5CECA

Bd3459 predatory endopeptidase from bdellovibrio bacteriovorus in complex with immunity protein bd3460
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
401
structure length
401
Chain Sequence
MVYLNSMCHMAANSKTQQIQGDDNKDDKFPLASISKVVTTLWAVDRLGPDYRFKTKLHVTPTANGSYDIHIEGSRDPLFGRNMSYFLISELNRMKITKIEKLTFDENFLLAWLAEEKPMIGGTTPKYDTVEQQASIVRATLTSSFATAISPGYYTILKTKAARIGVQMSNRPKIDVRTISFVKKAEFQKNEKSTTMVLMSAPLKTILKRMNNQSNNYIADNLYWNLGGTEAFNAYIAGKMQADTSDIEFHNGSGNNEGSVAKPVYNEATCEMMIKVLYSLDKSLSAKGYDLSDVMAVAAKDKASTVGSYGGVMAGSTTAKTGSVNKAKTLMGSVSTKNGEIYFAVLMHTDYDKSRSDWGVASQQIKNKVSQLINQNGGPKAIKYTEQLPLPFDKYSYLTKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Bd3459
publication title Ankyrin-mediated self-protection during cell invasion by the bacterial predator Bdellovibrio bacteriovorus.
pubmed doi rcsb
source organism Bdellovibrio bacteriovorus (strain atcc 15356 / dsm 50701 / ncib 9529 / hd100)
total genus 146
structure length 401
sequence length 401
ec nomenclature ec 3.4.16.4: Serine-type D-Ala-D-Ala carboxypeptidase.
pdb deposition date 2015-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02113 Peptidase_S13 D-Ala-D-Ala carboxypeptidase 3 (S13) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5cecA01
3.50.80.20 Alpha Beta 3-Layer(bba) Sandwich D-tyrosyl-trna(Tyr) Deacylase; Chain: A; D-tyrosyl-trna(Tyr) Deacylase; Chain: A; 5cecA02
5FDHA 4B4XA 1L0EA 4OOYA 1KDSA 4E3IA 3RXWA 5EOOA 1IELA 4Y0UA 4S2MA 3TSGA 5HAPA 4GB7A 2ZQ9A 5FQJA 4KG5A 5BOHA 3V3RA 1E4DA 2OV5A 3IWIA 1SHVA 4YFMA 3VP4A 2X71A 3BLMA 2V20A 4HBUA 4MBKA 1BTLA 3MFDA 4Y0TA 3W4PA 2QPNA 3ITBA 4X55A 3UY6A 1PZPA 4KZ5A 2WK0A 3O87A 2EXBA 5FSRA 5HAQA 3SS4A 3HLWA 3VMAA 4KQQA 5CTMA 1XGJA 3MZDA 5EOEA 4GN2A 1L2SA 4EWFA 2BLSA 3IH9A 4Y7PA 1GA9A 4WEKA 3ZHHA 5KMWA 1KGEA 3GRJA 3N7WA 4N92A 5CGSA 1SKFA 4MNRA 4JXWA 5KSHA 3UE3A 1NRFA 3G35A 5JYOA 2A3UA 3CG5A 1QMFA 3C4PA 2PBYA 3FKWA 2ZC5B 3IXDA 1L0FA 2Y2OA 4GDBA 5TFQA 4BJPA 1RP5A 3HLGA 3SS5A 1G68A 3IXGA 3ZG5A 3WS2A 3FWLA 1K55C 1MKIA 3G32A 4U0TA 1K4EA 1YLTA 3HLEA 4UA6A 1XPBA 3NI9A 5FQQA 1ONGA 1L0DA 4MLLA 2XD1A 2ZQCA 1K56A 4FH4A 4JPMA 2I72A 5F1GA 3O3VA 4EBPA 3UPOA 4KZ3A 3WRTA 4KENB 3VP3A 3OZHA 2EX2A 5GHXA 1PI4A 1MPLA 3ZG8B 3VP2A 1KVMA 3CJMA 4R23A 4Z9QA 3ZG7B 2XK1A 5HL1A 5KSCA 3G2ZA 2HDRA 3N8SA 1YLPA 3A3EA 3HLDA 1BLHA 2ZLYA 2ZQDA 4WZ4A 3QNBA 3IF6A 5GLBA 4IBRA 1NZUA 2ZC7A 4R3JA 3CMZA 3WWXA 5FATA 1FR1A 3HUNA 3V50A 4WZ5A 1GHMA 3RXXA 1RGYA 2HP5A 4GDNA 2ZQ8A 1JVJA 5EVID 4CJNA 4S2OA 2G2WA 2XQZA 3HLFA 2HDUA 3VFFA 3A3IA 5A93A 1ZG6A 1FSYA 5EE8A 2IWDA 4ID4A 5M19A 5DVAA 3ISGA 2Y2KA 3ZNTA 1N4OA 3IXHA 4DE2A 3NDEA 3IF6B 4R3BA 2ZMAA 4OP5A 2ZM0A 2Y2QA 5TR7A 2XH9A 4U3TA 4BL2A 4OPYA 4P87A 4GNUA 1KGFA 5AQAA 3IHBA 5DF8A 4DDYA 1KDWA 2GDNA 3M6HA 5GHZA 2XD5A 4X56A 1ESIA 1N9BA 3LEZA 4C6YA 2X02A 5J8XA 3NC8A 1CI9A 2Y2JA 2P74A 4YINA 3ZVTA 1FOFA 1H8ZA 1E25A 1NYYA 3N6IA 3OC2A 5D3OA 1SDEA 1MWSA 3IF5A 1NXYA 4U0XA 5GL9A 2J9OA 1K57A 4KZBA 1Q2PA 3C7UA 1XX2A 2HPBA 1PW1A 1ZG4A 3QHYA 2V1ZA 1XGIA 3VOZA 1XXMA 1Q2QA 2OLUA 4MEZA 1HD8A 5FQ9A 3FKVA 3TOIA 2XFSA 1S0WA 1BLPA 3C4OA 4IVIA 4DXBA 3ZVWA 4PPRA 2WAEA 5CHJA 1GHIA 4E3NA 4PM6A 1ERMA 4OVDA 1KE3A 4N9KA 2G2UA 3BRMA 3BLSA 4R1GA 1K54A 3NIAA 4XXRA 1LLBA 2DNSA 4S2NC 2JBFA 3MKFA 2Y59A 1I5QA 4HEFA 3QNCA 1L0GA 1EWZA 4WMCD 2WKHA 5TGFA 3SH8A 1LI9A 4ZAMA 1W8QA 1ES3A 4PMAA 4RA7A 4JXGA 3WS5A 3E2KA 4KG6A 3P09A 5FASA 5GLDA 4LCLA 2Y2MA 4N1HA 4WEJA 3N4IA 5EVIA 1BULA 1W79A 4E3MA 4R4SA 5L2FA 2VGJA 2DCFA 3GSGA 1NZOA 3W4QA 5M18A 5I94A 4OQGA 4B88A 3G34A 5EPHA 5FQMA 3PBRA 4S2KA 2DRWA 3SH7A 4E3OA 2ZC6B 1TDGA 4KZ6A 3BM6A 2C5WB 5GLCA 4OONA 4BENA 5CECA 4ZDXA 4ZJ2A 4WYYA 5CRFA 4XUZA 4DKIA 5A90A 1I2WA 4JBFA 1MWUA 4OP8A 5FI7A 5HFOA 3VFHA 3ZNYA 3BFEA 2ZC4B 5EVIB 1NY0A 2WGVA 4KQOA 2WGIA 1LI0A 2HP9A 1CK3A 3MBZA 1E3UD 3NDGA 4KZ4A 2RL3A 3BFDA 2J7VA 1PYYA 2BG1A 1PWDA 1LL5A 5FAQA 1AXBA 3HLBA 1YQSA 3ITAA 5DTSA 3ZDJA 2WKEA 1I2SA 2Y2NA 5EUAA 5AQ9A 1ALQA 4OPZA 3ZG0A 3BFFA 3BECA 2ZQAA 3VSKA 5IHVA 4RYEA 3GV9A 3OPPA 5JYPA 4JLFA 5GHYA 1RGZA 2QZ6A 4Y0OA 3C5AA 3G30A 4IEDA 3S4XA 4P6BA 1JWPA 4X69A 5FAOA 5CEBA 3IXBA 3WS0A 1O07A 5GLAA 2Q9NA 2J9PA 2V2FF 1CI8A 3IH8A 3IWOA 5AQ7A 2H0YA 4O7DA 3UO9A 2ZM8A 1XA1A 3PBNA 4JF6A 4C3QA 4DE0A 3NY4A 1ERQA 4JF5A 5FA7A 5FQKA 2H10A 5CTNA 1DJCA 2XGNA 4JXSA 4K0WA 4F94A 2OSUA 2E8IA 3VOYA 3N8LA 4X6TA 2X01A 1H5XA 4FCFA 5HARA 3EQVA 1C3BA 1K25A 1PWCA 2EXAA 3IQAA 4S2PA 4WMCA 1FQGA 5CXWA 3UDFA 1YMXA 4UA9A 3PBOA 3Q07A 5U47A 4C75A 4X68A 3AGFA 3VP1A 2Z2LB 5FI6A 4EBLA 1GHPA 4L0LA 4GKUA 4QD4A 1KE4A 1K6SA 4OKPA 1FCNA 5G18A 3MZFA 4OQ0A 4JXVA 3HUOA 5CERA 3BFGA 4QY5A 4ZTKA 4DE1A 3DW0A 4JKTA 4LCMA 4WBGA 4H8RA 2H5SA 1CEFA 2EX6A 3IF6C 1IEMA 1ES5A 2ZD8A 2CC1A 3OPRA 4KZ9A 1YLZA 2Y2PA 1JTDA 1Y54A 3I7JA 3Q7ZA 3S22A 4HBTA 2VGKA 4FH2A 2JC7A 2XLNA 3IWQA 1PIOA 3GR2A 4IBXA 1GCEA 4KQRA 4WZ5C 3W8KA 3CZDA 1TDLA 4N1XA 1DJBA 4R4RA 1BSGA 3HVFA 3A3FA 4IVKA 3GMWA 5FI2A 2Y2HA 2WADA 1XKZA 3FV7A 3HBRA 1Z6FA 1IKIA 1DY6A 1HTZA 1IYPA 2XFTA 4S2IA 3BYDA 2WZXA 3SH9A 3N8RA 4BLMA 3HLCA 4GD6A 4DDSA 1E3UA 3ZFZA 5FQIA 3NBLA 4E3JA 1IYSA 2JE5A 3ZG9B 5KZHA 4ZJ1A 1YLJA 1EI5A 3GVBA 5A91A 1J9MA 4FD8A 1HZOA 4KZ7A 1W5DA 3UNWA 1SDNA 3G2YA 3NCKA 1HVBA 3MKEA 3PBSA 2PU4A 1M6KA 4QY6A 3OCNA 4P0MA 3PBQA 2HP6A 5DF7A 2JCHA 4OOMA 4OLDA 4BD0A 2XR0A 4MBHA 1NJ4A 2OLVA 1K57C 1BLCA 4HESA 1GA0A 4FSFA 3W4OA 1YT4A 2RCXA 3DWZA 2FFYA 3LY3A 1K55A 4NK3A 1ESUA 4RX3A 1VQQA 3ZGAB 1JWVA 1VM1A 3M2KA 1CEGA 1ES4A 4E6WA 4WM9A 3Q81A 5CHUA 2Y2GA 3E2LA 1O7EA 5CEDA 3EQUA 4E3KA 1BUEA 5M1AA 1LL9A 1MXOA 1ONHA 3PBTA 3Q82A 5FAPA 1ES2A 2XEPA 2IWCA 2XDMA 3DTMA 2Y2IA 4P85A 1QMEA 3UDXA 1H8YA 3PAEA 1K54C 3HREA 3PTEA 4LV2A 5F83A 1ZKJA 1JWZA 3P98A 3Q7VA 4S2JA 3RJUA 5DF9A 5CGXA 4OPQA 4KG2A 4BD1A 4EQIA 4QU3A 1BZAA 2HDSA 3M2JA 3Q1FA 5EECA 4DF6A 1YM1A 3LO7A 3FZCA 2J8YA 2ZC3B 2WKIA 3G4PA 4OH0A 2WAFA 2XF3A 5E2GA 1YLWA 3WS4A 2Y91A 2R9WA 3IHAA 1K6RA 4X53A 3VP0A 1PW8A 1FSWA 3ZCZA 5EVIC 1OMEA 1K4FA 4ZJ3A 2IWBA 4EBNA 3UPNA 5F1FA 3V39A 3Q7VB 5F82A 1MWTA 2WUQA 4GZBA 1IYQA 1LHYA 4LENA 1BT5A 2Q9MA 4GOGA 4JF4A 1JTGA 1PZOA 5E43A 1KGGA 2A49A 3GQZA 3WS1A 1S6RA 2FFFB 4NETA 4R0QA 4A5RA 1WYCA 4PM7A 4CPKA 4RVAA 4E6XA 2ZQ7A 4QB8A 4XUXA 5E2HA 4ZBEA 4PM9A 3TG9A 3OPLA 4GD8A 1SCWA 4QJGA 2PU2A 1W8YA 2R9XA 3MXRA 3OCLA 3OPHA 4K91A 4LV1A 3M6BA 4RX2A 3UDIA 5A92A 1FCOA 1XP4A 3V3SA 4N9LA 2EX9A 2Z2MB 3AGDA 3FYZA 4OQHA 5E2FA 3UPPA 4EV4A 4D2OA 1K38A 3C7VA 3AGEA 4PM5A 4BL3A 2EFUA 5AQBA 1WE4A 1WYBA 3UN7A 3JYIA 1FR6A 3S1YA 4LV0A 2ZJ9A 3SOIA 2WYXA 4LV3A 2EFXA 1W7FA 4WELA 4S2LA 1DJAA 5HAIA 3WRZA 4E3LA 5HW3A 2WZZA 1KVLA 1PWGA 1MBLA 2C6WB 2P9VA 2Y4AA 3B3XA 3D4FA 3GTCA 4OPRA 1ZC2A 4UA7A 5CGWA 2WGWA 3PAGA 2H0TA 3A3JA 4BQMA 3LCEA 1TVFA 1BLSA 1TEMA 4M3KA 4QHCA 3HUMA 5CHMA 4Q8IA 1KE0A 4UAAA 2HDQA 3UE1A 4OLGA 1EROA 1IYOA 2EX8A 2Y2LA 3VSLA 3BEBA 4OQIA 4UHUA 3LY4A 5DTKA 3SS3A 2ZM2A 3V5MA 3MXSA 4B4ZA 4DRTA 4DXCA 3BFCA 1YLYA 1M40A 1YMSA 3G31A 3O88A 4S2NA 5HX9A 1K56D 3O86A 3MZEA 1RCJA 5EVLA 4PM8A 5E2EA 2P9VB 1XA7A 2QMIA 3HL9A 2WGWB 4MBFA 2B5RA 4OOLA 4KZAA 1FCMA 4K0XA 1PI5A 5DTTA 1MWRA 2UWXA 3DWKA 3IT9A 2Y55A 4KZ8A 4DE3A 1G6AA 4EUZA 1NYMA 1IKGA 1U60A 1MY8A 3A3DA 3UE0A
chains in the Genus database with same CATH superfamily
1YSQA 1MZUA 1L0EA 4OOYA 3RXWA 1IELA 3TSGA 2OV5A 2Z6CA 5AVFA 3VP4A 2X71A 2V20A 4HBUA 4RQ9A 3MFDA 5FDSA 3JVVA 4GN2A 2DMWA 2BLSA 4Y7PA 1GA9A 4WEKA 5DFXA 5KMWA 3MR0A 4RRGA 5KSHA 3UE3A 1NRFA 4HIAA 3DTKA 1QMFA 2ZBBA 3U2AA 3IXDA 4GDBA 2PRFA 3DAVA 3HLGA 3D9YA 3IXGA 3WS2A 3G32A 2QJ7A 4MMNA 1P97A 1YAXA 1NRJA 5FQQA 1ONGA 4MLLA 4JPMA 2I72A 3LI8A 2M7UA 5GHXA 1MPLA 3MMHA 3ZG8B 4R23A 5IU1A 4Z9QA 2HDRA 3QNBA 1XJ4A 5GLBA 1NZUA 4Y2FA 3TRCA 2PR5A 2K31A 3V50A 4RRRA 4WZ5A 1GHMA 3RXXA 2HP5A 3KO4A 4S2OA 2W27A 2HDUA 5A93A 1FSYA 5EE8A 2Y2KA 1N4OA 2Y2QA 2HL0A 1YSPA 2XD5A 3KYZA 3NOPC 3CAXA 3ZVTA 3KO7A 4QWOA 4F3LA 1SDEA 1NXYA 1Q2PA 3T1RA 1XX2A 1IOUA 1GSWA 3QHYA 3PD5A 3QP5A 1XXMA 3KX0X 4NXEA 5FQ9A 3TOIA 3C4OA 4DXBA 5CHJA 3UB8A 4OVDA 4F3LB 2G2UA 3BRMA 4XXRA 2JBFA 2Y59A 2D01A 1OTDA 3MJQA 3P09A 2ZOHA 4LCLA 2Y2MA 5TBMA 3N4IA 5EVIA 4RR8A 2VGJA 3GSGA 5M18A 2G7UA 3MF0A 2UV0E 3PBRA 3CUEA 2XRNA 3SH7A 1VETA 5CECA 4ZDXA 4ZJ2A 5CRFA 1I2WA 4JBFA 1MWUA 4OP8A 5FI7A 5TBMB 3VFHA 3ZNYA 5EVIB 1NY0A 2WGVA 4KQOA 1CK3A 4HQAA 2M7VA 1PYYA 2BG1A 1LL5A 1AXBA 1YQSA 5DTSA 1I2SA 3D72A 1VETB 2VV7A 3BECA 5JYPA 1RGZA 3C5AA 4IEDA 1YKDA 4X69A 1JWPA 3KO9A 5CEBA 2Q9NA 1CI8A 4KUKA 3PBNA 4JF6A 3UB5P 4C3QA 4HJ4A 4JF5A 4R70A 5EFWA 4X25A 4JXSA 4K0WA 4F94A 2OSUA 3T4OA 3MQQA 4RR7A 5HARA 1PWCA 3A0RA 4UA9A 3PBOA 3Q07A 4C75A 4X68A 3AGFA 2OAP1 5FI6A 3C8CA 1GHPA 1JKEA 4GKUA 1K6SA 5DJTA 5CERA 3BFGA 3DW0A 4HP4A 3IX3A 4H8RA 1CEFA 3OPRA 5LBRA 4FH2A 2JC7A 1Z09A 3GR2A 3W8KA 2GX5A 3VOLA 2MJ6A 4R4RA 1VB6A 3HVFA 4HJ6A 4MN5A 2VV8A 1XKZA 2L4RA 1IYPA 4B93A 3IX8A 3HLCA 3LMUA 5FQIA 5KZHA 4ZJ1A 1EI5A 3GVBA 1J9MA 3FC7A 4CLCC 3UNWA 5CX7A 3G2YA 2W3FA 3MKEA 1OJGA 1MKMA 2QYBA 1Y2QA 2O9AA 4P0MA 4ETZA 1A0KA 1WA9A 1GSVA 3ZGAB 1VQQA 5HWTA 4RRKA 3S7QA 3E2LA 5CEDA 3EQUA 4E3KA 5MC7A 3Q82A 1ONHA 3LIFA 1ES2A 2IWCA 3G6OA 2Y2IA 1PNEA 2ACGA 3HREA 4CLCD 1ZKJA 1S4RA 3JVUA 3RJUA 5CGXA 4OPQA 4BD1A 4EQIA 3LO7A 4GHIA 4OH0A 5E2GA 2XF3A 3WS4A 1FSWA 2VZWA 4NEED 3KO3A 3NJAA 1K4FA 2IWBA 3UB7A 3UPNA 3V39A 1IYQA 2PDRA 2A49A 4GHIB 4ZRRA 3E4PA 4RVAA 5HSQA 3U4LP 4PM9A 3TG9A 1S66L 2V1BA 5L2FA 1JNUA 2PU2A 2W1RA 3QP1A 2PHYA 4LV1A 2WKQA 3UDIA 1FCOA 1XP4A 4N9LA 2KDKA 3KYEA 4D2OA 3LEQA 3MQ0A 4I3JA 4QPRA 1FR6A 3R7WA 3VE4A 2WYXA 4LV3A 4S2LA 1DJAA 1IFQA 3V67A 5HAIA 4E3LA 4BBUA 5HW3A 2WZZA 1NLZA 2ZMFA 4UA7A 2C6WB 3B3XA 5CGWA 4UAAA 1ZC2A 2H0TA 2OWJA 3LCEA 1BLSA 1TEMA 1T1AA 4QHCA 3HUMA 1KE0A 3R7WB 4UQIS 3SS3A 3LY4A 3ZQ5A 4II7A 1M40A 3G31A 3O88A 1K56D 3O86A 3IX4A 2V8CA 4PM8A 3T4LA 2QMIA 2CMNA 4OOLA 3JPUA 1J7GA 2JKTM 4DE3A 2VV6A 1W63M 3DTEA 3O5YA 4EETB 3UE0A 2EWVA 4O01A 4MN7A 3BY9A 4Y0UA 4S2MA 5HAPA 2VA0A 4KG5A 2XSSA 1E4DA 1V9ZA 4IUHA 4YFMA 2DBOA 3T12B 4Y0TA 2BASA 4Z1WA 3ITBA 4X55A 3UY6A 2EXBA 3SS4A 3HLWA 1OTBA 1XGJA 5EV0A 5EOEA 1L2SA 1XJ2A 1LL8A 3ZHHA 3N7WA 5CGSA 4HH2A 5JYOA 3IBRA 2A3UA 2PBYA 3MXQA 3SS5A 5HL6A 2HJ9C 3BWLA 4U0TA 1S4SA 1K4EA 1KOUA 1X0OA 1XPBA 3MS6A 4Y3IA 2W3EA 3UPOA 4RRJA 3W2ZA 1OJ5A 4IUKA 3OZHA 3P7NA 1H3QA 3HJKA 1D06A 3VP2A 4E04A 5HL1A 3QP8A 2XK1A 5KSCA 3A3EA 3B33A 1D7EA 3IF6A 2ZC7A 3S7OA 4HJ3A 4PAUA 5FATA 2QHKA 2ZQ8A 2VEAA 2W1TA 2H28A 5EM0A 1FILA 3HLFA 2I9VA 1ZG6A 5M19A 5DVAA 4WUJA 4PKYG 3NDEA 3IF6B 2ZMAA 2ZM0A 5TR7A 4OPYA 4P87A 5AQAA 3IHBA 5DF8A 1ODVA 2GDNA 2GZAA 2W1TB 4BMWA 3UE6A 1ESIA 5J8XA 1CI9A 2P74A 3N6IA 1E25A 2OOLA 2B02A 3OC2A 1MWSA 1K57A 4KZBA 2HPBA 3KO5A 4UQIM 2V1ZA 5HPIA 1XGIA 5EM1A 3T4KA 1S1YA 4EUVA 4E3NA 4PM6A 5F6AA 2VX8A 5L09A 4N9KA 1K54A 4S2NC 1I5QA 3KYQA 3QNCA 1EWZA 4WMCD 3SH8A 4B9OA 1LI9A 1LT0A 4ZAMA 2KX6A 4RA7A 3WS5A 3H82A 1DP9A 2PYPA 2B18A 3B47A 3EGXC 2VKSA 4WEJA 1BULA 5HDDA 2DCFA 3FPVA 4MCWA 4OQGA 4Q0IA 2AVXA 4B88A 5FQMA 3MQOA 3H82B 1TDGA 4KZ6A 3BM6A 2HJEA 1T1CA 5A90A 5EVEA 4RRLA 3F1OA 1LI0A 2HP9A 3SW1A 3NDGA 4KZ4A 2J7VA 1PWDA 5FAQA 1XJ6A 3ZDJA 5EUAA 4P6ZS 4RYEA 3D3OA 3GV9A 4JLFA 2QZ6A 3S4XA 2KLIA 5AVEA 2J9PA 3IWOA 3F1OB 3UO9A 3BQ8A 4DE0A 3NHQA 4ME4A 4Y13A 5FA7A 5FQKA 1AWIA 2H10A 5CTNA 3LI9A 1VHMA 3TE8A 3N8LA 2OWHA 2X01A 1H5XA 1C3BA 3UDFA 5CXWA 4KQDA 3T1XA 4R38A 1CF0A 4EBLA 3FG8A 4DE1A 4QY5A 1PFLA 4LCMA 4WBGA 1N9NA 2H5SA 4EEUA 2Y2PA 1Y54A 3Q7ZA 3KODA 2PD7A 3TJZC 5J61A 3IWQA 1PIOA 4WZ5C 1GCEA 4N1XA 1DJBA 3GMWA 2Y2HA 2ZL1A 3C38A 4RRAA 1IKIA 1HTZA 1OT9A 2WZXA 4BLMA 4GD6A 5AJGA 4DDSA 2L1MA 3NBLA 1IYSA 2Y8HA 3PHYA 5A8BA 5A91A 3OOVA 4KZ7A 2ZL1B 1HVBA 4YWZA 2PU4A 4HI4A 4QY6A 3OCNA 2HP6A 3KSGA 2JCHA 4OOMA 4Y17A 4OLDA 2XR0A 1NJ4A 3KNFA 3A0VA 1BLCA 1EW0A 3CLOA 4YOFA 3W4OA 2RCXA 3DWZA 1K55A 1ESUA 1JWVA 3Q81A 3IS2A 3R4KA 4RRMA 2XEPA 3OLOA 2FH5A 4RR9A 4X1LA 1TS0A 1H8YA 3NOTC 4RRIA 3LMTA 4LV2A 1JWZA 3Q7VA 4KG2A 5HWVA 3M2JA 3Q1FA 5EECA 3FZCA 2ZC3B 3IS2B 3DBAA 4JGPA 2R9WA 5C5KA 1PW8A 5EVIC 1FIKA 2YKHA 4IHQA 1W63Q 4EBNA 5F1FA 3Q7VB 5F82A 1BYWA 3CUEC 4JF4A 1JTGA 1PZOA 5E43A 4WF0A 3WS1A 4A5RA 3EGDC 3IBJA 2ZQ7A 4QJGA 3OCLA 1W8YA 4XT2A 3MXRA 5G4YA 3M6BA 5A92A 2JKRM 2Z2MB 3AGDA 4OQHA 5E2FA 4FUWA 4LV0A 1S67L 1V9YA 4K08A 2V9AA 2P7JA 3D4FA 1PWGA 1TS7A 2Y4AA 4XT2B 5I5LA 5L8MA 2WGWA 4GW9A 5DJUA 4RRQA 4M3KA 5CHMA 1EROA 1IYOA 2Y2LA 3BEBA 4CLCA 3BFCA 5HX9A 4LRXC 3MZEA 4RRBA 2V0UA 2WGWB 3T4SA 1FCMA 4K0XA 1MWRA 2UWXA 3LMVA 3IT9A 2Y55A 3PD3A 1IKGA 4CLCB 3H9WA 1KDSA 4E3IA 4KUOA 5FQJA 1SHVA 2J3TC 3BLMA 4MBKA 1BTLA 3W4PA 2QPNA 3VE3A 1PZPA 3LYXA 4RRFA 5HAQA 3VMAA 4KQQA 4EWFA 1KGEA 3RFBA 4JXWA 4HHDA 3G35A 1YPRA 3CG5A 3C4PA 1ZHHB 3FKWA 5HD5A 4DMZA 5TFQA 3UB6A 4JGRA 5HWWA 4D60A 3NI9A 1K56A 4FH4A 2VGLS 3O3VA 4KZ3A 3WRTA 4KENB 2EX2A 1PI4A 3EWKA 5L10A 3N8SA 2Z6DA 1BLHA 2ZLYA 4RRHA 2W3DA 1L3LA 4IBRA 4R3JA 2PAVP 3GECA 4I3IA 3HUNA 2JKTI 4CJNA 2XQZA 3VFFA 3A3IA 2A24A 2VJWA 3IXHA 4R3BA 4OP5A 4S02A 4MN6A 2ZOIA 2XH9A 1N9LA 4BL2A 4GNUA 5TJJA 1KDWA 3M6HA 4NBJA 4X56A 3LEZA 2X02A 2Y2JA 4YINA 2A24B 2JKFA 1NYYA 5D3OA 1ACFA 3IF5A 4L9EA 4AFIA 1OPXA 3F1PA 1P9WA 2M1CA 3HJIA 3EOIA 3VOZA 2JKGA 2KOIA 3KNPA 5DKLA 4S0KA 1HD8A 1DRMA 1S0WA 4IVIA 2HL2A 4ESPA 2GJ3A 4PPRA 2WAEA 1GHIA 1DP6A 3PD2A 2D02A 4FOFA 3BLSA 3NIAA 3F1PB 3FPWA 4S03A 3MKFA 1TS6A 4S0LA 4HEFA 4CQHA 2K7SA 5KIZA 1W8QA 4JXGA 3E4QA 5FASA 3LGOA 1UWNX 4N1HA 1S1ZA 1W79A 4E3MA 4R4SA 3LR4A 1NZOA 2E8JA 5I94A 3G34A 5FEGA 5HDCA 4S2KA 4JGQA 2DRWA 4LGWA 2V8FA 2HF6A 4WN5A 2C5WB 4BENA 4WYYA 4DKIA 3BFEA 2ZC4B 1E3UD 2RL3A 3BFDA 3HLBA 3ITAA 4GS9A 1H8MA 2WKEA 2Y2NA 3ZG0A 2QJ5A 5AQ9A 1NLYA 3BFFA 3VSKA 5IHVA 3OPPA 3G30A 4P6BA 5FAOA 4EU0A 3WS0A 1O07A 5GLAA 2V2FF 3IH8A 3K3CA 5DFYA 4O7DA 5IS1A 2VK3A 2VGLM 1SKOA 1OT6A 5J7EA 5HZHA 1DJCA 1XFQA 2INWA 4GS9B 4HP9A 3VOYA 3LR0A 4FCFA 3EQVA 3IQAA 4S2PA 4WMCA 3PXPA 1YMXA 5J4EA 4L0LA 4GLQA 2W3GA 4QD4A 1KE4A 5G18A 4OQ0A 1SKOB 4JXVA 1TC5A 2EX6A 3IF6C 4KZ9A 1ES5A 1YLZA 3PR6A 1JTDA 3I7JA 4HBTA 5J3WA 2VGKA 3C30A 2XLNA 4IBXA 4KQRA 1TDLA 3KOBA 3A3FA 1LSVA 4IVKA 2P08A 3KSFA 3FV7A 2WADA 4DJ2A 4S2IA 5IT5A 3SH9A 2W0NA 2Y79A 2JE5A 1TS8A 2HKZA 4I39A 3RTYA 4G3VA 4FD8A 1SDNA 3L7HA 3PBSA 3QP6A 1M6KA 4S0JA 5DF7A 1LSXA 1F2KA 1Y28A 3LIDA 4GJ4A 3T50A 3E98A 4CLCE 2OLVA 1K57C 3CPTA 4HESA 1GA0A 4FSFA 1YT4A 3L9KA 3EEAA 4NK3A 4RX3A 5HD3A 1G6OA 3M2KA 1CEGA 1ZTUA 4E6WA 4WM9A 5CHUA 4Y5FA 1O7EA 1BUEA 5M1AA 4NXGA 1GSXA 2B95A 3K3DA 3PBTA 4NKPA 5HDSA 2XDMA 3DTMA 4P85A 1OTAA 1SZVA 2O9BA 2R78A 3UDXA 3PAEA 1K54C 3PTEA 3CPTB 2QWSA 2LB5A 3P98A 4G3WA 4S2JA 1BZAA 2HDSA 4DF6A 4WL9A 2WKIA 3IHAA 1K6RA 3VP0A 3ZCZA 4ZJ3A 4EW7A 1MWTA 2WUQA 4GZBA 1LHYA 4LENA 1BT5A 2Q9MA 4GOGA 2J3WA 3GQZA 1S6RA 3DTIA 4NETA 1XJ3A 4CPKA 4QB8A 4XUXA 1SCWA 3BW6A 4RX2A 2XROA 2PD8A 2EX9A 3FYZA 3UPPA 1K38A 3C7VA 2OAQ1 3LR3A 2EFUA 5AQBA 1WYBA 3JYIA 3S1YA 4L9GA 2ZJ9A 3SOIA 4MDZA 1W7FA 4WELA 4YNRA 3NULA 3WRZA 2HGVA 3GTCA 2P9VA 3BJNA 2O9CA 4L9FA 3QP2A 3UMDA 3LFVA 4BBTA 3UE1A 2HDQA 2EX8A 5DTKA 4B4ZA 2ZM2A 3PYPA 3MXSA 1F98A 4Y15A 4DXCA 1YLYA 1YMSA 3F1NA 5EVLA 2P9VB 3HL9A 4MBFA 3S7NA 1PI5A 3ICYA 5DTTA 3DWKA 3BQAA 4KZ8A 2J80A 1G6AA 4EUZA 1F5MA 1MY8A 1U60A 5FDHA 4B4XA 3F1NB 5EOOA 4HOIA 4PKYA 1N9OA 1Y4OA 4GB7A 2ZQ9A 5BOHA 3V3RA 3IWIA 3BY8A 4HNBA 1HLUP 3CHWP 3SZTA 4KZ5A 2WK0A 3O87A 5FSRA 5CTMA 3MZDA 1LSWA 2ZMVA 3IH9A 5F5YA 3GRJA 4N92A 1SKFA 4MNRA 2JKRI 1MC0A 4Q0HA 4Q0JA 2ZC5B 4DJ3A 1L0FA 2Y2OA 4BJPA 1RP5A 5K5BA 1G68A 4FTXA 3ZG5A 3FWLA 1K55C 1MKIA 1YLTA 3HLEA 4UA6A 2W3HA 1L0DA 2XD1A 2ZQCA 1G28A 5F1GA 4EBPA 3E0YA 3VP3A 4NG2A 4EQ1A 1KVMA 3CJMA 3ZG7B 3G2ZA 5F69A 3QP4A 1YLPA 3B42A 4P6ZM 3HLDA 4WZ4A 2ZQDA 1T1BA 1TF1A 2JN7A 1DP8A 5FL3A 3CMZA 3WWXA 1FR1A 1RGYA 4GDNA 1J3WA 4H6JA 5EVID 1JVJA 4R6LA 2G2WA 2HZ5A 3LICA 2QKPA 2IWDA 4ID4A 3ISGA 3ZNTA 4DE2A 4JGOA 2WKPA 4U3TA 4S0IA 4NXBA 1KGFA 4DDYA 2O99A 4H6JB 5GHZA 2BTFP 4UEYA 3C2WA 1N9BA 4C6YA 3NC8A 1FOFA 1H8ZA 1OTIA 4O8GA 4HY8A 2OKVA 1UGUA 3A0SA 2JHEA 4U0XA 5GL9A 2J9OA 3CITA 3C7UA 1PW1A 1ZG4A 2EWWA 2NUTC 2IA2A 5FEFA 3UB9A 1Q2QA 2OLUA 4MEZA 3FKVA 4R3AA 2XFSA 1BLPA 3ZVWA 5G4ZA 3T4JA 1ERMA 1CQAA 1KE3A 3CWFA 4R1GA 1LLBA 1PRQA 2DNSA 1L0GA 2WKHA 5TGFA 5HPFA 3KSIA 1ES3A 1STZA 4PMAA 3KSHA 3E2KA 4KG6A 1VEUA 5GLDA 4EERA 2A2LA 4LFUA 4LRZE 3W4QA 4RRCA 2PR6A 5EPHA 3HCYA 4E3OA 2ZC6B 2J3TD 2YKFA 5GLCA 1VEUB 4OONA 4DN0A 2XA7S 4XUZA 5HFOA 2WGIA 3RH8B 3MBZA 4O0PA 1UWPX 4NXFA 1ALQA 4OPZA 2ZQAA 2FZ0A 1CJFA 4X1MA 5GHYA 4Y0OA 3IXBA 5AQ7A 2H0YA 2ZM8A 1XA1A 4NBIA 3NY4A 1ERQA 4IJGA 3EEHA 2V1AA 2XGNA 4HH3A 4ARZA 3VV4A 2E8IA 3P01A 3KO6A 4X6TA 4LPZA 1K25A 2EXAA 1FQGA 5U47A 3K2NA 3VP1A 2Z2LB 4OKPA 1FCNA 3MZFA 3HUOA 4ZTKA 4JKTA 4BWIA 1P9RA 4ARZB 1IEMA 2ZD8A 2CC1A 3LIBA 3S22A 2HV1A 5F68A 3CZDA 1BSGA 1G5UA 3ZYTA 5FI2A 3HBRA 1Z6FA 1D1JA 4BBVA 1DY6A 2XFTA 3BYDA 3N8RA 1E3UA 3ZFZA 4E3JA 2K2NA 3ZG9B 1YLJA 4PHTA 1HZOA 3UMEA 1W5DA 2Q0OA 3NOUC 3NCKA 5L07A 3E4OA 1OTEA 3PBQA 4GCZA 2PYRA 4BD0A 4MBHA 3T4QA 3H7WA 1T19A 2FFYA 3LY3A 1K0KA 2PT7A 3T1SA 1VM1A 3ULFA 1ES4A 1NWZA 2Y2GA 1LL9A 1MXOA 5FAPA 5DKKA 1QMEA 3H7WB 3S7PA 1F9IA 5F83A 3PD4A 5DF9A 4QU3A 1YM1A 2J8YA 3G4PA 2NUPC 2WAFA 1YLWA 3LR5A 2Y91A 4I3AA 4X53A 2WKRA 3TW8A 4LRYC 1OMEA 4RR6A 4I38A 2XA7M 3MSHA 3NECA 1KGGA 2FFFB 4R0QA 1WYCA 4PM7A 4E6XA 3T1QB 5E2HA 4ZBEA 3OPLA 4GD8A 3OPHA 4K91A 2R9XA 1H0MA 3V3SA 3LIEA 4ETXA 4EV4A 4M4XA 2LB9A 3AGEA 4PM5A 4BL3A 4EEPA 1WE4A 3T4TA 3UN7A 3OBFA 1TD5A 3LUQA 4G3KA 2V0WA 4WLAA 2EFXA 3MFXA 2P04A 4RRDA 1KVLA 1MBLA 4OPRA 2HL1A 3PAGA 1XFNA 3A3JA 4BQMA 1TVFA 1T18A 4Q8IA 4OLGA 3VSLA 2GNXA 4OQIA 4UHUA 3V5MA 4EXOA 4LLOB 4DRTA 2VLGA 3LIAA 4S2NA 4I5SA 1P0ZA 1RCJA 5E2EA 1XA7A 2O0YA 4EESA 2B5RA 4KZAA 3KOCA 2L0WA 3CI6A 2EA9A 2PBDP 1NYMA 3GDIA 3A3DA
chains in the Genus database with same CATH topology
5FDHA 4B4XA 1L0EA 4OOYA 1KDSA 4E3IA 3RXWA 5EOOA 1IELA 4Y0UA 4S2MA 3TSGA 3KO9A 5HAPA 4GB7A 2ZQ9A 5FQJA 4KG5A 5BOHA 3V3RA 1E4DA 2OV5A 3IWIA 1SHVA 4YFMA 2DBOA 3VP4A 2X71A 3BLMA 2V20A 4HBUA 4MBKA 1BTLA 3MFDA 4Y0TA 3W4PA 2QPNA 3ITBA 4X55A 3UY6A 1PZPA 4KZ5A 2WK0A 4RRFA 3O87A 2EXBA 5FSRA 5HAQA 3SS4A 3HLWA 3VMAA 4KQQA 5CTMA 1XGJA 3MZDA 5EOEA 4GN2A 1L2SA 4EWFA 2BLSA 3IH9A 4Y7PA 1GA9A 4WEKA 3ZHHA 5KMWA 1KGEA 3GRJA 3N7WA 4N92A 5CGSA 1SKFA 4MNRA 4RRGA 4JXWA 5KSHA 3UE3A 1NRFA 3G35A 5JYOA 2A3UA 3CG5A 1QMFA 3C4PA 2PBYA 3FKWA 2ZC5B 3IXDA 1L0FA 2Y2OA 4GDBA 5TFQA 4BJPA 1RP5A 3HLGA 3SS5A 1G68A 3IXGA 3ZG5A 3WS2A 3FWLA 1K55C 1MKIA 3G32A 4U0TA 1K4EA 1YLTA 3HLEA 4UA6A 1XPBA 3NI9A 5FQQA 1ONGA 1L0DA 4MLLA 2XD1A 2ZQCA 1K56A 4FH4A 4JPMA 2I72A 5F1GA 3O3VA 4EBPA 3UPOA 4KZ3A 3WRTA 4KENB 3VP3A 4RRJA 3OZHA 2EX2A 5GHXA 1PI4A 1MPLA 3ZG8B 3VP2A 1KVMA 3CJMA 4R23A 4Z9QA 3ZG7B 2XK1A 5HL1A 5KSCA 3G2ZA 2HDRA 3N8SA 1YLPA 3A3EA 3HLDA 1BLHA 2ZLYA 2ZQDA 4WZ4A 4RRHA 3QNBA 3IF6A 5GLBA 4IBRA 1NZUA 2ZC7A 4R3JA 3CMZA 3WWXA 5FATA 1FR1A 3HUNA 3V50A 4RRRA 4WZ5A 1GHMA 3RXXA 1RGYA 2HP5A 4GDNA 3KO4A 2ZQ8A 1JVJA 5EVID 4CJNA 4S2OA 2G2WA 2XQZA 3HLFA 2HDUA 3VFFA 3A3IA 5A93A 1ZG6A 1FSYA 5EE8A 2IWDA 4ID4A 5M19A 5DVAA 3ISGA 2Y2KA 3ZNTA 1N4OA 3IXHA 4DE2A 3NDEA 3IF6B 4R3BA 2ZMAA 4OP5A 4S02A 2ZM0A 2Y2QA 5TR7A 2XH9A 2HL0A 4U3TA 4BL2A 4OPYA 4P87A 4S0IA 4GNUA 1KGFA 5AQAA 3IHBA 5DF8A 4DDYA 1KDWA 2GDNA 3M6HA 4NBJA 5GHZA 2XD5A 4X56A 1ESIA 1N9BA 3LEZA 4C6YA 2X02A 5J8XA 3NC8A 1CI9A 2Y2JA 2P74A 4YINA 3ZVTA 1FOFA 3KO7A 1H8ZA 1E25A 1NYYA 3N6IA 3OC2A 5D3OA 2OKVA 1SDEA 1MWSA 3IF5A 1NXYA 4U0XA 5GL9A 2J9OA 1K57A 4KZBA 1Q2PA 3C7UA 1XX2A 2HPBA 3KO5A 1PW1A 1ZG4A 3QHYA 3PD5A 2V1ZA 1XGIA 3VOZA 1XXMA 1Q2QA 3KNPA 2OLUA 4MEZA 4S0KA 1HD8A 5FQ9A 3FKVA 3TOIA 2XFSA 1S0WA 1BLPA 3C4OA 4IVIA 2HL2A 4DXBA 3ZVWA 4PPRA 2WAEA 5CHJA 1GHIA 4E3NA 4PM6A 3PD2A 1ERMA 4OVDA 1KE3A 4N9KA 2G2UA 3BRMA 3BLSA 4R1GA 1K54A 3NIAA 4XXRA 1LLBA 2DNSA 4S2NC 2JBFA 3MKFA 2Y59A 1I5QA 4S03A 4S0LA 4HEFA 3QNCA 1L0GA 1EWZA 4WMCD 2WKHA 5TGFA 3SH8A 1LI9A 4ZAMA 1W8QA 1ES3A 4PMAA 4RA7A 4JXGA 3WS5A 3E2KA 4KG6A 3P09A 5FASA 5GLDA 4LCLA 2Y2MA 4N1HA 4WEJA 3N4IA 5EVIA 1BULA 1W79A 4RR8A 4E3MA 4R4SA 5L2FA 2VGJA 2DCFA 3GSGA 1NZOA 3W4QA 5M18A 4RRCA 5I94A 4OQGA 4B88A 3G34A 5EPHA 5FQMA 3PBRA 4S2KA 2DRWA 3SH7A 4E3OA 2ZC6B 1TDGA 4KZ6A 3BM6A 2C5WB 5GLCA 4OONA 4BENA 5CECA 4ZDXA 4ZJ2A 4WYYA 5CRFA 4XUZA 4DKIA 5A90A 1I2WA 4JBFA 1MWUA 4OP8A 5FI7A 5HFOA 3VFHA 3ZNYA 4RRLA 3BFEA 2ZC4B 5EVIB 1NY0A 2WGVA 4KQOA 2WGIA 1LI0A 2HP9A 1CK3A 3MBZA 1E3UD 3NDGA 4KZ4A 2RL3A 3BFDA 2J7VA 1PYYA 2BG1A 1PWDA 1LL5A 5FAQA 1AXBA 3HLBA 1YQSA 3ITAA 5DTSA 3ZDJA 2WKEA 1I2SA 2Y2NA 5EUAA 5AQ9A 1ALQA 4OPZA 3ZG0A 3BFFA 3BECA 2ZQAA 3VSKA 5IHVA 4RYEA 3GV9A 3OPPA 5JYPA 4JLFA 5GHYA 1RGZA 2QZ6A 4Y0OA 3C5AA 3G30A 4IEDA 3S4XA 4P6BA 1JWPA 4X69A 5FAOA 5CEBA 3IXBA 3WS0A 1O07A 5GLAA 2Q9NA 2J9PA 2V2FF 1CI8A 3IH8A 3IWOA 5AQ7A 2H0YA 4O7DA 3UO9A 2ZM8A 1XA1A 4NBIA 3PBNA 4JF6A 4C3QA 4DE0A 3NY4A 1ERQA 4JF5A 5FA7A 5FQKA 2H10A 5CTNA 1DJCA 2XGNA 4JXSA 4K0WA 4F94A 2OSUA 2E8IA 3VOYA 3N8LA 4X6TA 2X01A 1H5XA 4FCFA 4RR7A 5HARA 3EQVA 1C3BA 1K25A 1PWCA 2EXAA 3IQAA 4S2PA 4WMCA 1FQGA 5CXWA 3UDFA 1YMXA 4UA9A 3PBOA 3Q07A 5U47A 4C75A 4X68A 3AGFA 3VP1A 2Z2LB 5FI6A 4EBLA 1GHPA 4L0LA 1JKEA 4GKUA 5J61A 4QD4A 1KE4A 1K6SA 4OKPA 1FCNA 5G18A 3MZFA 4OQ0A 4JXVA 3HUOA 5CERA 3BFGA 4QY5A 4ZTKA 4DE1A 3DW0A 1TC5A 4JKTA 4LCMA 4WBGA 4H8RA 2H5SA 1CEFA 2EX6A 3IF6C 1IEMA 1ES5A 2ZD8A 2CC1A 3OPRA 4KZ9A 1YLZA 2Y2PA 1JTDA 1Y54A 3I7JA 3Q7ZA 3S22A 4HBTA 3KODA 2VGKA 4FH2A 2JC7A 2XLNA 3IWQA 1PIOA 3GR2A 4IBXA 1GCEA 4KQRA 4WZ5C 3W8KA 3CZDA 1TDLA 4N1XA 1DJBA 4R4RA 1BSGA 3HVFA 3KOBA 3A3FA 4IVKA 3GMWA 5FI2A 2Y2HA 2WADA 1XKZA 3FV7A 3HBRA 1Z6FA 4RRAA 1IKIA 1DY6A 1HTZA 1IYPA 2XFTA 4S2IA 3BYDA 2WZXA 3SH9A 3N8RA 4BLMA 3HLCA 4GD6A 4DDSA 1E3UA 3ZFZA 3LMUA 5FQIA 3NBLA 4E3JA 1IYSA 2JE5A 3ZG9B 5KZHA 4ZJ1A 1YLJA 2HKZA 1EI5A 3GVBA 5A91A 1J9MA 4FD8A 1HZOA 4KZ7A 1W5DA 3UNWA 1SDNA 3G2YA 3NCKA 1HVBA 3MKEA 3PBSA 2PU4A 1M6KA 4QY6A 1Y2QA 3OCNA 4P0MA 4S0JA 3PBQA 2HP6A 5DF7A 2JCHA 4OOMA 4OLDA 4BD0A 2XR0A 4MBHA 1NJ4A 2OLVA 3KNFA 1K57C 1BLCA 4HESA 1GA0A 4FSFA 3W4OA 1YT4A 2RCXA 3DWZA 2FFYA 3LY3A 1K55A 4NK3A 1ESUA 4RX3A 1VQQA 3ZGAB 4RRKA 1JWVA 1VM1A 3M2KA 1CEGA 1ES4A 4E6WA 4WM9A 3Q81A 5CHUA 2Y2GA 3E2LA 1O7EA 5CEDA 3EQUA 4E3KA 1BUEA 5M1AA 4RRMA 1LL9A 1MXOA 1ONHA 3PBTA 3Q82A 5FAPA 1ES2A 2XEPA 2IWCA 2XDMA 3DTMA 2Y2IA 4P85A 4RR9A 1QMEA 3UDXA 1H8YA 3PAEA 4RRIA 1K54C 3HREA 3LMTA 3PTEA 4LV2A 5F83A 1ZKJA 3PD4A 1JWZA 3P98A 3Q7VA 4S2JA 3RJUA 5DF9A 5CGXA 4OPQA 4KG2A 4BD1A 4EQIA 4QU3A 1BZAA 2HDSA 3M2JA 3Q1FA 5EECA 4DF6A 1YM1A 3LO7A 3FZCA 2J8YA 2ZC3B 2WKIA 3G4PA 4OH0A 2WAFA 2XF3A 5E2GA 1YLWA 3WS4A 2Y91A 2R9WA 3IHAA 1K6RA 4X53A 3VP0A 1PW8A 1FSWA 3ZCZA 5EVIC 1OMEA 4RR6A 3KO3A 1K4FA 4ZJ3A 2IWBA 4EBNA 3UPNA 5F1FA 3V39A 3Q7VB 5F82A 1MWTA 2WUQA 4GZBA 1IYQA 1LHYA 4LENA 1BT5A 2Q9MA 4GOGA 4JF4A 1JTGA 1PZOA 5E43A 1KGGA 2A49A 3GQZA 3WS1A 1S6RA 2FFFB 4NETA 4R0QA 4A5RA 1WYCA 4PM7A 4CPKA 4RVAA 4E6XA 2ZQ7A 4QB8A 4XUXA 5E2HA 4ZBEA 4PM9A 3TG9A 3OPLA 4GD8A 1SCWA 4QJGA 2PU2A 1W8YA 2R9XA 3MXRA 3OCLA 3OPHA 4K91A 4LV1A 3M6BA 4RX2A 3UDIA 5A92A 1FCOA 1XP4A 3V3SA 4N9LA 2EX9A 2Z2MB 3AGDA 3FYZA 4OQHA 5E2FA 3UPPA 4EV4A 4D2OA 1K38A 3C7VA 3AGEA 4PM5A 4BL3A 2EFUA 5AQBA 1WE4A 1WYBA 3UN7A 3JYIA 1FR6A 3S1YA 4LV0A 2ZJ9A 3SOIA 2WYXA 4LV3A 2EFXA 1W7FA 4WELA 4S2LA 1DJAA 5HAIA 4RRDA 3WRZA 4E3LA 5HW3A 2WZZA 1KVLA 1PWGA 1MBLA 2C6WB 2P9VA 2Y4AA 3B3XA 3D4FA 3GTCA 4OPRA 1ZC2A 4UA7A 5CGWA 2HL1A 2WGWA 3PAGA 2H0TA 3A3JA 4BQMA 3LCEA 1TVFA 1BLSA 1TEMA 4RRQA 4M3KA 4QHCA 3HUMA 5CHMA 4Q8IA 1KE0A 4UAAA 2HDQA 3UE1A 4OLGA 1EROA 1IYOA 2EX8A 2Y2LA 3VSLA 3BEBA 4OQIA 4UHUA 3LY4A 5DTKA 3SS3A 2ZM2A 3V5MA 3MXSA 4B4ZA 4DRTA 4DXCA 3BFCA 1YLYA 1M40A 1YMSA 3G31A 3O88A 4S2NA 5HX9A 1K56D 3O86A 3MZEA 1RCJA 5EVLA 4PM8A 5E2EA 2P9VB 4RRBA 1XA7A 2QMIA 3HL9A 2WGWB 4MBFA 2B5RA 4OOLA 4KZAA 3KOCA 1FCMA 4K0XA 1J7GA 1PI5A 5DTTA 1MWRA 2UWXA 3DWKA 3LMVA 3IT9A 2Y55A 4KZ8A 4DE3A 1G6AA 3PD3A 4EUZA 1NYMA 1IKGA 1U60A 1MY8A 3A3DA 3UE0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FDH A;  4B4X A;  1L0E A;  4OOY A;  1KDS A;  4E3I A;  3RXW A;  5EOO A;  1IEL A;  4Y0U A;  4S2M A;  3TSG A;  5HAP A;  4GB7 A;  2ZQ9 A;  5FQJ A;  4KG5 A;  5BOH A;  3V3R A;  1E4D A;  2OV5 A;  3IWI A;  1SHV A;  4YFM A;  3VP4 A;  2X71 A;  3BLM A;  2V20 A;  4HBU A;  4MBK A;  1BTL A;  3MFD A;  4Y0T A;  3W4P A;  2QPN A;  3ITB A;  4X55 A;  3UY6 A;  1PZP A;  4KZ5 A;  2WK0 A;  3O87 A;  2EXB A;  5FSR A;  5HAQ A;  3SS4 A;  3HLW A;  3VMA A;  4KQQ A;  5CTM A;  1XGJ A;  3MZD A;  5EOE A;  4GN2 A;  1L2S A;  4EWF A;  2BLS A;  3IH9 A;  4Y7P A;  1GA9 A;  4WEK A;  3ZHH A;  5KMW A;  1KGE A;  3GRJ A;  3N7W A;  4N92 A;  5CGS A;  1SKF A;  4MNR A;  4JXW A;  5KSH A;  3UE3 A;  1NRF A;  3G35 A;  5JYO A;  2A3U A;  3CG5 A;  1QMF A;  3C4P A;  2PBY A;  3FKW A;  2ZC5 B;  3IXD A;  1L0F A;  2Y2O A;  4GDB A;  5TFQ A;  4BJP A;  1RP5 A;  3HLG A;  3SS5 A;  1G68 A;  3IXG A;  3ZG5 A;  3WS2 A;  3FWL A;  1K55 C;  1MKI A;  3G32 A;  4U0T A;  1K4E A;  1YLT A;  3HLE A;  4UA6 A;  1XPB A;  3NI9 A;  5FQQ A;  1ONG A;  1L0D A;  4MLL A;  2XD1 A;  2ZQC A;  1K56 A;  4FH4 A;  4JPM A;  2I72 A;  5F1G A;  3O3V A;  4EBP A;  3UPO A;  4KZ3 A;  3WRT A;  4KEN B;  3VP3 A;  3OZH A;  2EX2 A;  5GHX A;  1PI4 A;  1MPL A;  3ZG8 B;  3VP2 A;  1KVM A;  3CJM A;  4R23 A;  4Z9Q A;  3ZG7 B;  2XK1 A;  5HL1 A;  5KSC A;  3G2Z A;  2HDR A;  3N8S A;  1YLP A;  3A3E A;  3HLD A;  1BLH A;  2ZLY A;  2ZQD A;  4WZ4 A;  3QNB A;  3IF6 A;  5GLB A;  4IBR A;  1NZU A;  2ZC7 A;  4R3J A;  3CMZ A;  3WWX A;  5FAT A;  1FR1 A;  3HUN A;  3V50 A;  4WZ5 A;  1GHM A;  3RXX A;  1RGY A;  2HP5 A;  4GDN A;  2ZQ8 A;  1JVJ A;  5EVI D;  4CJN A;  4S2O A;  2G2W A;  2XQZ A;  3HLF A;  2HDU A;  3VFF A;  3A3I A;  5A93 A;  1ZG6 A;  1FSY A;  5EE8 A;  2IWD A;  4ID4 A;  5M19 A;  5DVA A;  3ISG A;  2Y2K A;  3ZNT A;  1N4O A;  3IXH A;  4DE2 A;  3NDE A;  3IF6 B;  4R3B A;  2ZMA A;  4OP5 A;  2ZM0 A;  2Y2Q A;  5TR7 A;  2XH9 A;  4U3T A;  4BL2 A;  4OPY A;  4P87 A;  4GNU A;  1KGF A;  5AQA A;  3IHB A;  5DF8 A;  4DDY A;  1KDW A;  2GDN A;  3M6H A;  5GHZ A;  2XD5 A;  4X56 A;  1ESI A;  1N9B A;  3LEZ A;  4C6Y A;  2X02 A;  5J8X A;  3NC8 A;  1CI9 A;  2Y2J A;  2P74 A;  4YIN A;  3ZVT A;  1FOF A;  1H8Z A;  1E25 A;  1NYY A;  3N6I A;  3OC2 A;  5D3O A;  1SDE A;  1MWS A;  3IF5 A;  1NXY A;  4U0X A;  5GL9 A;  2J9O A;  1K57 A;  4KZB A;  1Q2P A;  3C7U A;  1XX2 A;  2HPB A;  1PW1 A;  1ZG4 A;  3QHY A;  2V1Z A;  1XGI A;  3VOZ A;  1XXM A;  1Q2Q A;  2OLU A;  4MEZ A;  1HD8 A;  5FQ9 A;  3FKV A;  3TOI A;  2XFS A;  1S0W A;  1BLP A;  3C4O A;  4IVI A;  4DXB A;  3ZVW A;  4PPR A;  2WAE A;  5CHJ A;  1GHI A;  4E3N A;  4PM6 A;  1ERM A;  4OVD A;  1KE3 A;  4N9K A;  2G2U A;  3BRM A;  3BLS A;  4R1G A;  1K54 A;  3NIA A;  4XXR A;  1LLB A;  2DNS A;  4S2N C;  2JBF A;  3MKF A;  2Y59 A;  1I5Q A;  4HEF A;  3QNC A;  1L0G A;  1EWZ A;  4WMC D;  2WKH A;  5TGF A;  3SH8 A;  1LI9 A;  4ZAM A;  1W8Q A;  1ES3 A;  4PMA A;  4RA7 A;  4JXG A;  3WS5 A;  3E2K A;  4KG6 A;  3P09 A;  5FAS A;  5GLD A;  4LCL A;  2Y2M A;  4N1H A;  4WEJ A;  3N4I A;  5EVI A;  1BUL A;  1W79 A;  4E3M A;  4R4S A;  5L2F A;  2VGJ A;  2DCF A;  3GSG A;  1NZO A;  3W4Q A;  5M18 A;  5I94 A;  4OQG A;  4B88 A;  3G34 A;  5EPH A;  5FQM A;  3PBR A;  4S2K A;  2DRW A;  3SH7 A;  4E3O A;  2ZC6 B;  1TDG A;  4KZ6 A;  3BM6 A;  2C5W B;  5GLC A;  4OON A;  4BEN A;  5CEC A;  4ZDX A;  4ZJ2 A;  4WYY A;  5CRF A;  4XUZ A;  4DKI A;  5A90 A;  1I2W A;  4JBF A;  1MWU A;  4OP8 A;  5FI7 A;  5HFO A;  3VFH A;  3ZNY A;  3BFE A;  2ZC4 B;  5EVI B;  1NY0 A;  2WGV A;  4KQO A;  2WGI A;  1LI0 A;  2HP9 A;  1CK3 A;  3MBZ A;  1E3U D;  3NDG A;  4KZ4 A;  2RL3 A;  3BFD A;  2J7V A;  1PYY A;  2BG1 A;  1PWD A;  1LL5 A;  5FAQ A;  1AXB A;  3HLB A;  1YQS A;  3ITA A;  5DTS A;  3ZDJ A;  2WKE A;  1I2S A;  2Y2N A;  5EUA A;  5AQ9 A;  1ALQ A;  4OPZ A;  3ZG0 A;  3BFF A;  3BEC A;  2ZQA A;  3VSK A;  5IHV A;  4RYE A;  3GV9 A;  3OPP A;  5JYP A;  4JLF A;  5GHY A;  1RGZ A;  2QZ6 A;  4Y0O A;  3C5A A;  3G30 A;  4IED A;  3S4X A;  4P6B A;  1JWP A;  4X69 A;  5FAO A;  5CEB A;  3IXB A;  3WS0 A;  1O07 A;  5GLA A;  2Q9N A;  2J9P A;  2V2F F;  1CI8 A;  3IH8 A;  3IWO A;  5AQ7 A;  2H0Y A;  4O7D A;  3UO9 A;  2ZM8 A;  1XA1 A;  3PBN A;  4JF6 A;  4C3Q A;  4DE0 A;  3NY4 A;  1ERQ A;  4JF5 A;  5FA7 A;  5FQK A;  2H10 A;  5CTN A;  1DJC A;  2XGN A;  4JXS A;  4K0W A;  4F94 A;  2OSU A;  2E8I A;  3VOY A;  3N8L A;  4X6T A;  2X01 A;  1H5X A;  4FCF A;  5HAR A;  3EQV A;  1C3B A;  1K25 A;  1PWC A;  2EXA A;  3IQA A;  4S2P A;  4WMC A;  1FQG A;  5CXW A;  3UDF A;  1YMX A;  4UA9 A;  3PBO A;  3Q07 A;  5U47 A;  4C75 A;  4X68 A;  3AGF A;  3VP1 A;  2Z2L B;  5FI6 A;  4EBL A;  1GHP A;  4L0L A;  4GKU A;  4QD4 A;  1KE4 A;  1K6S A;  4OKP A;  1FCN A;  5G18 A;  3MZF A;  4OQ0 A;  4JXV A;  3HUO A;  5CER A;  3BFG A;  4QY5 A;  4ZTK A;  4DE1 A;  3DW0 A;  4JKT A;  4LCM A;  4WBG A;  4H8R A;  2H5S A;  1CEF A;  2EX6 A;  3IF6 C;  1IEM A;  1ES5 A;  2ZD8 A;  2CC1 A;  3OPR A;  4KZ9 A;  1YLZ A;  2Y2P A;  1JTD A;  1Y54 A;  3I7J A;  3Q7Z A;  3S22 A;  4HBT A;  2VGK A;  4FH2 A;  2JC7 A;  2XLN A;  3IWQ A;  1PIO A;  3GR2 A;  4IBX A;  1GCE A;  4KQR A;  4WZ5 C;  3W8K A;  3CZD A;  1TDL A;  4N1X A;  1DJB A;  4R4R A;  1BSG A;  3HVF A;  3A3F A;  4IVK A;  3GMW A;  5FI2 A;  2Y2H A;  2WAD A;  1XKZ A;  3FV7 A;  3HBR A;  1Z6F A;  1IKI A;  1DY6 A;  1HTZ A;  1IYP A;  2XFT A;  4S2I A;  3BYD A;  2WZX A;  3SH9 A;  3N8R A;  4BLM A;  3HLC A;  4GD6 A;  4DDS A;  1E3U A;  3ZFZ A;  5FQI A;  3NBL A;  4E3J A;  1IYS A;  2JE5 A;  3ZG9 B;  5KZH A;  4ZJ1 A;  1YLJ A;  1EI5 A;  3GVB A;  5A91 A;  1J9M A;  4FD8 A;  1HZO A;  4KZ7 A;  1W5D A;  3UNW A;  1SDN A;  3G2Y A;  3NCK A;  1HVB A;  3MKE A;  3PBS A;  2PU4 A;  1M6K A;  4QY6 A;  3OCN A;  4P0M A;  3PBQ A;  2HP6 A;  5DF7 A;  2JCH A;  4OOM A;  4OLD A;  4BD0 A;  2XR0 A;  4MBH A;  1NJ4 A;  2OLV A;  1K57 C;  1BLC A;  4HES A;  1GA0 A;  4FSF A;  3W4O A;  1YT4 A;  2RCX A;  3DWZ A;  2FFY A;  3LY3 A;  1K55 A;  4NK3 A;  1ESU A;  4RX3 A;  1VQQ A;  3ZGA B;  1JWV A;  1VM1 A;  3M2K A;  1CEG A;  1ES4 A;  4E6W A;  4WM9 A;  3Q81 A;  5CHU A;  2Y2G A;  3E2L A;  1O7E A;  5CED A;  3EQU A;  4E3K A;  1BUE A;  5M1A A;  1LL9 A;  1MXO A;  1ONH A;  3PBT A;  3Q82 A;  5FAP A;  1ES2 A;  2XEP A;  2IWC A;  2XDM A;  3DTM A;  2Y2I A;  4P85 A;  1QME A;  3UDX A;  1H8Y A;  3PAE A;  1K54 C;  3HRE A;  3PTE A;  4LV2 A;  5F83 A;  1ZKJ A;  1JWZ A;  3P98 A;  3Q7V A;  4S2J A;  3RJU A;  5DF9 A;  5CGX A;  4OPQ A;  4KG2 A;  4BD1 A;  4EQI A;  4QU3 A;  1BZA A;  2HDS A;  3M2J A;  3Q1F A;  5EEC A;  4DF6 A;  1YM1 A;  3LO7 A;  3FZC A;  2J8Y A;  2ZC3 B;  2WKI A;  3G4P A;  4OH0 A;  2WAF A;  2XF3 A;  5E2G A;  1YLW A;  3WS4 A;  2Y91 A;  2R9W A;  3IHA A;  1K6R A;  4X53 A;  3VP0 A;  1PW8 A;  1FSW A;  3ZCZ A;  5EVI C;  1OME A;  1K4F A;  4ZJ3 A;  2IWB A;  4EBN A;  3UPN A;  5F1F A;  3V39 A;  3Q7V B;  5F82 A;  1MWT A;  2WUQ A;  4GZB A;  1IYQ A;  1LHY A;  4LEN A;  1BT5 A;  2Q9M A;  4GOG A;  4JF4 A;  1JTG A;  1PZO A;  5E43 A;  1KGG A;  2A49 A;  3GQZ A;  3WS1 A;  1S6R A;  2FFF B;  4NET A;  4R0Q A;  4A5R A;  1WYC A;  4PM7 A;  4CPK A;  4RVA A;  4E6X A;  2ZQ7 A;  4QB8 A;  4XUX A;  5E2H A;  4ZBE A;  4PM9 A;  3TG9 A;  3OPL A;  4GD8 A;  1SCW A;  4QJG A;  2PU2 A;  1W8Y A;  2R9X A;  3MXR A;  3OCL A;  3OPH A;  4K91 A;  4LV1 A;  3M6B A;  4RX2 A;  3UDI A;  5A92 A;  1FCO A;  1XP4 A;  3V3S A;  4N9L A;  2EX9 A;  2Z2M B;  3AGD A;  3FYZ A;  4OQH A;  5E2F A;  3UPP A;  4EV4 A;  4D2O A;  1K38 A;  3C7V A;  3AGE A;  4PM5 A;  4BL3 A;  2EFU A;  5AQB A;  1WE4 A;  1WYB A;  3UN7 A;  3JYI A;  1FR6 A;  3S1Y A;  4LV0 A;  2ZJ9 A;  3SOI A;  2WYX A;  4LV3 A;  2EFX A;  1W7F A;  4WEL A;  4S2L A;  1DJA A;  5HAI A;  3WRZ A;  4E3L A;  5HW3 A;  2WZZ A;  1KVL A;  1PWG A;  1MBL A;  2C6W B;  2P9V A;  2Y4A A;  3B3X A;  3D4F A;  3GTC A;  4OPR A;  1ZC2 A;  4UA7 A;  5CGW A;  2WGW A;  3PAG A;  2H0T A;  3A3J A;  4BQM A;  3LCE A;  1TVF A;  1BLS A;  1TEM A;  4M3K A;  4QHC A;  3HUM A;  5CHM A;  4Q8I A;  1KE0 A;  4UAA A;  2HDQ A;  3UE1 A;  4OLG A;  1ERO A;  1IYO A;  2EX8 A;  2Y2L A;  3VSL A;  3BEB A;  4OQI A;  4UHU A;  3LY4 A;  5DTK A;  3SS3 A;  2ZM2 A;  3V5M A;  3MXS A;  4B4Z A;  4DRT A;  4DXC A;  3BFC A;  1YLY A;  1M40 A;  1YMS A;  3G31 A;  3O88 A;  4S2N A;  5HX9 A;  1K56 D;  3O86 A;  3MZE A;  1RCJ A;  5EVL A;  4PM8 A;  5E2E A;  2P9V B;  1XA7 A;  2QMI A;  3HL9 A;  2WGW B;  4MBF A;  2B5R A;  4OOL A;  4KZA A;  1FCM A;  4K0X A;  1PI5 A;  5DTT A;  1MWR A;  2UWX A;  3DWK A;  3IT9 A;  2Y55 A;  4KZ8 A;  4DE3 A;  1G6A A;  4EUZ A;  1NYM A;  1IKG A;  1U60 A;  1MY8 A;  3A3D A;  3UE0 A; 
#chains in the Genus database with same CATH topology
 1YSQ A;  1MZU A;  1L0E A;  4OOY A;  3RXW A;  1IEL A;  3TSG A;  2OV5 A;  2Z6C A;  5AVF A;  3VP4 A;  2X71 A;  2V20 A;  4HBU A;  4RQ9 A;  3MFD A;  5FDS A;  3JVV A;  4GN2 A;  2DMW A;  2BLS A;  4Y7P A;  1GA9 A;  4WEK A;  5DFX A;  5KMW A;  3MR0 A;  4RRG A;  5KSH A;  3UE3 A;  1NRF A;  4HIA A;  3DTK A;  1QMF A;  2ZBB A;  3U2A A;  3IXD A;  4GDB A;  2PRF A;  3DAV A;  3HLG A;  3D9Y A;  3IXG A;  3WS2 A;  3G32 A;  2QJ7 A;  4MMN A;  1P97 A;  1YAX A;  1NRJ A;  5FQQ A;  1ONG A;  4MLL A;  4JPM A;  2I72 A;  3LI8 A;  2M7U A;  5GHX A;  1MPL A;  3MMH A;  3ZG8 B;  4R23 A;  5IU1 A;  4Z9Q A;  2HDR A;  3QNB A;  1XJ4 A;  5GLB A;  1NZU A;  4Y2F A;  3TRC A;  2PR5 A;  2K31 A;  3V50 A;  4RRR A;  4WZ5 A;  1GHM A;  3RXX A;  2HP5 A;  3KO4 A;  4S2O A;  2W27 A;  2HDU A;  5A93 A;  1FSY A;  5EE8 A;  2Y2K A;  1N4O A;  2Y2Q A;  2HL0 A;  1YSP A;  2XD5 A;  3KYZ A;  3NOP C;  3CAX A;  3ZVT A;  3KO7 A;  4QWO A;  4F3L A;  1SDE A;  1NXY A;  1Q2P A;  3T1R A;  1XX2 A;  1IOU A;  1GSW A;  3QHY A;  3PD5 A;  3QP5 A;  1XXM A;  3KX0 X;  4NXE A;  5FQ9 A;  3TOI A;  3C4O A;  4DXB A;  5CHJ A;  3UB8 A;  4OVD A;  4F3L B;  2G2U A;  3BRM A;  4XXR A;  2JBF A;  2Y59 A;  2D01 A;  1OTD A;  3MJQ A;  3P09 A;  2ZOH A;  4LCL A;  2Y2M A;  5TBM A;  3N4I A;  5EVI A;  4RR8 A;  2VGJ A;  3GSG A;  5M18 A;  2G7U A;  3MF0 A;  2UV0 E;  3PBR A;  3CUE A;  2XRN A;  3SH7 A;  1VET A;  5CEC A;  4ZDX A;  4ZJ2 A;  5CRF A;  1I2W A;  4JBF A;  1MWU A;  4OP8 A;  5FI7 A;  5TBM B;  3VFH A;  3ZNY A;  5EVI B;  1NY0 A;  2WGV A;  4KQO A;  1CK3 A;  4HQA A;  2M7V A;  1PYY A;  2BG1 A;  1LL5 A;  1AXB A;  1YQS A;  5DTS A;  1I2S A;  3D72 A;  1VET B;  2VV7 A;  3BEC A;  5JYP A;  1RGZ A;  3C5A A;  4IED A;  1YKD A;  4X69 A;  1JWP A;  3KO9 A;  5CEB A;  2Q9N A;  1CI8 A;  4KUK A;  3PBN A;  4JF6 A;  3UB5 P;  4C3Q A;  4HJ4 A;  4JF5 A;  4R70 A;  5EFW A;  4X25 A;  4JXS A;  4K0W A;  4F94 A;  2OSU A;  3T4O A;  3MQQ A;  4RR7 A;  5HAR A;  1PWC A;  3A0R A;  4UA9 A;  3PBO A;  3Q07 A;  4C75 A;  4X68 A;  3AGF A;  2OAP 1;  5FI6 A;  3C8C A;  1GHP A;  1JKE A;  4GKU A;  1K6S A;  5DJT A;  5CER A;  3BFG A;  3DW0 A;  4HP4 A;  3IX3 A;  4H8R A;  1CEF A;  3OPR A;  5LBR A;  4FH2 A;  2JC7 A;  1Z09 A;  3GR2 A;  3W8K A;  2GX5 A;  3VOL A;  2MJ6 A;  4R4R A;  1VB6 A;  3HVF A;  4HJ6 A;  4MN5 A;  2VV8 A;  1XKZ A;  2L4R A;  1IYP A;  4B93 A;  3IX8 A;  3HLC A;  3LMU A;  5FQI A;  5KZH A;  4ZJ1 A;  1EI5 A;  3GVB A;  1J9M A;  3FC7 A;  4CLC C;  3UNW A;  5CX7 A;  3G2Y A;  2W3F A;  3MKE A;  1OJG A;  1MKM A;  2QYB A;  1Y2Q A;  2O9A A;  4P0M A;  4ETZ A;  1A0K A;  1WA9 A;  1GSV A;  3ZGA B;  1VQQ A;  5HWT A;  4RRK A;  3S7Q A;  3E2L A;  5CED A;  3EQU A;  4E3K A;  5MC7 A;  3Q82 A;  1ONH A;  3LIF A;  1ES2 A;  2IWC A;  3G6O A;  2Y2I A;  1PNE A;  2ACG A;  3HRE A;  4CLC D;  1ZKJ A;  1S4R A;  3JVU A;  3RJU A;  5CGX A;  4OPQ A;  4BD1 A;  4EQI A;  3LO7 A;  4GHI A;  4OH0 A;  5E2G A;  2XF3 A;  3WS4 A;  1FSW A;  2VZW A;  4NEE D;  3KO3 A;  3NJA A;  1K4F A;  2IWB A;  3UB7 A;  3UPN A;  3V39 A;  1IYQ A;  2PDR A;  2A49 A;  4GHI B;  4ZRR A;  3E4P A;  4RVA A;  5HSQ A;  3U4L P;  4PM9 A;  3TG9 A;  1S66 L;  2V1B A;  5L2F A;  1JNU A;  2PU2 A;  2W1R A;  3QP1 A;  2PHY A;  4LV1 A;  2WKQ A;  3UDI A;  1FCO A;  1XP4 A;  4N9L A;  2KDK A;  3KYE A;  4D2O A;  3LEQ A;  3MQ0 A;  4I3J A;  4QPR A;  1FR6 A;  3R7W A;  3VE4 A;  2WYX A;  4LV3 A;  4S2L A;  1DJA A;  1IFQ A;  3V67 A;  5HAI A;  4E3L A;  4BBU A;  5HW3 A;  2WZZ A;  1NLZ A;  2ZMF A;  4UA7 A;  2C6W B;  3B3X A;  5CGW A;  4UAA A;  1ZC2 A;  2H0T A;  2OWJ A;  3LCE A;  1BLS A;  1TEM A;  1T1A A;  4QHC A;  3HUM A;  1KE0 A;  3R7W B;  4UQI S;  3SS3 A;  3LY4 A;  3ZQ5 A;  4II7 A;  1M40 A;  3G31 A;  3O88 A;  1K56 D;  3O86 A;  3IX4 A;  2V8C A;  4PM8 A;  3T4L A;  2QMI A;  2CMN A;  4OOL A;  3JPU A;  1J7G A;  2JKT M;  4DE3 A;  2VV6 A;  1W63 M;  3DTE A;  3O5Y A;  4EET B;  3UE0 A;  2EWV A;  4O01 A;  4MN7 A;  3BY9 A;  4Y0U A;  4S2M A;  5HAP A;  2VA0 A;  4KG5 A;  2XSS A;  1E4D A;  1V9Z A;  4IUH A;  4YFM A;  2DBO A;  3T12 B;  4Y0T A;  2BAS A;  4Z1W A;  3ITB A;  4X55 A;  3UY6 A;  2EXB A;  3SS4 A;  3HLW A;  1OTB A;  1XGJ A;  5EV0 A;  5EOE A;  1L2S A;  1XJ2 A;  1LL8 A;  3ZHH A;  3N7W A;  5CGS A;  4HH2 A;  5JYO A;  3IBR A;  2A3U A;  2PBY A;  3MXQ A;  3SS5 A;  5HL6 A;  2HJ9 C;  3BWL A;  4U0T A;  1S4S A;  1K4E A;  1KOU A;  1X0O A;  1XPB A;  3MS6 A;  4Y3I A;  2W3E A;  3UPO A;  4RRJ A;  3W2Z A;  1OJ5 A;  4IUK A;  3OZH A;  3P7N A;  1H3Q A;  3HJK A;  1D06 A;  3VP2 A;  4E04 A;  5HL1 A;  3QP8 A;  2XK1 A;  5KSC A;  3A3E A;  3B33 A;  1D7E A;  3IF6 A;  2ZC7 A;  3S7O A;  4HJ3 A;  4PAU A;  5FAT A;  2QHK A;  2ZQ8 A;  2VEA A;  2W1T A;  2H28 A;  5EM0 A;  1FIL A;  3HLF A;  2I9V A;  1ZG6 A;  5M19 A;  5DVA A;  4WUJ A;  4PKY G;  3NDE A;  3IF6 B;  2ZMA A;  2ZM0 A;  5TR7 A;  4OPY A;  4P87 A;  5AQA A;  3IHB A;  5DF8 A;  1ODV A;  2GDN A;  2GZA A;  2W1T B;  4BMW A;  3UE6 A;  1ESI A;  5J8X A;  1CI9 A;  2P74 A;  3N6I A;  1E25 A;  2OOL A;  2B02 A;  3OC2 A;  1MWS A;  1K57 A;  4KZB A;  2HPB A;  3KO5 A;  4UQI M;  2V1Z A;  5HPI A;  1XGI A;  5EM1 A;  3T4K A;  1S1Y A;  4EUV A;  4E3N A;  4PM6 A;  5F6A A;  2VX8 A;  5L09 A;  4N9K A;  1K54 A;  4S2N C;  1I5Q A;  3KYQ A;  3QNC A;  1EWZ A;  4WMC D;  3SH8 A;  4B9O A;  1LI9 A;  1LT0 A;  4ZAM A;  2KX6 A;  4RA7 A;  3WS5 A;  3H82 A;  1DP9 A;  2PYP A;  2B18 A;  3B47 A;  3EGX C;  2VKS A;  4WEJ A;  1BUL A;  5HDD A;  2DCF A;  3FPV A;  4MCW A;  4OQG A;  4Q0I A;  2AVX A;  4B88 A;  5FQM A;  3MQO A;  3H82 B;  1TDG A;  4KZ6 A;  3BM6 A;  2HJE A;  1T1C A;  5A90 A;  5EVE A;  4RRL A;  3F1O A;  1LI0 A;  2HP9 A;  3SW1 A;  3NDG A;  4KZ4 A;  2J7V A;  1PWD A;  5FAQ A;  1XJ6 A;  3ZDJ A;  5EUA A;  4P6Z S;  4RYE A;  3D3O A;  3GV9 A;  4JLF A;  2QZ6 A;  3S4X A;  2KLI A;  5AVE A;  2J9P A;  3IWO A;  3F1O B;  3UO9 A;  3BQ8 A;  4DE0 A;  3NHQ A;  4ME4 A;  4Y13 A;  5FA7 A;  5FQK A;  1AWI A;  2H10 A;  5CTN A;  3LI9 A;  1VHM A;  3TE8 A;  3N8L A;  2OWH A;  2X01 A;  1H5X A;  1C3B A;  3UDF A;  5CXW A;  4KQD A;  3T1X A;  4R38 A;  1CF0 A;  4EBL A;  3FG8 A;  4DE1 A;  4QY5 A;  1PFL A;  4LCM A;  4WBG A;  1N9N A;  2H5S A;  4EEU A;  2Y2P A;  1Y54 A;  3Q7Z A;  3KOD A;  2PD7 A;  3TJZ C;  5J61 A;  3IWQ A;  1PIO A;  4WZ5 C;  1GCE A;  4N1X A;  1DJB A;  3GMW A;  2Y2H A;  2ZL1 A;  3C38 A;  4RRA A;  1IKI A;  1HTZ A;  1OT9 A;  2WZX A;  4BLM A;  4GD6 A;  5AJG A;  4DDS A;  2L1M A;  3NBL A;  1IYS A;  2Y8H A;  3PHY A;  5A8B A;  5A91 A;  3OOV A;  4KZ7 A;  2ZL1 B;  1HVB A;  4YWZ A;  2PU4 A;  4HI4 A;  4QY6 A;  3OCN A;  2HP6 A;  3KSG A;  2JCH A;  4OOM A;  4Y17 A;  4OLD A;  2XR0 A;  1NJ4 A;  3KNF A;  3A0V A;  1BLC A;  1EW0 A;  3CLO A;  4YOF A;  3W4O A;  2RCX A;  3DWZ A;  1K55 A;  1ESU A;  1JWV A;  3Q81 A;  3IS2 A;  3R4K A;  4RRM A;  2XEP A;  3OLO A;  2FH5 A;  4RR9 A;  4X1L A;  1TS0 A;  1H8Y A;  3NOT C;  4RRI A;  3LMT A;  4LV2 A;  1JWZ A;  3Q7V A;  4KG2 A;  5HWV A;  3M2J A;  3Q1F A;  5EEC A;  3FZC A;  2ZC3 B;  3IS2 B;  3DBA A;  4JGP A;  2R9W A;  5C5K A;  1PW8 A;  5EVI C;  1FIK A;  2YKH A;  4IHQ A;  1W63 Q;  4EBN A;  5F1F A;  3Q7V B;  5F82 A;  1BYW A;  3CUE C;  4JF4 A;  1JTG A;  1PZO A;  5E43 A;  4WF0 A;  3WS1 A;  4A5R A;  3EGD C;  3IBJ A;  2ZQ7 A;  4QJG A;  3OCL A;  1W8Y A;  4XT2 A;  3MXR A;  5G4Y A;  3M6B A;  5A92 A;  2JKR M;  2Z2M B;  3AGD A;  4OQH A;  5E2F A;  4FUW A;  4LV0 A;  1S67 L;  1V9Y A;  4K08 A;  2V9A A;  2P7J A;  3D4F A;  1PWG A;  1TS7 A;  2Y4A A;  4XT2 B;  5I5L A;  5L8M A;  2WGW A;  4GW9 A;  5DJU A;  4RRQ A;  4M3K A;  5CHM A;  1ERO A;  1IYO A;  2Y2L A;  3BEB A;  4CLC A;  3BFC A;  5HX9 A;  4LRX C;  3MZE A;  4RRB A;  2V0U A;  2WGW B;  3T4S A;  1FCM A;  4K0X A;  1MWR A;  2UWX A;  3LMV A;  3IT9 A;  2Y55 A;  3PD3 A;  1IKG A;  4CLC B;  3H9W A;  1KDS A;  4E3I A;  4KUO A;  5FQJ A;  1SHV A;  2J3T C;  3BLM A;  4MBK A;  1BTL A;  3W4P A;  2QPN A;  3VE3 A;  1PZP A;  3LYX A;  4RRF A;  5HAQ A;  3VMA A;  4KQQ A;  4EWF A;  1KGE A;  3RFB A;  4JXW A;  4HHD A;  3G35 A;  1YPR A;  3CG5 A;  3C4P A;  1ZHH B;  3FKW A;  5HD5 A;  4DMZ A;  5TFQ A;  3UB6 A;  4JGR A;  5HWW A;  4D60 A;  3NI9 A;  1K56 A;  4FH4 A;  2VGL S;  3O3V A;  4KZ3 A;  3WRT A;  4KEN B;  2EX2 A;  1PI4 A;  3EWK A;  5L10 A;  3N8S A;  2Z6D A;  1BLH A;  2ZLY A;  4RRH A;  2W3D A;  1L3L A;  4IBR A;  4R3J A;  2PAV P;  3GEC A;  4I3I A;  3HUN A;  2JKT I;  4CJN A;  2XQZ A;  3VFF A;  3A3I A;  2A24 A;  2VJW A;  3IXH A;  4R3B A;  4OP5 A;  4S02 A;  4MN6 A;  2ZOI A;  2XH9 A;  1N9L A;  4BL2 A;  4GNU A;  5TJJ A;  1KDW A;  3M6H A;  4NBJ A;  4X56 A;  3LEZ A;  2X02 A;  2Y2J A;  4YIN A;  2A24 B;  2JKF A;  1NYY A;  5D3O A;  1ACF A;  3IF5 A;  4L9E A;  4AFI A;  1OPX A;  3F1P A;  1P9W A;  2M1C A;  3HJI A;  3EOI A;  3VOZ A;  2JKG A;  2KOI A;  3KNP A;  5DKL A;  4S0K A;  1HD8 A;  1DRM A;  1S0W A;  4IVI A;  2HL2 A;  4ESP A;  2GJ3 A;  4PPR A;  2WAE A;  1GHI A;  1DP6 A;  3PD2 A;  2D02 A;  4FOF A;  3BLS A;  3NIA A;  3F1P B;  3FPW A;  4S03 A;  3MKF A;  1TS6 A;  4S0L A;  4HEF A;  4CQH A;  2K7S A;  5KIZ A;  1W8Q A;  4JXG A;  3E4Q A;  5FAS A;  3LGO A;  1UWN X;  4N1H A;  1S1Z A;  1W79 A;  4E3M A;  4R4S A;  3LR4 A;  1NZO A;  2E8J A;  5I94 A;  3G34 A;  5FEG A;  5HDC A;  4S2K A;  4JGQ A;  2DRW A;  4LGW A;  2V8F A;  2HF6 A;  4WN5 A;  2C5W B;  4BEN A;  4WYY A;  4DKI A;  3BFE A;  2ZC4 B;  1E3U D;  2RL3 A;  3BFD A;  3HLB A;  3ITA A;  4GS9 A;  1H8M A;  2WKE A;  2Y2N A;  3ZG0 A;  2QJ5 A;  5AQ9 A;  1NLY A;  3BFF A;  3VSK A;  5IHV A;  3OPP A;  3G30 A;  4P6B A;  5FAO A;  4EU0 A;  3WS0 A;  1O07 A;  5GLA A;  2V2F F;  3IH8 A;  3K3C A;  5DFY A;  4O7D A;  5IS1 A;  2VK3 A;  2VGL M;  1SKO A;  1OT6 A;  5J7E A;  5HZH A;  1DJC A;  1XFQ A;  2INW A;  4GS9 B;  4HP9 A;  3VOY A;  3LR0 A;  4FCF A;  3EQV A;  3IQA A;  4S2P A;  4WMC A;  3PXP A;  1YMX A;  5J4E A;  4L0L A;  4GLQ A;  2W3G A;  4QD4 A;  1KE4 A;  5G18 A;  4OQ0 A;  1SKO B;  4JXV A;  1TC5 A;  2EX6 A;  3IF6 C;  4KZ9 A;  1ES5 A;  1YLZ A;  3PR6 A;  1JTD A;  3I7J A;  4HBT A;  5J3W A;  2VGK A;  3C30 A;  2XLN A;  4IBX A;  4KQR A;  1TDL A;  3KOB A;  3A3F A;  1LSV A;  4IVK A;  2P08 A;  3KSF A;  3FV7 A;  2WAD A;  4DJ2 A;  4S2I A;  5IT5 A;  3SH9 A;  2W0N A;  2Y79 A;  2JE5 A;  1TS8 A;  2HKZ A;  4I39 A;  3RTY A;  4G3V A;  4FD8 A;  1SDN A;  3L7H A;  3PBS A;  3QP6 A;  1M6K A;  4S0J A;  5DF7 A;  1LSX A;  1F2K A;  1Y28 A;  3LID A;  4GJ4 A;  3T50 A;  3E98 A;  4CLC E;  2OLV A;  1K57 C;  3CPT A;  4HES A;  1GA0 A;  4FSF A;  1YT4 A;  3L9K A;  3EEA A;  4NK3 A;  4RX3 A;  5HD3 A;  1G6O A;  3M2K A;  1CEG A;  1ZTU A;  4E6W A;  4WM9 A;  5CHU A;  4Y5F A;  1O7E A;  1BUE A;  5M1A A;  4NXG A;  1GSX A;  2B95 A;  3K3D A;  3PBT A;  4NKP A;  5HDS A;  2XDM A;  3DTM A;  4P85 A;  1OTA A;  1SZV A;  2O9B A;  2R78 A;  3UDX A;  3PAE A;  1K54 C;  3PTE A;  3CPT B;  2QWS A;  2LB5 A;  3P98 A;  4G3W A;  4S2J A;  1BZA A;  2HDS A;  4DF6 A;  4WL9 A;  2WKI A;  3IHA A;  1K6R A;  3VP0 A;  3ZCZ A;  4ZJ3 A;  4EW7 A;  1MWT A;  2WUQ A;  4GZB A;  1LHY A;  4LEN A;  1BT5 A;  2Q9M A;  4GOG A;  2J3W A;  3GQZ A;  1S6R A;  3DTI A;  4NET A;  1XJ3 A;  4CPK A;  4QB8 A;  4XUX A;  1SCW A;  3BW6 A;  4RX2 A;  2XRO A;  2PD8 A;  2EX9 A;  3FYZ A;  3UPP A;  1K38 A;  3C7V A;  2OAQ 1;  3LR3 A;  2EFU A;  5AQB A;  1WYB A;  3JYI A;  3S1Y A;  4L9G A;  2ZJ9 A;  3SOI A;  4MDZ A;  1W7F A;  4WEL A;  4YNR A;  3NUL A;  3WRZ A;  2HGV A;  3GTC A;  2P9V A;  3BJN A;  2O9C A;  4L9F A;  3QP2 A;  3UMD A;  3LFV A;  4BBT A;  3UE1 A;  2HDQ A;  2EX8 A;  5DTK A;  4B4Z A;  2ZM2 A;  3PYP A;  3MXS A;  1F98 A;  4Y15 A;  4DXC A;  1YLY A;  1YMS A;  3F1N A;  5EVL A;  2P9V B;  3HL9 A;  4MBF A;  3S7N A;  1PI5 A;  3ICY A;  5DTT A;  3DWK A;  3BQA A;  4KZ8 A;  2J80 A;  1G6A A;  4EUZ A;  1F5M A;  1MY8 A;  1U60 A;  5FDH A;  4B4X A;  3F1N B;  5EOO A;  4HOI A;  4PKY A;  1N9O A;  1Y4O A;  4GB7 A;  2ZQ9 A;  5BOH A;  3V3R A;  3IWI A;  3BY8 A;  4HNB A;  1HLU P;  3CHW P;  3SZT A;  4KZ5 A;  2WK0 A;  3O87 A;  5FSR A;  5CTM A;  3MZD A;  1LSW A;  2ZMV A;  3IH9 A;  5F5Y A;  3GRJ A;  4N92 A;  1SKF A;  4MNR A;  2JKR I;  1MC0 A;  4Q0H A;  4Q0J A;  2ZC5 B;  4DJ3 A;  1L0F A;  2Y2O A;  4BJP A;  1RP5 A;  5K5B A;  1G68 A;  4FTX A;  3ZG5 A;  3FWL A;  1K55 C;  1MKI A;  1YLT A;  3HLE A;  4UA6 A;  2W3H A;  1L0D A;  2XD1 A;  2ZQC A;  1G28 A;  5F1G A;  4EBP A;  3E0Y A;  3VP3 A;  4NG2 A;  4EQ1 A;  1KVM A;  3CJM A;  3ZG7 B;  3G2Z A;  5F69 A;  3QP4 A;  1YLP A;  3B42 A;  4P6Z M;  3HLD A;  4WZ4 A;  2ZQD A;  1T1B A;  1TF1 A;  2JN7 A;  1DP8 A;  5FL3 A;  3CMZ A;  3WWX A;  1FR1 A;  1RGY A;  4GDN A;  1J3W A;  4H6J A;  5EVI D;  1JVJ A;  4R6L A;  2G2W A;  2HZ5 A;  3LIC A;  2QKP A;  2IWD A;  4ID4 A;  3ISG A;  3ZNT A;  4DE2 A;  4JGO A;  2WKP A;  4U3T A;  4S0I A;  4NXB A;  1KGF A;  4DDY A;  2O99 A;  4H6J B;  5GHZ A;  2BTF P;  4UEY A;  3C2W A;  1N9B A;  4C6Y A;  3NC8 A;  1FOF A;  1H8Z A;  1OTI A;  4O8G A;  4HY8 A;  2OKV A;  1UGU A;  3A0S A;  2JHE A;  4U0X A;  5GL9 A;  2J9O A;  3CIT A;  3C7U A;  1PW1 A;  1ZG4 A;  2EWW A;  2NUT C;  2IA2 A;  5FEF A;  3UB9 A;  1Q2Q A;  2OLU A;  4MEZ A;  3FKV A;  4R3A A;  2XFS A;  1BLP A;  3ZVW A;  5G4Z A;  3T4J A;  1ERM A;  1CQA A;  1KE3 A;  3CWF A;  4R1G A;  1LLB A;  1PRQ A;  2DNS A;  1L0G A;  2WKH A;  5TGF A;  5HPF A;  3KSI A;  1ES3 A;  1STZ A;  4PMA A;  3KSH A;  3E2K A;  4KG6 A;  1VEU A;  5GLD A;  4EER A;  2A2L A;  4LFU A;  4LRZ E;  3W4Q A;  4RRC A;  2PR6 A;  5EPH A;  3HCY A;  4E3O A;  2ZC6 B;  2J3T D;  2YKF A;  5GLC A;  1VEU B;  4OON A;  4DN0 A;  2XA7 S;  4XUZ A;  5HFO A;  2WGI A;  3RH8 B;  3MBZ A;  4O0P A;  1UWP X;  4NXF A;  1ALQ A;  4OPZ A;  2ZQA A;  2FZ0 A;  1CJF A;  4X1M A;  5GHY A;  4Y0O A;  3IXB A;  5AQ7 A;  2H0Y A;  2ZM8 A;  1XA1 A;  4NBI A;  3NY4 A;  1ERQ A;  4IJG A;  3EEH A;  2V1A A;  2XGN A;  4HH3 A;  4ARZ A;  3VV4 A;  2E8I A;  3P01 A;  3KO6 A;  4X6T A;  4LPZ A;  1K25 A;  2EXA A;  1FQG A;  5U47 A;  3K2N A;  3VP1 A;  2Z2L B;  4OKP A;  1FCN A;  3MZF A;  3HUO A;  4ZTK A;  4JKT A;  4BWI A;  1P9R A;  4ARZ B;  1IEM A;  2ZD8 A;  2CC1 A;  3LIB A;  3S22 A;  2HV1 A;  5F68 A;  3CZD A;  1BSG A;  1G5U A;  3ZYT A;  5FI2 A;  3HBR A;  1Z6F A;  1D1J A;  4BBV A;  1DY6 A;  2XFT A;  3BYD A;  3N8R A;  1E3U A;  3ZFZ A;  4E3J A;  2K2N A;  3ZG9 B;  1YLJ A;  4PHT A;  1HZO A;  3UME A;  1W5D A;  2Q0O A;  3NOU C;  3NCK A;  5L07 A;  3E4O A;  1OTE A;  3PBQ A;  4GCZ A;  2PYR A;  4BD0 A;  4MBH A;  3T4Q A;  3H7W A;  1T19 A;  2FFY A;  3LY3 A;  1K0K A;  2PT7 A;  3T1S A;  1VM1 A;  3ULF A;  1ES4 A;  1NWZ A;  2Y2G A;  1LL9 A;  1MXO A;  5FAP A;  5DKK A;  1QME A;  3H7W B;  3S7P A;  1F9I A;  5F83 A;  3PD4 A;  5DF9 A;  4QU3 A;  1YM1 A;  2J8Y A;  3G4P A;  2NUP C;  2WAF A;  1YLW A;  3LR5 A;  2Y91 A;  4I3A A;  4X53 A;  2WKR A;  3TW8 A;  4LRY C;  1OME A;  4RR6 A;  4I38 A;  2XA7 M;  3MSH A;  3NEC A;  1KGG A;  2FFF B;  4R0Q A;  1WYC A;  4PM7 A;  4E6X A;  3T1Q B;  5E2H A;  4ZBE A;  3OPL A;  4GD8 A;  3OPH A;  4K91 A;  2R9X A;  1H0M A;  3V3S A;  3LIE A;  4ETX A;  4EV4 A;  4M4X A;  2LB9 A;  3AGE A;  4PM5 A;  4BL3 A;  4EEP A;  1WE4 A;  3T4T A;  3UN7 A;  3OBF A;  1TD5 A;  3LUQ A;  4G3K A;  2V0W A;  4WLA A;  2EFX A;  3MFX A;  2P04 A;  4RRD A;  1KVL A;  1MBL A;  4OPR A;  2HL1 A;  3PAG A;  1XFN A;  3A3J A;  4BQM A;  1TVF A;  1T18 A;  4Q8I A;  4OLG A;  3VSL A;  2GNX A;  4OQI A;  4UHU A;  3V5M A;  4EXO A;  4LLO B;  4DRT A;  2VLG A;  3LIA A;  4S2N A;  4I5S A;  1P0Z A;  1RCJ A;  5E2E A;  1XA7 A;  2O0Y A;  4EES A;  2B5R A;  4KZA A;  3KOC A;  2L0W A;  3CI6 A;  2EA9 A;  2PBD P;  1NYM A;  3GDI A;  3A3D A; 
#chains in the Genus database with same CATH homology
 5FDH A;  4B4X A;  1L0E A;  4OOY A;  1KDS A;  4E3I A;  3RXW A;  5EOO A;  1IEL A;  4Y0U A;  4S2M A;  3TSG A;  3KO9 A;  5HAP A;  4GB7 A;  2ZQ9 A;  5FQJ A;  4KG5 A;  5BOH A;  3V3R A;  1E4D A;  2OV5 A;  3IWI A;  1SHV A;  4YFM A;  2DBO A;  3VP4 A;  2X71 A;  3BLM A;  2V20 A;  4HBU A;  4MBK A;  1BTL A;  3MFD A;  4Y0T A;  3W4P A;  2QPN A;  3ITB A;  4X55 A;  3UY6 A;  1PZP A;  4KZ5 A;  2WK0 A;  4RRF A;  3O87 A;  2EXB A;  5FSR A;  5HAQ A;  3SS4 A;  3HLW A;  3VMA A;  4KQQ A;  5CTM A;  1XGJ A;  3MZD A;  5EOE A;  4GN2 A;  1L2S A;  4EWF A;  2BLS A;  3IH9 A;  4Y7P A;  1GA9 A;  4WEK A;  3ZHH A;  5KMW A;  1KGE A;  3GRJ A;  3N7W A;  4N92 A;  5CGS A;  1SKF A;  4MNR A;  4RRG A;  4JXW A;  5KSH A;  3UE3 A;  1NRF A;  3G35 A;  5JYO A;  2A3U A;  3CG5 A;  1QMF A;  3C4P A;  2PBY A;  3FKW A;  2ZC5 B;  3IXD A;  1L0F A;  2Y2O A;  4GDB A;  5TFQ A;  4BJP A;  1RP5 A;  3HLG A;  3SS5 A;  1G68 A;  3IXG A;  3ZG5 A;  3WS2 A;  3FWL A;  1K55 C;  1MKI A;  3G32 A;  4U0T A;  1K4E A;  1YLT A;  3HLE A;  4UA6 A;  1XPB A;  3NI9 A;  5FQQ A;  1ONG A;  1L0D A;  4MLL A;  2XD1 A;  2ZQC A;  1K56 A;  4FH4 A;  4JPM A;  2I72 A;  5F1G A;  3O3V A;  4EBP A;  3UPO A;  4KZ3 A;  3WRT A;  4KEN B;  3VP3 A;  4RRJ A;  3OZH A;  2EX2 A;  5GHX A;  1PI4 A;  1MPL A;  3ZG8 B;  3VP2 A;  1KVM A;  3CJM A;  4R23 A;  4Z9Q A;  3ZG7 B;  2XK1 A;  5HL1 A;  5KSC A;  3G2Z A;  2HDR A;  3N8S A;  1YLP A;  3A3E A;  3HLD A;  1BLH A;  2ZLY A;  2ZQD A;  4WZ4 A;  4RRH A;  3QNB A;  3IF6 A;  5GLB A;  4IBR A;  1NZU A;  2ZC7 A;  4R3J A;  3CMZ A;  3WWX A;  5FAT A;  1FR1 A;  3HUN A;  3V50 A;  4RRR A;  4WZ5 A;  1GHM A;  3RXX A;  1RGY A;  2HP5 A;  4GDN A;  3KO4 A;  2ZQ8 A;  1JVJ A;  5EVI D;  4CJN A;  4S2O A;  2G2W A;  2XQZ A;  3HLF A;  2HDU A;  3VFF A;  3A3I A;  5A93 A;  1ZG6 A;  1FSY A;  5EE8 A;  2IWD A;  4ID4 A;  5M19 A;  5DVA A;  3ISG A;  2Y2K A;  3ZNT A;  1N4O A;  3IXH A;  4DE2 A;  3NDE A;  3IF6 B;  4R3B A;  2ZMA A;  4OP5 A;  4S02 A;  2ZM0 A;  2Y2Q A;  5TR7 A;  2XH9 A;  2HL0 A;  4U3T A;  4BL2 A;  4OPY A;  4P87 A;  4S0I A;  4GNU A;  1KGF A;  5AQA A;  3IHB A;  5DF8 A;  4DDY A;  1KDW A;  2GDN A;  3M6H A;  4NBJ A;  5GHZ A;  2XD5 A;  4X56 A;  1ESI A;  1N9B A;  3LEZ A;  4C6Y A;  2X02 A;  5J8X A;  3NC8 A;  1CI9 A;  2Y2J A;  2P74 A;  4YIN A;  3ZVT A;  1FOF A;  3KO7 A;  1H8Z A;  1E25 A;  1NYY A;  3N6I A;  3OC2 A;  5D3O A;  2OKV A;  1SDE A;  1MWS A;  3IF5 A;  1NXY A;  4U0X A;  5GL9 A;  2J9O A;  1K57 A;  4KZB A;  1Q2P A;  3C7U A;  1XX2 A;  2HPB A;  3KO5 A;  1PW1 A;  1ZG4 A;  3QHY A;  3PD5 A;  2V1Z A;  1XGI A;  3VOZ A;  1XXM A;  1Q2Q A;  3KNP A;  2OLU A;  4MEZ A;  4S0K A;  1HD8 A;  5FQ9 A;  3FKV A;  3TOI A;  2XFS A;  1S0W A;  1BLP A;  3C4O A;  4IVI A;  2HL2 A;  4DXB A;  3ZVW A;  4PPR A;  2WAE A;  5CHJ A;  1GHI A;  4E3N A;  4PM6 A;  3PD2 A;  1ERM A;  4OVD A;  1KE3 A;  4N9K A;  2G2U A;  3BRM A;  3BLS A;  4R1G A;  1K54 A;  3NIA A;  4XXR A;  1LLB A;  2DNS A;  4S2N C;  2JBF A;  3MKF A;  2Y59 A;  1I5Q A;  4S03 A;  4S0L A;  4HEF A;  3QNC A;  1L0G A;  1EWZ A;  4WMC D;  2WKH A;  5TGF A;  3SH8 A;  1LI9 A;  4ZAM A;  1W8Q A;  1ES3 A;  4PMA A;  4RA7 A;  4JXG A;  3WS5 A;  3E2K A;  4KG6 A;  3P09 A;  5FAS A;  5GLD A;  4LCL A;  2Y2M A;  4N1H A;  4WEJ A;  3N4I A;  5EVI A;  1BUL A;  1W79 A;  4RR8 A;  4E3M A;  4R4S A;  5L2F A;  2VGJ A;  2DCF A;  3GSG A;  1NZO A;  3W4Q A;  5M18 A;  4RRC A;  5I94 A;  4OQG A;  4B88 A;  3G34 A;  5EPH A;  5FQM A;  3PBR A;  4S2K A;  2DRW A;  3SH7 A;  4E3O A;  2ZC6 B;  1TDG A;  4KZ6 A;  3BM6 A;  2C5W B;  5GLC A;  4OON A;  4BEN A;  5CEC A;  4ZDX A;  4ZJ2 A;  4WYY A;  5CRF A;  4XUZ A;  4DKI A;  5A90 A;  1I2W A;  4JBF A;  1MWU A;  4OP8 A;  5FI7 A;  5HFO A;  3VFH A;  3ZNY A;  4RRL A;  3BFE A;  2ZC4 B;  5EVI B;  1NY0 A;  2WGV A;  4KQO A;  2WGI A;  1LI0 A;  2HP9 A;  1CK3 A;  3MBZ A;  1E3U D;  3NDG A;  4KZ4 A;  2RL3 A;  3BFD A;  2J7V A;  1PYY A;  2BG1 A;  1PWD A;  1LL5 A;  5FAQ A;  1AXB A;  3HLB A;  1YQS A;  3ITA A;  5DTS A;  3ZDJ A;  2WKE A;  1I2S A;  2Y2N A;  5EUA A;  5AQ9 A;  1ALQ A;  4OPZ A;  3ZG0 A;  3BFF A;  3BEC A;  2ZQA A;  3VSK A;  5IHV A;  4RYE A;  3GV9 A;  3OPP A;  5JYP A;  4JLF A;  5GHY A;  1RGZ A;  2QZ6 A;  4Y0O A;  3C5A A;  3G30 A;  4IED A;  3S4X A;  4P6B A;  1JWP A;  4X69 A;  5FAO A;  5CEB A;  3IXB A;  3WS0 A;  1O07 A;  5GLA A;  2Q9N A;  2J9P A;  2V2F F;  1CI8 A;  3IH8 A;  3IWO A;  5AQ7 A;  2H0Y A;  4O7D A;  3UO9 A;  2ZM8 A;  1XA1 A;  4NBI A;  3PBN A;  4JF6 A;  4C3Q A;  4DE0 A;  3NY4 A;  1ERQ A;  4JF5 A;  5FA7 A;  5FQK A;  2H10 A;  5CTN A;  1DJC A;  2XGN A;  4JXS A;  4K0W A;  4F94 A;  2OSU A;  2E8I A;  3VOY A;  3N8L A;  4X6T A;  2X01 A;  1H5X A;  4FCF A;  4RR7 A;  5HAR A;  3EQV A;  1C3B A;  1K25 A;  1PWC A;  2EXA A;  3IQA A;  4S2P A;  4WMC A;  1FQG A;  5CXW A;  3UDF A;  1YMX A;  4UA9 A;  3PBO A;  3Q07 A;  5U47 A;  4C75 A;  4X68 A;  3AGF A;  3VP1 A;  2Z2L B;  5FI6 A;  4EBL A;  1GHP A;  4L0L A;  1JKE A;  4GKU A;  5J61 A;  4QD4 A;  1KE4 A;  1K6S A;  4OKP A;  1FCN A;  5G18 A;  3MZF A;  4OQ0 A;  4JXV A;  3HUO A;  5CER A;  3BFG A;  4QY5 A;  4ZTK A;  4DE1 A;  3DW0 A;  1TC5 A;  4JKT A;  4LCM A;  4WBG A;  4H8R A;  2H5S A;  1CEF A;  2EX6 A;  3IF6 C;  1IEM A;  1ES5 A;  2ZD8 A;  2CC1 A;  3OPR A;  4KZ9 A;  1YLZ A;  2Y2P A;  1JTD A;  1Y54 A;  3I7J A;  3Q7Z A;  3S22 A;  4HBT A;  3KOD A;  2VGK A;  4FH2 A;  2JC7 A;  2XLN A;  3IWQ A;  1PIO A;  3GR2 A;  4IBX A;  1GCE A;  4KQR A;  4WZ5 C;  3W8K A;  3CZD A;  1TDL A;  4N1X A;  1DJB A;  4R4R A;  1BSG A;  3HVF A;  3KOB A;  3A3F A;  4IVK A;  3GMW A;  5FI2 A;  2Y2H A;  2WAD A;  1XKZ A;  3FV7 A;  3HBR A;  1Z6F A;  4RRA A;  1IKI A;  1DY6 A;  1HTZ A;  1IYP A;  2XFT A;  4S2I A;  3BYD A;  2WZX A;  3SH9 A;  3N8R A;  4BLM A;  3HLC A;  4GD6 A;  4DDS A;  1E3U A;  3ZFZ A;  3LMU A;  5FQI A;  3NBL A;  4E3J A;  1IYS A;  2JE5 A;  3ZG9 B;  5KZH A;  4ZJ1 A;  1YLJ A;  2HKZ A;  1EI5 A;  3GVB A;  5A91 A;  1J9M A;  4FD8 A;  1HZO A;  4KZ7 A;  1W5D A;  3UNW A;  1SDN A;  3G2Y A;  3NCK A;  1HVB A;  3MKE A;  3PBS A;  2PU4 A;  1M6K A;  4QY6 A;  1Y2Q A;  3OCN A;  4P0M A;  4S0J A;  3PBQ A;  2HP6 A;  5DF7 A;  2JCH A;  4OOM A;  4OLD A;  4BD0 A;  2XR0 A;  4MBH A;  1NJ4 A;  2OLV A;  3KNF A;  1K57 C;  1BLC A;  4HES A;  1GA0 A;  4FSF A;  3W4O A;  1YT4 A;  2RCX A;  3DWZ A;  2FFY A;  3LY3 A;  1K55 A;  4NK3 A;  1ESU A;  4RX3 A;  1VQQ A;  3ZGA B;  4RRK A;  1JWV A;  1VM1 A;  3M2K A;  1CEG A;  1ES4 A;  4E6W A;  4WM9 A;  3Q81 A;  5CHU A;  2Y2G A;  3E2L A;  1O7E A;  5CED A;  3EQU A;  4E3K A;  1BUE A;  5M1A A;  4RRM A;  1LL9 A;  1MXO A;  1ONH A;  3PBT A;  3Q82 A;  5FAP A;  1ES2 A;  2XEP A;  2IWC A;  2XDM A;  3DTM A;  2Y2I A;  4P85 A;  4RR9 A;  1QME A;  3UDX A;  1H8Y A;  3PAE A;  4RRI A;  1K54 C;  3HRE A;  3LMT A;  3PTE A;  4LV2 A;  5F83 A;  1ZKJ A;  3PD4 A;  1JWZ A;  3P98 A;  3Q7V A;  4S2J A;  3RJU A;  5DF9 A;  5CGX A;  4OPQ A;  4KG2 A;  4BD1 A;  4EQI A;  4QU3 A;  1BZA A;  2HDS A;  3M2J A;  3Q1F A;  5EEC A;  4DF6 A;  1YM1 A;  3LO7 A;  3FZC A;  2J8Y A;  2ZC3 B;  2WKI A;  3G4P A;  4OH0 A;  2WAF A;  2XF3 A;  5E2G A;  1YLW A;  3WS4 A;  2Y91 A;  2R9W A;  3IHA A;  1K6R A;  4X53 A;  3VP0 A;  1PW8 A;  1FSW A;  3ZCZ A;  5EVI C;  1OME A;  4RR6 A;  3KO3 A;  1K4F A;  4ZJ3 A;  2IWB A;  4EBN A;  3UPN A;  5F1F A;  3V39 A;  3Q7V B;  5F82 A;  1MWT A;  2WUQ A;  4GZB A;  1IYQ A;  1LHY A;  4LEN A;  1BT5 A;  2Q9M A;  4GOG A;  4JF4 A;  1JTG A;  1PZO A;  5E43 A;  1KGG A;  2A49 A;  3GQZ A;  3WS1 A;  1S6R A;  2FFF B;  4NET A;  4R0Q A;  4A5R A;  1WYC A;  4PM7 A;  4CPK A;  4RVA A;  4E6X A;  2ZQ7 A;  4QB8 A;  4XUX A;  5E2H A;  4ZBE A;  4PM9 A;  3TG9 A;  3OPL A;  4GD8 A;  1SCW A;  4QJG A;  2PU2 A;  1W8Y A;  2R9X A;  3MXR A;  3OCL A;  3OPH A;  4K91 A;  4LV1 A;  3M6B A;  4RX2 A;  3UDI A;  5A92 A;  1FCO A;  1XP4 A;  3V3S A;  4N9L A;  2EX9 A;  2Z2M B;  3AGD A;  3FYZ A;  4OQH A;  5E2F A;  3UPP A;  4EV4 A;  4D2O A;  1K38 A;  3C7V A;  3AGE A;  4PM5 A;  4BL3 A;  2EFU A;  5AQB A;  1WE4 A;  1WYB A;  3UN7 A;  3JYI A;  1FR6 A;  3S1Y A;  4LV0 A;  2ZJ9 A;  3SOI A;  2WYX A;  4LV3 A;  2EFX A;  1W7F A;  4WEL A;  4S2L A;  1DJA A;  5HAI A;  4RRD A;  3WRZ A;  4E3L A;  5HW3 A;  2WZZ A;  1KVL A;  1PWG A;  1MBL A;  2C6W B;  2P9V A;  2Y4A A;  3B3X A;  3D4F A;  3GTC A;  4OPR A;  1ZC2 A;  4UA7 A;  5CGW A;  2HL1 A;  2WGW A;  3PAG A;  2H0T A;  3A3J A;  4BQM A;  3LCE A;  1TVF A;  1BLS A;  1TEM A;  4RRQ A;  4M3K A;  4QHC A;  3HUM A;  5CHM A;  4Q8I A;  1KE0 A;  4UAA A;  2HDQ A;  3UE1 A;  4OLG A;  1ERO A;  1IYO A;  2EX8 A;  2Y2L A;  3VSL A;  3BEB A;  4OQI A;  4UHU A;  3LY4 A;  5DTK A;  3SS3 A;  2ZM2 A;  3V5M A;  3MXS A;  4B4Z A;  4DRT A;  4DXC A;  3BFC A;  1YLY A;  1M40 A;  1YMS A;  3G31 A;  3O88 A;  4S2N A;  5HX9 A;  1K56 D;  3O86 A;  3MZE A;  1RCJ A;  5EVL A;  4PM8 A;  5E2E A;  2P9V B;  4RRB A;  1XA7 A;  2QMI A;  3HL9 A;  2WGW B;  4MBF A;  2B5R A;  4OOL A;  4KZA A;  3KOC A;  1FCM A;  4K0X A;  1J7G A;  1PI5 A;  5DTT A;  1MWR A;  2UWX A;  3DWK A;  3LMV A;  3IT9 A;  2Y55 A;  4KZ8 A;  4DE3 A;  1G6A A;  3PD3 A;  4EUZ A;  1NYM A;  1IKG A;  1U60 A;  1MY8 A;  3A3D A;  3UE0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...