A;  3C4O A;  2X01 A;  3UE1 A;  4IUH A;  1IYO A;  3T1R A;  4DDY A;  4P6Z M;  3FKW A;  4UQI S;  2EX8 A;  3LID A;  2ZC3 B;  4PMA A;  3NY4 A;  3ZG7 B;  5CEB A;  1H8Y A;  1TDL A;  3PAG A;  3A0S A;  3TRC A;  2K31 A;  4BLM A;  3GR2 A;  4WUJ A;  1RGZ A;  3UPO A;  3PTE A;  5J4E A;  1L0G A;  2DBO A;  4C6Y A;  3W2Z A;  1KE3 A;  3UO9 A;  4X69 A;  1YLT A;  3VSK A;  1K4F A;  4RX2 A;  2L1M A;  5HDS A;  3HLG A;  2ZOI A;  5FAQ A;  3BLS A;  4BD1 A;  1KDW A;  4KUK A;  5CGW A;  5GLA A;  3HCY A;  1HTZ A;  3GTC A;  1BLP A;  4EU0 A;  4FSF A;  2HP9 A;  3C2W A;  2A49 A;  2HDR A;  3GDI A;  1NJ4 A;  3G2Z A;  5FEF A;  1J7G A;  2WAD A;  1EW0 A;  4I5S A;  2VK3 A;  5EVL A;  3DAV A;  1OT9 A;  4XXR A;  1YAX A;  2XGN A;  3VE4 A;  5AVF A;  2VV7 A;  1IFQ A;  3FYZ A;  5EOE A;  3RH8 B;  4L0L A;  4EWF A;  4X53 A;  5JYO A;  4FH2 A;  5A93 A;  4HJ4 A;  1VHM A;  3HLF A;  4MMN A;  3UB8 A;  5GHY A;  1F98 A;  4H6J B;  3T50 A;  1FSW A;  4EUV A;  4FOF A;  3PBO A;  1TVF A;  5FAS A;  4O0P A;  3VP1 A;  1CI8 A;  4WMC A;  3LR5 A;  2ZBB A;  2XEP A;  2BG1 A;  2JKG A;  2OLV A;  4KQD A;  1K6R A;  1OTB A;  3CJM A;  4R23 A;  3ZG0 A;  4S0J A;  4DE1 A;  1ERO A;  3OOV A;  5FQQ A;  2JE5 A;  4RRJ A;  3VOZ A;  4PAU A;  4GDN A;  5EFW A;  1BZA A;  1MWS A;  1KGE A;  3OC2 A;  5EM1 A;  3GMW A;  4IJG A;  5DKL A;  2IWB A;  4JGO A;  4DE0 A;  2V1A A;  4OP8 A;  3UY6 A;  1GHI A;  4RVA A;  3IWI A;  4OPQ A;  3LR3 A;  5JYP A;  2HDS A;  3ZNY A;  2V8F A;  3LI9 A;  2G2U A;  3ZYT A;  2XD5 A;  1YT4 A;  3UDI A;  1PW1 A;  1MPL A;  2XRO A;  2PAV P;  4H6J A;  3Q1F A;  3SS3 A;  1XP4 A;  3VP4 A;  1VEU A;  1BLC A;  4U3T A;  3BY8 A;  3O88 A;  2Y79 A;  1NLZ A;  1YMX A;  2OV5 A;  4PM5 A;  5HWT A;  3ZHH A;  3A3E A;  2Z6D A;  4K08 A;  3E4P A;  4OQ0 A;  5GLC A;  5AQ7 A;  4S03 A;  2W1R A;  1MC0 A;  2C5W B;  3G32 A;  2WKI A;  4XT2 B;  1LL8 A;  1S4S A;  4R3J A;  4X55 A;  4CLC B;  1NLY A;  3BJN A;  4RRG A;  3BEC A;  5F69 A;  4E3J A;  3ZCZ A;  1PFL A;  2L0W A;  2XH9 A;  3PD3 A;  2HP6 A;  4I3A A;  1PWC A;  1WA9 A;  4R0Q A;  4RRR A;  3V67 A;  1BLH A;  3LIF A;  5FA7 A;  4DJ2 A;  3LEZ A;  4L9G A;  3OPH A;  3LIC A;  5HAP A;  1NRF A;  1JWP A;  2V1B A;  2O0Y A;  4I3J A;  3QP5 A;  3EQU A;  1NZO A;  2XLN A;  4WZ4 A;  2Z2L B;  2E8J A;  2XA7 S;  3UE6 A;  5HAR A;  3E2L A;  2H0Y A;  4OOY A;  1ES3 A;  4RRH A;  1O7E A;  2HZ5 A;  3UE0 A;  1ACF A;  5IU1 A;  4HH3 A;  4GD8 A;  3CG5 A;  2WKP A;  4HIA A;  3Q7Z A;  1H8M A;  1RGY A;  4E3I A;  5FAP A;  4XT2 A;  3VSL A;  3FV7 A;  4CLC A;  2Y2J A;  4JXS A;  3EQV A;  1AWI A;  5EV0 A;  4RRD A;  5EE8 A;  5A8B A;  3O5Y A;  3MBZ A;  3Q7V B;  1F9I A;  5FQI A;  1K38 A;  4RX3 A;  3QP8 A;  3HUN A;  1PIO A;  4Y0O A;  4LGW A;  3MJQ A;  4FCF A;  1YKD A;  3S1Y A;  4EBP A;  1Y28 A;  3EGX C;  2ACG A;  2J9P A;  3KOB A;  4YOF A;  4PKY G;  2PRF A;  3GSG A;  5HWV A;  3MFX A;  2PD7 A;  4Q0I A;  4CLC E;  2BAS A;  2Y2H A;  3MXQ A;  4NG2 A;  3WS0 A;  3IF5 A;  2Q9N A;  1PYY A;  3C30 A;  4R4R A;  2VA0 A;  4Y0T A;  4DN0 A;  5L07 A;  1LLB A;  3NUL A;  4HP4 A;  4S02 A;  1CK3 A;  3BQA A;  1MXO A;  1XGI A;  3UME A;  4EBL A;  1I2S A;  4HI4 A;  4GD6 A;  4X68 A;  3WS5 A;  3CUE A;  4IED A;  1XJ2 A;  1AXB A;  3U4L P;  3Q7V A;  1IYS A;  1PI5 A;  4LEN A;  1HLU P;  4UQI M;  3DTM A;  4QJG A;  4N1X A;  3UMD A;  2Y59 A;  3VP2 A;  3H9W A;  2DCF A;  4S2J A;  5HZH A;  2INW A;  2VJW A;  4RA7 A;  4DJ3 A;  2HV1 A;  3PR6 A;  5G4Z A;  3LY4 A;  2MJ6 A;  3UDF A;  3MFD A;  4RRL A;  2CC1 A;  3KO6 A;  3UB6 A;  3W8K A;  4XUZ A;  3IF6 B;  5J8X A;  3MXR A;  3N8S A;  3VOL A;  5EVI B;  3T4O A;  1TF1 A;  2KOI A;  4HH2 A;  4HEF A;  3EEH A;  4MCW A;  4JPM A;  5CGX A;  3QP1 A;  3KNP A;  1GA0 A;  1YLW A;  2PHY A;  2WZZ A;  2VGK A;  4ETZ A;  4Y3I A;  5CEC A;  1FCN A;  4PPR A;  3KNF A;  2WGI A;  4A5R A;  3HUO A;  2XFS A;  2IA2 A;  2WKE A;  3NEC A;  3KO7 A;  2ZLY A;  5CX7 A;  1TC5 A;  2WAE A;  1FR1 A;  5AQ9 A;  4RRA A;  1FCO A;  3T12 B;  2HDU A;  5A92 A;  1Z09 A;  5D3O A;  1FCM A;  3BFC A;  5J7E A;  1YMS A;  3UB9 A;  4S2N A;  2R9X A;  4LCM A;  4BL3 A;  3OBF A;  2P04 A;  1VQQ A;  3N8L A;  4E3O A;  4S2O A;  2H28 A;  4EW7 A;  3HRE A;  5A91 A;  3IF6 A;  5EVI A;  3G2Y A;  3MZD A;  1XJ6 A;  1K56 A;  4ETX A;  2D02 A;  4RRB A;  4X1M A;  1QMF A;  3ITB A;  1CI9 A;  3IX4 A;  2R78 A;  1K0K A;  1SDN A;  4RRQ A;  2A2L A;  5GHZ A;  3T4J A;  1OTD A;  1ZG6 A;  4K0X A;  1Q2Q A;  2XRN A;  3C8C A;  4DE3 A;  4ZJ1 A;  4RR8 A;  4B88 A;  1MBL A;  5HAQ A;  4WN5 A;  3O86 A;  4MLL A;  5HDC A;  2V2F F;  4BBT A;  4UHU A;  4Y5F A;  3BFF A;  1DP8 A;  1DJA A;  4JXG A;  3UDX A;  5FAT A;  3K2N A;  2V0U A;  2PD8 A;  2Y91 A;  5E2E A;  3PD5 A;  2W27 A;  1OME A;  2WKH A;  2V1Z A;  3QP4 A;  1K54 C;  1BUL A;  1UWN X;  3PYP A;  3LIA A;  4C75 A;  1FOF A;  4HBT A;  4DDS A;  3A3I A;  1F5M A;  3FZC A;  4GDB A;  4RRI A;  4IUK A;  2G7U A;  4WEL A;  4GHI B;  3IS2 B;  2W3E A;  5F68 A;  3D4F A;  3SOI A;  2GDN A;  4QY6 A;  1XPB A;  2OWJ A;  4ARZ B;  1WYB A;  1IEM A;  3KYZ A;  5LBR A;  3LEQ A;  3IXG A;  5E43 A;  3OCL A;  4FUW A;  1YLZ A;  2PR5 A;  3IX3 A;  1TEM A;  1KGG A;  2QKP A;  5HSQ A;  1T1B A;  2EWW A;  5K5B A;  4OPR A;  4QPR A;  4ZAM A;  1XGJ A;  5E2G A;  3CPT A;  4K91 A;  2ZC6 B;  4Y0U A;  3BWL A;  2XA7 M;  2DNS A;  3IT9 A;  5CGS A;  1MY8 A;  4PM9 A;  3ZVW A;  4U0X A;  2H0T A;  3OCN A;  1S66 L;  4UA6 A;  5E2H A;  2Y2L A;  1CF0 A;  1OJG A;  5EOO A;  3HL9 A;  4LRZ E;  4E04 A;  3HVF A;  4HY8 A;  1G6O A;  5EUA A;  1ONH A;  2B18 A;  1W79 A;  3GRJ A;  2QMI A;  3CZD A;  1K57 A;  1TS6 A;  4JF5 A;  1F2K A;  4GHI A;  2VEA A;  4O8G A;  3IS2 A;  1CEF A;  2ZM2 A;  5DJT A;  1H8Z A;  5GLD A;  5DF9 A;  4ARZ A;  3HUM A;  3S4X A;  3QP2 A;  2ZL1 B;  3A0R A;  4Y7P A;  5FSR A;  4EEP A;  3D72 A;  1E3U D;  2Z6C A;  2ZMF A;  4DF6 A;  1JKE A;  1SHV A;  3G35 A;  3PBQ A;  2DMW A;  2OKV A;  1KE4 A;  1VEU B;  2PYP A;  4YIN A;  1IKG A;  3UPP A;  3MQO A;  5FQJ A;  1ESU A;  3MF0 A;  4D60 A;  1I2W A;  2EX2 A;  1EI5 A;  1NYY A;  4PM8 A;  1W63 Q;  2FFY A;  4ID4 A;  2HL1 A;  5F83 A;  5FDH A;  3G6O A;  1D7E A;  2EA9 A;  4WL9 A;  5AQB A;  2ZQ8 A;  4E6X A;  4OQH A;  3L7H A;  5FAO A;  2GX5 A;  1UGU A;  1HVB A;  2P7J A;  1SKF A;  1T1C A;  3DTK A;  3SS5 A;  1L3L A;  1XKZ A;  4GN2 A;  4PHT A;  3T4K A;  3WWX A;  4EXO A;  1ONG A;  3RFB A;  5AVE A;  1MWR A;  2V9A A;  4HBU A;  2ZL1 A;  2QZ6 A;  1HZO A;  3QNB A;  2JKR I;  2BTF P;  3F1N A;  4Q0H A;  4KG5 A;  2EWV A;  4WYY A;  4NK3 A;  5FL3 A;  3K3D A;  3RJU A;  3BW6 A;  3IX8 A;  1S1Z A;  4ZTK A;  1W63 M;  3UB7 A;  2WKR A;  3CAX A;  1ZKJ A;  4HNB A;  4N9L A;  3BEB A;  2R9W A;  4EET B;  2B95 A;  4C3Q A;  5CER A;  1X0O A;  3C7U A;  3CWF A;  4Z1W A;  3MZE A;  1G5U A;  4OOL A;  2PBD P;  1FSY A;  5M19 A;  1JWZ A;  1IYQ A;  2KX6 A;  1OTI A;  1SCW A;  3RXW A;  1XXM A;  1DP9 A;  3VFH A;  4GZB A;  2YKH A;  3G30 A;  5CED A;  1E25 A;  4UEY A;  4OVD A;  3EWK A;  3KOC A;  1J3W A;  3R4K A;  3ZVT A;  1YPR A;  4MNR A;  4KZ7 A;  4R1G A;  5CHM A;  3ITA A;  2D01 A;  4OON A;  2A3U A;  1O07 A;  4LRX C;  1LT0 A;  3IXB A;  4EEU A;  5HX9 A;  4U0T A;  5FQM A;  1LSX A;  3E4Q A;  3W4O A;  2VV6 A;  2EX9 A;  4BQM A;  1RCJ A;  3DTI A;  2Y2N A;  1ZHH B;  2WGW B;  5DTK A;  4BEN A;  3H7W B;  3OPP A;  1Y2Q A;  1MKM A;  4G3W A;  4MN6 A;  4P85 A;  2QWS A;  2ZJ9 A;  3ZNT A;  3F1O B;  1ODV A;  4JLF A;  3DW0 A;  2XDM A;  3KO5 A;  1MWT A;  5F82 A;  1FR6 A;  1YM1 A;  5DKK A;  3S22 A;  2VGJ A;  1TD5 A;  5M1A A;  1NYM A;  2ZQD A;  4DXB A;  2C6W B;  4S2L A;  2OWH A;  4GKU A;  4QY5 A;  2B5R A;  4G3V A;  2B02 A;  4WZ5 C;  5DF7 A;  3G4P A;  1S1Y A;  5HD5 A;  3OZH A;  3Q81 A;  5CRF A;  4NKP A;  5F5Y A;  1S4R A;  5CTN A;  5CHU A;  5KIZ A;  1W8Y A;  3KYE A;  1BSG A;  3CHW P;  3Q82 A;  2J8Y A;  3VMA A;  4FH4 A;  5L2F A;  1YSQ A;  1GHP A;  2JN7 A;  4NBI A;  3OPR A;  3MSH A;  1N9B A;  4OPZ A;  3LMU A;  4EUZ A;  2WGW A;  3H7W A;  2PU4 A;  4RR9 A;  2H10 A;  4I3I A;  2EX6 A;  5G18 A;  3F1O A;  4GNU A;  2HPB A;  3EGD C;  4KG2 A;  3BYD A;  3TOI A;  3V3R A;  1STZ A;  1H0M A;  1JNU A;  1V9Z A;  1OTE A;  1OTA A;  2Y2Q A;  2JKT I;  3V3S A;  4L9F A;  5GL9 A;  3PBS A;  3MXS A;  3S7P A;  3N7W A;  2HP5 A;  4L9E A;  4OLD A;  1IKI A;  3IQA A; 
#chains in the Genus database with same CATH homology
 1NXY A;  5EVL A;  3KO3 A;  1Q2Q A;  4XXR A;  4IBX A;  5KSH A;  2XGN A;  2ZC4 B;  4DE3 A;  4ZJ1 A;  4RR8 A;  4B88 A;  1MBL A;  1S6R A;  5HAQ A;  1KVL A;  3O87 A;  3FYZ A;  5HL1 A;  5EOE A;  5I94 A;  3O86 A;  4MLL A;  3FKV A;  4L0L A;  4EWF A;  2V2F F;  2XFT A;  4X53 A;  1E4D A;  5JYO A;  3C5A A;  4FH2 A;  4R4S A;  5A93 A;  3HLC A;  1K25 A;  3G31 A;  4UHU A;  3BFF A;  1DJA A;  3HLF A;  3V39 A;  4JXG A;  3UDX A;  5FAT A;  5GHY A;  4B4Z A;  1FSW A;  2DRW A;  2P74 A;  2Y91 A;  3PBO A;  1TVF A;  5FAS A;  5U47 A;  3VP1 A;  5FQK A;  1CI8 A;  2WUQ A;  4WMC A;  5E2E A;  3PD5 A;  2XEP A;  1PWD A;  1G6A A;  4MEZ A;  1OME A;  2BG1 A;  2WKH A;  2V1Z A;  2OLV A;  3BFG A;  5DTT A;  4B4X A;  1K54 C;  1K6R A;  1BUL A;  2Y2M A;  3O3V A;  4C75 A;  1FOF A;  1IKI A;  4HBT A;  3KOD A;  1SDE A;  1GCE A;  3ZGA B;  1EWZ A;  4DDS A;  3CJM A;  2IWD A;  4R23 A;  3A3I A;  3ZG0 A;  1LL5 A;  4S0J A;  3FZC A;  1ERO A;  4DE1 A;  3PAE A;  5FQQ A;  4GDB A;  4RRI A;  2JE5 A;  1XA7 A;  4JF4 A;  4QB8 A;  4RRJ A;  4WEL A;  4LV2 A;  2EFU A;  2G2W A;  2Q9M A;  4FD8 A;  3VOZ A;  4GDN A;  5J61 A;  3D4F A;  4JF6 A;  3SOI A;  2GDN A;  4QY6 A;  3P98 A;  4WM9 A;  4S2I A;  1BZA A;  5DTS A;  3WS1 A;  1XPB A;  1MWS A;  1KGE A;  3OC2 A;  5TR7 A;  4KQR A;  2Y2O A;  3GMW A;  1WYB A;  2ZQA A;  3MKF A;  1IEM A;  3P09 A;  2IWB A;  4E6W A;  3SH7 A;  4E3M A;  4DE0 A;  1IEL A;  4OLG A;  4OP8 A;  3IXG A;  3OPL A;  5E43 A;  3NBL A;  3OCL A;  1VM1 A;  4S2M A;  1YLZ A;  4UA9 A;  3UY6 A;  1GHI A;  1TEM A;  4RVA A;  1KGG A;  3IH9 A;  3IWI A;  1L2S A;  1QME A;  3LY3 A;  4OPQ A;  4KZ6 A;  5JYP A;  2HDS A;  2IWC A;  3IXD A;  3MKE A;  4KZ8 A;  3ZNY A;  4H8R A;  4OPY A;  3NCK A;  4ZDX A;  4OPR A;  4ZAM A;  1XGJ A;  3BLM A;  3N6I A;  4N9K A;  2G2U A;  5E2G A;  4K91 A;  5A90 A;  2ZC6 B;  2Y4A A;  2XD5 A;  1ERQ A;  4Y0U A;  1YT4 A;  3UDI A;  1PW1 A;  1MPL A;  2DNS A;  3IT9 A;  5CGS A;  5EPH A;  1MY8 A;  4PM9 A;  3ZVW A;  4QD4 A;  4U0X A;  3DWK A;  4OH0 A;  2H0T A;  3OCN A;  4S2N C;  3Q1F A;  2PBY A;  3SS3 A;  5HW3 A;  4UA6 A;  1XP4 A;  5E2H A;  2Y2L A;  4LV3 A;  3VP4 A;  4IBR A;  1HD8 A;  4JXV A;  1ESI A;  5EOO A;  3HL9 A;  2J9O A;  5KMW A;  1BLC A;  4U3T A;  1C3B A;  3O88 A;  2UWX A;  3HVF A;  3IF6 C;  1YMX A;  4DKI A;  3UE3 A;  5EUA A;  1LL9 A;  5EVI C;  2OV5 A;  3ZFZ A;  4PM5 A;  1ONH A;  2Z2M B;  1W79 A;  1CEG A;  1XX2 A;  4KZ3 A;  3ZHH A;  3GRJ A;  3NDG A;  2QMI A;  3A3E A;  3CZD A;  2Y2K A;  3Q07 A;  4JKT A;  1K57 A;  2H5S A;  4JF5 A;  5TGF A;  1N4O A;  4OQ0 A;  1Q2P A;  5GLC A;  5AQ7 A;  1M6K A;  3G34 A;  2JC7 A;  4OQG A;  2ZD8 A;  4S03 A;  3UPN A;  1ZC2 A;  5FI2 A;  2EFX A;  1CEF A;  2C5W B;  2ZM2 A;  1H8Z A;  1DY6 A;  2WKI A;  2ZQ7 A;  3C4P A;  3G32 A;  3HBR A;  5GLD A;  4R3J A;  5DF9 A;  4X55 A;  4RRG A;  2EXB A;  3BEC A;  3W4P A;  1Y54 A;  3PD2 A;  4E3J A;  3ZCZ A;  3HUM A;  2WGV A;  2X02 A;  3S4X A;  2ZC5 B;  3BFD A;  2XH9 A;  3PD3 A;  3C7V A;  2HP6 A;  1PWC A;  4QHC A;  3ZG8 B;  3PD4 A;  5FI6 A;  4R0Q A;  4RRR A;  1BLH A;  4KQO A;  4Y7P A;  5FA7 A;  5FSR A;  3LEZ A;  5EEC A;  1W8Q A;  3ISG A;  3OPH A;  1E3U D;  4ZJ3 A;  2RL3 A;  5HAP A;  3W4Q A;  2XD1 A;  3SH9 A;  4DF6 A;  3QNC A;  2J7V A;  3M6H A;  1JKE A;  1SHV A;  2Y55 A;  1NRF A;  1JWP A;  3G35 A;  3PBQ A;  3GVB A;  3EQU A;  3M2K A;  1NZO A;  2OKV A;  1KE4 A;  4EQI A;  2XLN A;  3GV9 A;  4WZ4 A;  4PM7 A;  1ALQ A;  2Z2L B;  4YIN A;  1IKG A;  3SS4 A;  3UPP A;  2P9V B;  5FQJ A;  1ESU A;  4WEK A;  5HAR A;  3UN7 A;  1I2W A;  2EX2 A;  3E2L A;  5CTM A;  2H0Y A;  1ES2 A;  1MKI A;  1EI5 A;  1W5D A;  4WBG A;  1NYY A;  4OOY A;  3HLB A;  1ES3 A;  4RRH A;  1PZO A;  1K55 A;  1O7E A;  4PM8 A;  4UAA A;  4GB7 A;  2WZX A;  4MBH A;  3UE0 A;  3V50 A;  2FFY A;  3B3X A;  4ID4 A;  3PBR A;  2HL1 A;  5F83 A;  2JBF A;  4LV1 A;  5FDH A;  3IH8 A;  1K55 C;  4BJP A;  4OOM A;  1MWU A;  1GHM A;  4GD8 A;  5AQB A;  3CG5 A;  2ZQ8 A;  3Q7Z A;  4E6X A;  4K0X A;  4KZB A;  2XR0 A;  1RGY A;  3DWZ A;  4OQH A;  4UA7 A;  4N92 A;  3M6B A;  5FAO A;  4E3I A;  5FAP A;  4RR7 A;  1HVB A;  3SH8 A;  3FV7 A;  3VSL A;  1KGF A;  1SKF A;  1YLJ A;  2Y2J A;  4JXS A;  4NBJ A;  3IHB A;  4HES A;  4OP5 A;  3EQV A;  3SS5 A;  2HL2 A;  3LMV A;  4RRF A;  1XKZ A;  3I7J A;  2WK0 A;  3E2K A;  4GN2 A;  4RRD A;  3WWX A;  4WZ5 A;  3ZG9 B;  1ONG A;  3V5M A;  5KZH A;  5FI7 A;  2ZQ9 A;  1K6S A;  1MWR A;  4KZ9 A;  5E2F A;  5EE8 A;  1PWG A;  3PBT A;  1J9M A;  4HBU A;  3HLE A;  1M40 A;  1HZO A;  2QZ6 A;  3MBZ A;  3QNB A;  4KZ5 A;  4P0M A;  3Q7V B;  1E3U A;  3N8R A;  4P6B A;  4KG5 A;  5FQI A;  1K38 A;  4RX3 A;  3HUN A;  1PIO A;  4RR6 A;  1W7F A;  4Y0O A;  4WYY A;  4FCF A;  4N1H A;  3AGF A;  4NK3 A;  4RRC A;  4ZJ2 A;  5F1F A;  4R3B A;  3S1Y A;  3RJU A;  2I72 A;  1JTD A;  4EBP A;  1L0F A;  5TFQ A;  4ZTK A;  2ZQC A;  2J9P A;  1ERM A;  1ZKJ A;  4MBK A;  4N9L A;  4KEN B;  3BEB A;  2R9W A;  3KOB A;  4JXW A;  4C3Q A;  4Z9Q A;  5CER A;  2P9V A;  3GSG A;  1YLY A;  4DXC A;  3C7U A;  3AGE A;  4EV4 A;  4PM6 A;  3MZF A;  4KZ4 A;  1S0W A;  3MZE A;  4OOL A;  4X56 A;  1FSY A;  4E3K A;  5F1G A;  5GLB A;  5M19 A;  1JWZ A;  1IYQ A;  1JVJ A;  4O7D A;  4QU3 A;  1FQG A;  3M2J A;  2XQZ A;  3IWQ A;  2HKZ A;  2Y2H A;  2EXA A;  3WS0 A;  4DRT A;  3QHY A;  3IF5 A;  2Q9N A;  3VFF A;  4RRK A;  4BL2 A;  1PYY A;  4R4R A;  1SCW A;  1ZG4 A;  3RXW A;  1XXM A;  5M18 A;  3VFH A;  2ZC7 A;  1K57 C;  4Y0T A;  4GZB A;  1LLB A;  3HLD A;  1BUE A;  4S02 A;  1ES5 A;  2E8I A;  3G30 A;  2XF3 A;  1CK3 A;  4M3K A;  5CED A;  1E25 A;  1MXO A;  1RP5 A;  1XGI A;  1JWV A;  3WS4 A;  4EBL A;  1I2S A;  4MBF A;  4OVD A;  3CMZ A;  1YQS A;  4X6T A;  3RXX A;  1DJC A;  1BTL A;  4GD6 A;  4X68 A;  3WS5 A;  4RYE A;  4KQQ A;  1BT5 A;  3KOC A;  5BOH A;  3VP3 A;  1TDG A;  4CPK A;  4IED A;  1WE4 A;  2WYX A;  5HFO A;  3ZVT A;  1WYC A;  4MNR A;  4WEJ A;  1AXB A;  4KZ7 A;  5GHX A;  1KDS A;  1LI9 A;  4R1G A;  3LMT A;  5CHM A;  3ITA A;  2Y2P A;  4P87 A;  1LI0 A;  3Q7V A;  1IYS A;  2PU2 A;  1PI5 A;  2XK1 A;  5AQA A;  4S2P A;  4OON A;  2HL0 A;  4S0L A;  4LEN A;  4LCL A;  3DTM A;  3A3F A;  4QJG A;  2A3U A;  4N1X A;  1O07 A;  3BM6 A;  3BFE A;  3UNW A;  2Y59 A;  3VP2 A;  3IXB A;  1XA1 A;  2QPN A;  2DCF A;  4S2J A;  4E3L A;  4ZBE A;  1ES4 A;  4RA7 A;  3BRM A;  4KG6 A;  5HX9 A;  2WAF A;  3LY4 A;  1KVM A;  1Z6F A;  3UDF A;  4U0T A;  3MFD A;  5FQM A;  4RRL A;  3NDE A;  2Y2I A;  3W4O A;  2V20 A;  4BQM A;  2CC1 A;  1JTG A;  1RCJ A;  2BLS A;  1G68 A;  2EX9 A;  2Y2N A;  2WGW B;  5DTK A;  4BEN A;  3OPP A;  3W8K A;  1Y2Q A;  1K4E A;  2ZM0 A;  3TG9 A;  3WRT A;  3WRZ A;  4XUZ A;  4P85 A;  3IF6 B;  1K54 A;  5J8X A;  1IYP A;  3MXR A;  3N8S A;  2ZJ9 A;  1I5Q A;  5EVI B;  3VP0 A;  4LV0 A;  3ZNT A;  3VOY A;  4JBF A;  4DE2 A;  2OSU A;  4GOG A;  4JLF A;  3DW0 A;  1L0D A;  2XDM A;  3A3J A;  4HEF A;  1MWT A;  5KSC A;  3KO5 A;  5EVI D;  4JPM A;  5F82 A;  1FR6 A;  1YM1 A;  1LHY A;  2ZMA A;  4KZA A;  4OKP A;  5CGX A;  3S22 A;  1PI4 A;  2VGJ A;  5M1A A;  4BD0 A;  4F94 A;  1NYM A;  4YFM A;  1K56 D;  2ZQD A;  2FFF B;  5CXW A;  4S2K A;  2ZM8 A;  3PBN A;  1GA0 A;  1NZU A;  2HDQ A;  3IWO A;  1YLW A;  4IVI A;  2WZZ A;  3TSG A;  3KNP A;  4DXB A;  2VGK A;  1NY0 A;  2C6W B;  2X71 A;  5CEC A;  1FCN A;  4PPR A;  1PZP A;  3KNF A;  3LCE A;  2JCH A;  2WGI A;  5CHJ A;  4A5R A;  4OQI A;  3NC8 A;  3AGD A;  3IXH A;  4S2L A;  5FQ9 A;  4CJN A;  3KO9 A;  3NI9 A;  3WS2 A;  4GKU A;  3HUO A;  2XFS A;  2B5R A;  4QY5 A;  1YLP A;  1U60 A;  3ZDJ A;  2OLU A;  2Y2G A;  4WZ5 C;  5DF7 A;  3G4P A;  2WKE A;  3OZH A;  3Q81 A;  5CRF A;  1L0E A;  5HAI A;  3KO7 A;  4RRM A;  5CTN A;  1GA9 A;  3KO4 A;  3A3D A;  3HLW A;  4S0K A;  2ZLY A;  5CHU A;  1TC5 A;  1KE0 A;  2WAE A;  3LO7 A;  4D2O A;  3C4O A;  3JYI A;  1W8Y A;  2X01 A;  3UE1 A;  1FR1 A;  5AQ9 A;  1H5X A;  1BSG A;  1IYO A;  4RRA A;  1FCO A;  2HDU A;  5A92 A;  3Q82 A;  2J8Y A;  3NIA A;  4DDY A;  5D3O A;  3FKW A;  2EX8 A;  3VMA A;  1FCM A;  4FH4 A;  5L2F A;  4IVK A;  1GHP A;  2ZC3 B;  4PMA A;  3BFC A;  3NY4 A;  4NBI A;  1BLS A;  3OPR A;  3ZG7 B;  1YMS A;  2RCX A;  4S2N A;  5CEB A;  2R9X A;  3FWL A;  1N9B A;  4K0W A;  4LCM A;  4OPZ A;  4BL3 A;  1H8Y A;  1TDL A;  1VQQ A;  3LMU A;  4EUZ A;  3PAG A;  2WGW A;  4Q8I A;  3N8L A;  4BLM A;  3GR2 A;  4E3O A;  4S2O A;  4XUX A;  2PU4 A;  3HRE A;  5A91 A;  3IF6 A;  1RGZ A;  2H10 A;  4RR9 A;  3UPO A;  3PTE A;  4WMC D;  2EX6 A;  3N4I A;  5G18 A;  1L0G A;  5EVI A;  4C6Y A;  2DBO A;  3G2Y A;  1KE3 A;  3MZD A;  4GNU A;  2HPB A;  3UO9 A;  4X69 A;  1YLT A;  3VSK A;  4E3N A;  4KG2 A;  1K4F A;  3BYD A;  1K56 A;  3TOI A;  4RX2 A;  3V3R A;  3HLG A;  5DVA A;  5FAQ A;  4BD1 A;  3BLS A;  1KDW A;  4S0I A;  4RRB A;  1QMF A;  3ITB A;  1CI9 A;  3ZG5 A;  1DJB A;  5CGW A;  3IHA A;  5GLA A;  4EBN A;  1HTZ A;  1SDN A;  4RRQ A;  2Y2Q A;  3GTC A;  1BLP A;  5DF8 A;  3V3S A;  4FSF A;  3PBS A;  5GHZ A;  2HP9 A;  3GQZ A;  3MXS A;  2A49 A;  2HDR A;  5GL9 A;  1NJ4 A;  1ZG6 A;  3G2Z A;  3N7W A;  2HP5 A;  1J7G A;  4NET A;  4OLD A;  2WAD A;  1PW8 A;  5IHV A;  3IQA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...