1LSNA

Thermal stability determinants of chicken egg-white lysozyme core mutants: hydrophobicity, packing volume and conserved buried water molecules
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
129
structure length
129
Chain Sequence
KVFGRCELAAAMKRHGLDNYRGYSLGNWVCAAKFESNFNTQATNRNTDGSTDYGILQINSRWWCNDGRTPGSRNLCNIPCSALLSSDITAAVNCAKKIVSNGNGMNAWVAWRNRCKGTDVQAWIRGCRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(o-glycosyl)
molecule keywords HEN EGG WHITE LYSOZYME
publication title Thermal stability determinants of chicken egg-white lysozyme core mutants: hydrophobicity, packing volume, and conserved buried water molecules.
pubmed rcsb
source organism Gallus gallus
total genus 45
structure length 129
sequence length 129
ec nomenclature ec 3.2.1.17: Lysozyme.
pdb deposition date 1994-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00062 Lys C-type lysozyme/alpha-lactalbumin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.530.10 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 1lsnA00
1J1PY 4NIJA 2G4NA 5F14A 1LYOA 3B0KA 3WU7A 1LZ1A 4XJHA 4DD3A 4Z3MA 1B5YA 4HPIA 1LKSA 1GE1A 1IC7Y 1DPWA 3WU8A 5IHGA 5APEA 4LT1A 4LFXA 3RNXA 4H9HA 5M1YA 1GF8A 2HEFA 4WM6A 4PPOA 4YEMA 1YL0X 3LZTA 1D0LA 2W1YA 4II8A 5LXWA 1QTEA 4M6DA 1A2YC 1I20A 1LZNA 4HJVA 4N8ZA 3WH1A 3WPKA 1NDGC 3ZEKA 5KKIA 3SP3A 1GD6A 1GF9A 1HF4A 2HU1A 2ZYPA 4EOFA 4C3WA 3RZ4A 4LYZA 5FCPA 1HEMA 1OUBA 5L9JA 4I0CA 4WMGA 4DDAA 4NSJA 1YAMA 4DD0A 2Z2FA 3J6KA 4LT0A 3MGWA 5LVHA 1LSBA 1LJGA 1IWZA 3CSQA 5HNLA 1BVXA 1YAPA 1LSNA 5DM9A 1LTMA 3TMVA 1GXV2 1LJNA 4LYMA 4NG1A 3TXJA 1ALCA 2H9JA 3AZ4A 5ILCA 1GWDA 5LIOA 2ZYCA 3P65A 2D4IA 3A3RX 5FEKA 1FN5A 2VB1A 1HELA 3GXKA 2HEDA 1JTOL 1JTTL 4B4IA 1IP4A 1BVKC 3TXEA 4H8XA 1LHHA 4WLDA 1DZBX 3WW5A 4ET8A 3AZ7A 1CJ9A 4H9CA 4J0LA 1GFEA 5B59A 2MEGA 4H9EA 1IORA 3LYMA 2Z37A 1IR8A 5FHWA 4YM8A 1B5VA 1LMOA 1IP6A 5E9RA 1IY4A 2F30A 3WXUA 1CKGA 1B5XA 1LZ6A 5B07A 3WVXA 4Z46A 1OUDA 4MCKA 4CJ2A 208LA 5HLLA 4PGJB 3W6CA 2X0AA 3HBEX 4RW1A 4ET9A 1BB6A 4TSCA 2BQBA 4G4BA 1LJIA 2BQLA 4PRUA 3RU5A 4DC4A 1BB4A 1YKZX 4LYTA 1QUTA 1XGPC 4HPEA 5KXSA 4ZEEA 1GBSA 1H87A 1BB5A 4GCDA 4IATA 4NY5A 3D3DA 4DWXA 4WL7A 1CKHA 1F0WA 1GB2A 1GAZA 1OUIA 1YQVY 3LN2A 4XJIA 1IWVA 3TXGA 4WM4A 4LGKA 4O34A 4DD7A 4H1PA 3ZVQB 3HFMY 4Z41A 1REZA 4OWCA 1GF4A 2XJWA 1LYYA 1UIGA 5HNCA 2ZNXY 3TXIA 2BQJA 3N9CA 1LZGA 1IOQA 4G4CA 2BQHA 4HP0A 1UIAA 2BQCA 1HFYA 4GN4A 1YAOA 1G7IC 3AW6A 3E3DA 4NGJA 5I4WA 5KKJA 4QEQA 1JHLA 1DKKA 2F4GA 1LSAA 1FLYA 2EQLA 2H9KA 4HTQA 3A90A 4N9RA 4PJ2C 5KXRA 4IJ4A 1W08A 1REXA 5FSTA 1PS5A 4I8SA 1JWRA 1HFZA 1WQNA 3A8ZA 3B72A 4FJRA 4J1BA 1I1ZA 1TAYA 3G3AB 5KXXA 4WO9A 2HEAA 4TTDA 4BAPA 4MR1A 4N5RA 1FKQA 3EXDA 4ETDA 1YKYX 2HUBA 1LKRA 4NGKA 1LZBA 2I25L 1GB5A 2Z38A 2FYDA 4LFPA 3A94A 2DQFC 2CJLA 4BADA 1UIHA 2D91A 1RFPA 1WQOA 2MEEA 1JKAA 4WOAA 2D4JA 8LYZA 1QUSA 5I54A 1AKIA 1LMCA 1IEEA 1B5UA 4ETAA 1REYA 1D9UA 4LT3A 1UCOA 5LVGA 1LHJA 1C10A 4NHIA 5AMYA 1IOTA 193LA 1LSDA 1AM7A 1P2CC 1IOSA 1CKCA 1WTNA 1LMPA 2HEEA 2YBMA 3M3UA 4GLAA 2BPUA 2MEFA 4GN5C 5FDJA 2DQAA 4OW1A 2AUBA 4ETEA 1JISA 1LMAA 1ZMYL 1GBZA 2C8PA 1CKFA 3BKHA 3ATNA 3A93A 1LSFA 5LINA 1LMNA 1MELL 2BQEA 3HBDA 1IP1A 4NGIA 1MLCE 1LZSA 3OK0A 1C08C 1NHEA 5A3ZA 1VFBC 2XBSA 1VDPA 4ZFPA 4NG8A 2ZWBA 2LYOA 154LA 3AZ6A 1KXYA 4DDCA 4GN3A 2G4PA 2DQDY 4WM3A 1GE4A 4HTKA 1EQ4A 3J4GA 4YEOA 5T3FA 1TDYA 3RT5X 5I4YA 2D4KA 3AYQA 1DI5A 1LSPA 4WO6A 1LHMA 3WL2A 2ZNWY 5LVKA 4NEBA 2HECA 1QDRA 2DQJY 1OP9B 1HEPA 1IWTA 1YL1X 2RSCA 3IJVA 1JJ3A 1LSEA 1GFJA 1XEJA 4OWEA 4X3BA 5LYMA 133LA 9LYZA 3G3BB 1YAQA 1CJ7A 1OUAA 1LHIA 4W96A 4KXIA 3WPJA 3LHMA 1GFGA 1N4FA 1GF3A 4IASA 2IHLA 4M4OA 5KXLA 1ZV5L 2XBRA 1HMKA 2W1LA 2Z39A 3BKVA 1PZYA 2D6BA 4QGZA 4RW2A 4HV2A 4UWNA 4QY9A 1CJ8A 3K3TA 1IC4Y 3KAMA 1LMQA 3IJUA 4NHPA 2CGIA 1JKCA 5KXWA 1BB3A 5D5CA 1INUA 4NGLA 4N1EI 5B06A 1GFAA 3F6ZA 1LSCA 2DQEY 4AGAA 1QTKA 4NGYA 5LAFA 2BQIA 2MEIA 1GEZA 4Z98A 1VATA 2XTHA 1VDSA 3WULA 1JITA 1XFPL 3WUMA 2MECA 1LYSA 3WU9A 4ETBA 1JKDA 2YBHA 1CNSA 3FE0A 3WVYA 2Z12A 4OWHA 1OUFA 5C6IA 1LZDA 1GB6A 1BB7A 4HTNA 2A7FA 5FELA 5F81A 1ZVYB 1GFTA 1RI8B 4G4HA 5F16A 2NWDX 4R0FA 4ETCA 1G7JC 1HENA 4DYGA 5DN5A 1D0KA 1JJ1A 4PRQA 2HTXA 3B6LA 1GDXA 4WLTA 5E4PA 1JSEA 4ANRA 4CGEA 1UICA 1IWWA 1HEWA 4J7VA 4ZIXA 4LZTA 3A95A 5JENB 4RDSA 5II3A 4NSGA 1LZAA 1HSWA 5IELA 1GF7A 4XYYA 1JUGA 2MEBA 1XGQC 1GBWA 2YBLA 1JEFA 4TSBA 1RCMA 3GXRA 135LA 5DN4A 1B9OA 4BAFA 1IX0A 1NKHA 4GCEA 4B0DA 1D6QA 1T3PA 1OQMA 3B0IA 1IR7A 5KXNA 3W6DA 1H6MA 5KJ9A 4CHXA 2WARA 1G7MC 1NBYC 3CSZA 2BQKA 2HU3A 2I26L 2ZIKA 2BLYA 2BLXA 1HEOA 2CDSA 3AGIA 4ML7A 1RJCB 1LAAA 1TCYA 5F9UA 3WUNA 2DBTA 3ZVQA 3WW6A 1LHLA 2Q0MX 1HNLA 2YVBA 5LVIA 5HMVA 1IP3A 1WQPA 6LYTA 3QY4A 5C6JA 1LZ5A 3A92A 3T6UA 5I4XA 1TEWA 1IWUA 4E3UA 1LJFA 3VWOA 4LYCA 1VAUA 4PHIA 1SLYA 4WM2A 1LZTA 1LSMA 1LZYA 3OJPA 4OWBA 4HSFA 5D5FA 3WYHA 2YBJA 2YBNA 3AW7A 5L3IA 1B7OA 2GV0A 1KIQC 3P66A 4NGOA 1O23A 1FBIX 4H9BA 4YOPA 3WMKA 2BQDA 2F2NA 4UWVA 4CFOA 3RW8A 1LSGA 4DD2A 1BGIA 4H91A 194LA 1IOCA 4H8YA 4YENA 3M18B 1KIPC 4MSTA 1LJ3A 1GFVA 1OUHA 1YKXX 1LCNA 2YBIA 3B0OA 3A96A 1LPIA 4NGZA 1FDLY 1BHZA 5B1GA 1C46A 4FDYA 4UWUA 4WM5A 1D0MA 1GFUA 1KXWA 1XGTC 2HEBA 4AXTA 3AJNA 4BS7A 4DD1A 1HHLA 5A3EA 1FLWA 1GB0A 4DD9A 3A3QA 2EIZC 5KXKA 1XGRC 4LYBA 3WUAA 3LYOA 1JTPL 4A7DA 1XEKA 1RE2A 5KXMA 1TBYA 2LHMA 4H93A 3EBAB 2Z2EA 1C7PA 1VDQA 1A4VA 2LZTA 4HV1A 4LT2A 1JIYA 5APFA 1UUZC 5I53A 1B7PA 4XN6A 1IP2A 4CFPA 1JJ0A 1UIDA 2YDGA 5KXTA 5KXOA 1IC5Y 1B7SA 1HEQA 1GBXA 2ZILA 4J1AA 5B1FA 1WQQA 1WQMA 1GE2A 2DQHY 2PC2A 5APDA 5I5QA 3TMXA 3A6CY 2I6ZA 1IP7A 1VEDA 1AZFA 3TMUA 3TXHA 1GAYA 2Z19A 1GE3A 1OUGA 3IWRA 1QSAA 3CT0A 3A34A 1NBZC 3QE8A 4NHSA 1LJHA 1QDTA 1LJKA 1B7MA 1V7SA 5F9XA 3T36A 1UACY 1GB9A 1UC0A 207LA 1QQYA 1LZ4A 1HSXA 5IDDA 2BQOA 4XJBA 1GFRA 1I56A 1UIFA 5KXPA 4DT3A 3TXDA 1HERA 1B7NA 2C8OA 4L41A 1LHKA 3AGHA 3WPLA 4GCCA 1B5WA 5LVJA 1GBYA 1KXXA 5EBHA 1NQIA 1FLQA 3N9EA 132LA 1AT5A 4P2EA 3TXKA 1GFHA 1UIBA 1JPOA 1QSWA 4G49A 2DQCY 1F6SA 4WLYA 4N1CC 1GXXA 1VDTA 1DI4A 1GE0A 1LJJA 1GB3A 4B49A 4B4JA 1XEIA 1B7LA 1GB8A 1BWHA 5ILFA 1DPXA 2FBDA 2LYZA 1JSFA 3A6BY 2Y8PA 4NWEA 4RLNA 1T6VL 2LZ2A 3P68A 1UBZA 5C6LA 1JKBA 3P64A 5HQ1A 1F10A 4XJDA 1F6RA 1ZVHL 2Z18A 1B2KA 1J1XY 1SQ2L 4H9FA 3LYZA 2DQIY 1HFXA 1WTMA 3W3EA 1OUEA 2BQAA 4DDBA 4WG1A 1GF0A 5J7CA 1FKVA 3AGGG 3HBHA 3WXTA 5B05A 1IWYA 2DKVA 3FI7A 1GEVA 1IR9A 3LZ2A 4KL7A 3N9AA 4H92A 4H9AA 1B7QA 1LJ4A 5LA5A 2F4AA 1REMA 2CWIA 4XJGA 2MEHA 4OOOA 5HMJA 1XSFA 1LMTA 4RLMA 4WL6A 2FBBA 1IIZA 5K7OA 1WQRA 1GB7A 4WM1A 1IO5A 3A67Y 1DKJA 5APCA 1DQJC 1IP5A 1GF5A 1GHLA 4NSIA 3W6AA 2N5ZA 3CSRA 2G4QA 1LYZA 1UA6Y 3CQLA 2BQFA 4TWSA 4W94A 4XENA 7LYZA 5LYTA 1G7LC 1E8LA 5DL9A 1CKDA 1W6ZA 1WVVA 2FYCA 4H8ZA 4D9ZA 1WVUA 2MEDA 4NSHA 4TUNA 1C45A 3QNGA 1HC0A 1DI3A 3A91A 1LOZA 1OUJA 2LYMA 3TXBA 1YROA 1B7RA 4EMNA 1Z55A 2EPEA 1FLUA 1LSYA 5LYZA 3TMWA 1LZCA 1BWJA 2EKSC 4NGWA 4B1AA 1GF6A 4KT3A 2BAAA 5LA8A 4H90A 4GCBA 4TX7A 3EO5A 4WLXA 1G7HC 3AZ5A 4B4EA 2BQGA 2BQMA 3AB6A 1GBOA 2ZIJA 4H9IA 2YSSC 4QDNA 4U3XB 5DLAA 1YILA 2ZQ3A 3CT1A 2W1MA 5L3HA 1B0DA 4C5FA 1LZEA 1IVMA 1GDWA 4N0JA 1V7TA 4WG7A 4KPMA 3P4ZA 2H5ZA 1J1OY 1C43A 4GCFA 3W6BA 4HJZA 4NGVA 1LSZA 4OOTA 1NMMA 1QIOA 1LZ9A 1NWGA 1DXJA 1BQLY 1AT6A 4H94A 4NFVA 5KY1A 1UIEA 3LYTA 3W6FA 4GLVA 1NDMC 4HJYA 4NHQA 1KIRC 3CT5A 153LA 4XJFA 3ULRA 2ZQ4A 4OWAA 2DQGY 4NHTA 2B5ZA 4G9SA 5LAGA 3W6EA 1LZRA 1EQ5A 1IY3A 2IFFY 2W1XA 3ATOA 1EL1A 1NF5A 1D6PA 3TXFA 4LYOA 1GPQC 1YANA 1OUCA 2A7DA 1HMLA 3EMSA 134LA 4NWHA 1EQEA 4YF2A 3CB7A 1GFKA 2BQNA 4XADA 2MEAA 1B5ZA 1BWIA 6LYZA 3D9AC 1LZ8A 5KXZA 1YIKA 1CJ6A 1LJEA 4R6CA 1XGUC 5KXYA 1IWXA
chains in the Genus database with same CATH superfamily
2G4NA 3B0KA 4DQ7A 1LZ1A 3NY9A 3WU8A 4WM6A 4PPOA 1L12A 4YEMA 1LYDA 4W53A 2W1YA 4M6DA 2HUKA 1HF4A 4LYZA 5FCPA 5L9JA 4DDAA 223LA 4LT0A 3CSQA 1LSNA 1C68A 1L82A 4LYMA 2H9JA 3HTGA 1L65A 188LA 2RBNA 4H8XA 4WLDA 4W57A 3AZ7A 142LA 3G3VA 1C6CA 1IORA 1IR8A 4YM8A 178LA 2O79A 5E9RA 3WXUA 151LA 3RZEA 4MCKA 208LA 5HLLA 4ET9A 4G4BA 1YKZX 5KXSA 4ZEEA 1H87A 4GCDA 245LA 1L43A 3LN2A 1LYJA 1DYEA 3G3WA 5LZMA 3ZVQB 3HFMY 4OWCA 1GF4A 1LYYA 1UIGA 1LZGA 1UIAA 4GN4A 5I4WA 3AW6A 3CDVA 1JHLA 2H9KA 4N9RA 2L78A 1REXA 3HT9A 1JWRA 1WQNA 5KXXA 1C65A 1I1ZA 2HEAA 148LE 1G1WA 4MR1A 3EXDA 1LKRA 2Z38A 4LFPA 1GB5A 3A94A 8LYZA 3GUJA 1AKIA 2B6WA 1IEEA 4ETAA 1D9UA 4LT3A 1L77A 1UCOA 1C10A 4NHIA 1CKCA 1WTNA 104LA 2BPUA 2MEFA 4GN5C 2B75A 111LA 4ETEA 3ATNA 222LA 1C6HA 1QS5A 1L05A 2LZMA 4ZFPA 4NG8A 3AZ6A 1KXYA 1L40A 4ARPA 119LA 1OWZA 1LYEA 4HTKA 3J4GA 4YEOA 3VW7A 1TDYA 3RT5X 120LA 1JQUA 2ZNWY 2DQJY 1L14A 1D3FA 213LA 3GUNA 4OWEA 5LYMA 133LA 2OE9X 1L79A 161LA 1HMKA 1PZYA 2D6BA 1L94A 3K3TA 1IC4Y 2CGIA 1C69A 5D5CA 190LA 1GFAA 5LAFA 3HU8A 4Z98A 3HWLA 3HH4A 3WULA 2MECA 171LA 1LYSA 1LZDA 5FELA 1ZVYB 1GFTA 3GUIA 5F16A 1HENA 4DYGA 3FA0A 3C81A 4PRQA 2HTXA 4EPFA 3HUQA 1UICA 2MEBA 1XGQC 2YBLA 4TSBA 114LA 4B0DA 5KXNA 3W6DA 2WARA 182LA 2I26L 1TCYA 3ZVQA 3WW6A 2Q0MX 159LA 1L53A 2YVBA 164LA 1WQPA 6LYTA 1WTHA 5C6JA 3T6UA 1QT7A 3CDOA 4LYCA 1VAUA 4WM2A 3OJPA 1QTDA 2YBNA 3SB8A 5L3IA 2GV0A 1L25A 1O23A 1QT4A 211LA 4DD2A 3SBBC 1KIPC 4MSTA 1LJ3A 1LCNA 3L2XA 1L73A 1GFUA 3AJNA 3RUNA 200LA 3A3QA 5KXKA 4A7DA 1RE2A 227LA 1LWGA 1TBYA 4H93A 1G0MA 2LZTA 5I53A 4XN6A 1UIDA 5KXTA 1B7SA 1HEQA 1WQQA 3GUKA 5APDA 5I5QA 3TMUA 2Z19A 1L04A 1OUGA 1LYGA 1NBZC 3GULA 1GB9A 1UC0A 3CDQA 224LA 4I7PA 1L45A 1GFRA 2OEAX 1HERA 3AGHA 1GBYA 1UIBA 1QSWA 2DQCY 4WLYA 4N1CC 1DI4A 4B4JA 1B7LA 1CV5A 1DPXA 1L54A 1L29A 4NWEA 1JKBA 1F10A 221LA 4XJDA 1LGWA 2RB0X 1B2KA 1FKVA 3FI7A 1CV3A 4KL7A 244LA 139LA 2F4AA 2MEHA 3C82A 3HTFA 1GB7A 5APCA 1GHLA 4W55A 4NSIA 3W6AA 1L07A 4XENA 1SSYA 1E8LA 1QT3A 1WVVA 4H8ZA 215LA 4NSHA 3QNGA 1DI3A 3TXBA 146LA 1LSYA 1LZCA 1BWJA 2EKSC 1G0KA 5LA8A 4H90A 4GCBA 3CDRA 3AZ5A 2BQMA 4H9IA 152LA 5L3HA 1L24A 1YILA 2W1MA 1LZEA 4N0JA 1OV7A 4W51A 4KPMA 3P4ZA 1L47A 1C43A 1PQMA 1B6IA 4NHTA 2B5ZA 4G9SA 3DMVA 1EL1A 1OUCA 4YF2A 1L36A 3CB7A 3DMXA 192LA 3D9AC 1PQJA 5KXZA 2O4WA 5KXYA 1KNIA 1IWXA 3EMLA 1LYOA 3WU7A 4XJHA 5APEA 5M1YA 3DN2A 1L30A 1YL0X 1L61A 1D0LA 1D3MA 4II8A 3OE6A 3WH1A 4ZPUA 1GF9A 1XEPA 2HU1A 1G07A 4WMGA 4NSJA 1YAMA 3J6KA 4W52A 1L48A 3MGWA 261LA 1YAPA 3C8SA 2A4TA 108LA 5DM9A 206LA 3TMVA 2HUMA 1ALCA 5ILCA 1GWDA 4K5YA 2ZYCA 1L31A 233LA 2D4IA 5FEKA 1FN5A 3PBLA 1IP4A 1LHHA 1L85A 4H9CA 1GFEA 2MEGA 1NHBA 1CV1A 1LMOA 3WVXA 1B5XA 1OUDA 2B6YA 2Q9EA 4CJ2A 2NTGA 3HBEX 2OE7X 2Q9DA 4TSCA 1L98A 1BB4A 1P56A 1XGPC 1BB5A 1CKHA 1F0WA 1GB2A 3TXGA 4LGKA 107LA 1L71A 3HUKA 1L0KA 4Z41A 1L89A 1L59A 176LA 1ZURA 2RBPA 3D4SA 1L69A 2F4GA 1DKKA 1KW7A 1LSAA 1FLYA 1KY1A 4HTQA 4PJ2C 5KXRA 1LYHA 2F32A 2RH1A 4TTDA 4N5RA 4EKQA 4BADA 1CU2A 1WQOA 3L64A 1LMCA 1C6IA 1B5UA 1L80A 2HEEA 1IOSA 4GLAA 1L96A 2AUBA 4OW1A 1JISA 1XJTA 1ZMYL 2RAYX 2C8PA 3BKHA 1LMNA 3HBDA 1IP1A 1L66A 1VDPA 1SX7A 2LYOA 154LA 130LA 1L58A 243LA 2ANVA 5I4YA 2D4KA 3AYQA 1DI5A 1LSPA 3WL2A 1LHMA 5LVKA 4NEBA 2HECA 1YL1X 1XEJA 1LHIA 4KXIA 3WPJA 1GFGA 1PQIA 4M4OA 2XBRA 3BKVA 1LYIA 4QY9A 1OV5A 3IJUA 3GUMA 4GRVA 1JKCA 3HU9A 4NGLA 4N1EI 5B06A 1L75A 1LSCA 4AGAA 1QTKA 4NGYA 103LA 1L97A 3HUAA 1JITA 1XFPL 3WU9A 4ETBA 2YBHA 1D3NA 3WVYA 1OUFA 1GB6A 4G4HA 2NWDX 216LA 1G1VA 201LA 1L09A 1DYDA 1GDXA 1JSEA 3DN1A 1LI3A 150LA 4NSGA 1JUGA 228LA 3GXRA 135LA 1LI6A 1IX0A 4EKPA 199LA 3B0IA 2HU3A 1L81A 138LA 123LA 1QSBA 1HEOA 3AGIA 1RJCB 5F9UA 3WUNA 1LHLA 3DN3A 5LVIA 185LA 3A92A 5I4XA 1IWUA 4E3UA 4I7RA 3VWOA 1P5CA 1C67A 4PHIA 5LA5A 5D5FA 1LZYA 4OWBA 1P64A 1B7OA 2CUUA 1G0PA 1C6FA 2F47A 1L26A 3F9LA 1C6PA 1LSGA 2OE4X 1BGIA 4H91A 4H8YA 3NYAA 1XJUA 1OUHA 3DN4A 1LPIA 229LA 1FDLY 1BHZA 1C66A 4FDYA 1CTWA 1D0MA 1KXWA 1XGTC 4BS7A 1FLWA 4LYBA 1XEKA 2LHMA 3EBAB 1L99A 2Z2EA 1C7PA 1L01A 1L68A 4CFPA 5KXOA 5B1FA 4LZMA 1P3NA 1GE2A 2DQHY 1L67A 3DN0A 2I6ZA 3TXHA 1LWKA 3IWRA 183LA 3A34A 1QDTA 1T8GA 5F9XA 1UACY 1PQOA 2C8OA 4L41A 5LVJA 1L19A 1FLQA 1GFHA 169LA 1QS9A 4ARMB 1G0GA 1GE0A 1LJJA 4W59A 4ARJA 1XEIA 1GB8A 2FBDA 2LYZA 170LA 1ZYTA 3A6BY 4RLNA 1L62A 3P68A 3P64A 1F6RA 4H9FA 1SQ2L 3W3EA 2DQIY 1HFXA 231LA 1OUEA 4DDBA 1GF0A 5J7CA 2RBRA 3WXTA 5B05A 1GEVA 3N9AA 1B7QA 1REMA 4OOOA 3DN8A 3C7YA 1C64A 2B74A 1L06A 3A67Y 4EPIA 1DQJC 1IP5A 1GF5A 2OTZX 2N5ZA 3CSRA 260LA 1UA6Y 4TWSA 7LYZA 1G7LC 2B70A 1CKDA 1W6ZA 2FYCA 1G0QA 1C6JA 4EMNA 1Z55A 2EPEA 1FLUA 4B1AA 1GF6A 128LA 1G7HC 4W54A 256LA 3V2YA 1GBOA 4QDNA 2YSSC 5B59A 4ARLA 4C5FA 1V7TA 4WG7A 1P7SA 2H5ZA 1DYBA 1L28A 4OOTA 1QIOA 4H94A 4GLVA 153LA 3ULRA 2ZQ4A 3DNAA 4I7TA 1IY3A 2IFFY 1P2RA 3ATOA 1CV4A 4NWHA 1EQEA 1C62A 254LA 1CU0A 1GFKA 242LA 2MEAA 1QTVA 1LZ8A 2QB0B 1LJEA 1L50A 1J1PY 3DKEX 232LA 4DD3A 4Z3MA 4HPIA 4YXCA 4LT1A 3RNXA 4H9HA 1GF8A 1KW5A 3LZTA 1LZNA 1I20A 1P37A 3SP3A 4I7JA 3HTBA 4EOFA 3C8RA 4C3WA 3RZ4A 1HEMA 1OUBA 1QT8A 4I0CA 2F2QA 2Z2FA 127LA 5LVHA 1LSBA 1LJGA 1CX7A 230LA 5HNLA 1LTMA 109LA 1GXV2 4NG1A 3TXJA 3AZ4A 144LA 4I7OA 238LA 2VB1A 3GXKA 2HEDA 1JTOL 4B4IA 1L64A 255LA 1CJ9A 4J0LA 125LA 4ARMA 1G06A 1B5VA 2F30A 1CKGA 1LZ6A 5B07A 1L60A 217LA 239LA 4PGJB 3W6CA 2X0AA 118LA 4PRUA 3RU5A 2BQLA 4DC4A 1L63A 141LA 1QUTA 4HPEA 1OVJA 4IATA 1L20A 167LA 165LA 4ARQB 4DWXA 1P2LA 1OUIA 2Z6BA 4WM4A 4H1PA 1D2YA 1P36A 1REZA 1SSWA 3TXIA 4HP0A 4G4CA 2BQCA 1HFYA 1G7IC 1L32A 3E3DA 5KKJA 3C83A 1L92A 4QEQA 2EQLA 4IJ4A 248LA 1PS5A 4I8SA 3B72A 3A8ZA 4FJRA 4J1BA 3G3AB 4WO9A 1FKQA 1YKYX 1JTMA 1LZBA 112LA 2DQFC 1LI2A 2CJLA 1UIHA 1LYFA 2MEEA 4WOAA 2D4JA 4IAPA 1QUSA 1REYA 1LHJA 5AMYA 1LSDA 193LA 3FI5A 2YBMA 258LA 3M3UA 1LMAA 4OO9A 2XQOA 1LSFA 1MELL 2BQEA 4W58A 1C08C 1NHEA 5A3ZA 163LA 1C63A 1L17A 3OE8A 4GN3A 2G4PA 4WM3A 5T3FA 1EQ4A 2B7XA 158LA 1L13A 1HEPA 3IJVA 3HT6A 2B6XA 3G3BB 1CJ7A 4W96A 1QUDA 3LHMA 4IASA 162LA 2IHLA 1ZV5L 4QGZA 2W1LA 2Z39A 1L52A 4HV2A 1C6QA 1L93A 3KAMA 5KXWA 1BB3A 1L33A 2DQEY 1C61A 3K2RA 2BQIA 2MEIA 1VATA 1K28A 235LA 247LA 1CNSA 3FE0A 257LA 122LA 1BB7A 5F81A 1RI8B 2RBSA 1D0KA 1JJ1A 205LA 3B6LA 4WLTA 1DYCA 196LA 1IWWA 4LZTA 4RDSA 5II3A 4DKLA 1LZAA 1HSWA 5IELA 1GF7A 3ODUA 1L90A 214LA 1ZWNA 1GBWA 3HDEA 5DN4A 1B9OA 4BAFA 1NKHA 1T3PA 4I7MA 4ARQA 1H6MA 5KJ9A 4CHXA 1G7MC 3OE9A 181LA 1NBYC 3GUPA 253LA 4YXAC 4ML7A 2CDSA 2B6ZA 3PDSA 1HNLA 2O7AA 1DYAA 1D3JA 5HMVA 1KY0A 1SLYA 4HSFA 3WYHA 2YBJA 1LPYA 3AW7A 2LC9A 1CUPA 1KIQC 1L70A 4NGOA 4H9BA 4YOPA 2BQDA 4UWVA 3RW8A 1L87A 194LA 1GFVA 3B0OA 4NGZA 5B1GA 137LA 2OU8A 1L35A 1XGRC 3SB5A 3FADA 1VDQA 4LT2A 5APFA 1B7PA 2ZILA 1QT5A 1WQMA 2PC2A 1L46A 3TMXA 3A6CY 1VEDA 1AZFA 1QSAA 175LA 1EPYA 1L18A 3QE8A 160LA 1B7MA 207LA 5IDDA 1DYFA 1L88A 2BQOA 3C8QA 3HH6A 4XJBA 1I56A 5KXPA 4DT3A 3TXDA 3V2WA 1B7NA 3WPLA 4GCCA 3SBAA 1KXXA 1NQIA 3N9EA 2NTHA 3C7ZA 1D2WA 1F6SA 1QUOA 131LA 186LA 4B49A 3F8VA 1BWHA 5ILFA 4LDOA 2Y8PA 1T6VL 2LZ2A 1C6LA 1UBZA 3HH3A 5HQ1A 1OVHA 1L91A 4U3XB 2Z18A 3LYZA 1WTMA 3UONA 4PK0A 4WG1A 3AGGG 2DKVA 3LZ2A 4H92A 1L00A 157LA 1LJ4A 115LA 2CWIA 4XJGA 1L55A 1L49A 1L42A 1OVKA 4WL6A 149LA 1IIZA 5K7OA 1WQRA 4WM1A 1IO5A 1KS3A 2HULA 1DYGA 2G4QA 1LYZA 2BQFA 5LYTA 140LA 2MEDA 1HC0A 1C6KA 1C6EA 1B7RA 5LYZA 1L95A 3TMWA 4NGWA 2BAAA 1C6GA 1L57A 4WLXA 1TLAA 3AB6A 2ZIJA 1L44A 5DLAA 2ZQ3A 3CT1A 4DQ5A 1B0DA 4GCFA 1JTNA 4HJZA 4NGVA 4AQNA 1NMMA 4NFVA 5KY1A 3LYTA 172LA 1KIRC 3GUOA 4OWAA 3DMZA 1EQ5A 241LA 1QUHA 2W1XA 1NF5A 1D6PA 2A7DA 1GPQC 3EMSA 1L11A 1HMLA 251LA 1L83A 1CU6A 2BQNA 2OTYX 1B5ZA 1BWIA 1C6AA 6LYZA 1YIKA 1CJ6A 4NIJA 5F14A 1SWZA 1B5YA 1LKSA 1GE1A 1IC7Y 1DPWA 5IHGA 4LFXA 2HEFA 3QAKA 4DJHA 5LXWA 1QTEA 1A2YC 4HJVA 4N8ZA 3WPKA 1NDGC 3ZEKA 4LDLA 5KKIA 1L16A 1GD6A 2ZYPA 1L27A 3HT8A 4DD0A 1L08A 4I7QA 1L38A 1IWZA 1BVXA 113LA 3SN6R 1LJNA 3C80A 5LIOA 3P65A 3HH5A 3A3RX 1L74A 1HELA 1JTTL 1BVKC 3TXEA 1CU5A 1DZBX 3WW5A 4E97A 4H9EA 3LYMA 2Z37A 262LA 3G3XA 2B6TA 5FHWA 1IP6A 237LA 1IY4A 4Z46A 1C6MA 4RW1A 180LA 1BB6A 2BQBA 1LJIA 4LYTA 1GBSA 1C6TA 1L02A 4NY5A 1L23A 3D3DA 4WL7A 1GAZA 4XJIA 1YQVY 3SB6A 4I7KA 1IWVA 2QARC 250LA 4O34A 4DD7A 1D9WA 1L10A 3HT7A 2XJWA 5HNCA 2ZNXY 2BQJA 3N9CA 1IOQA 2BQHA 4NGJA 1YAOA 259LA 1L84A 3A90A 1W08A 1CVKA 5FSTA 2RBQA 4EKRA 3NY8A 1HFZA 226LA 219LA 1TAYA 4BAPA 1PQDA 4ETDA 2HUBA 4NGKA 2I25L 1L76A 2FYDA 1G0JA 1P46A 2D91A 1RFPA 1JKAA 5I54A 1L22A 129LA 147LA 2ANXA 5LVGA 3OE0A 1IOTA 1AM7A 1P2CC 195LA 1LMPA 1L39A 5FDJA 1L15A 2DQAA 3C7WA 1SWYA 1GBZA 1CKFA 1PQKA 3A93A 5LINA 246LA 102LA 4NGIA 220LA 1MLCE 1LZSA 3OK0A 1VFBC 145LA 2XBSA 3SB9A 4S0WA 4EKSA 2ZWBA 184LA 4DDCA 2DQDY 1GE4A 2LCBA 4WO6A 4DAJA 1QDRA 1OP9B 1IWTA 2RSCA 1JJ3A 212LA 1LSEA 1GFJA 4X3BA 1T8AA 9LYZA 1YAQA 1C6DA 1OUAA 1OWYA 4EXMA 1CU3A 1N4FA 1GF3A 1C6NA 5KXLA 4RW2A 4UWNA 1CJ8A 1LMQA 249LA 4NHPA 225LA 1INUA 1L0JA 3F6ZA 3HTDA 1GEZA 168LA 187LA 2XTHA 1VDSA 4YX7C 3WUMA 1JKDA 1I6SA 2Z12A 3SB7A 4OWHA 5C6IA 4HTNA 2A7FA 143LA 4R0FA 4ETCA 1G7JC 2OU0X 1OYUA 5DN5A 198LA 5E4PA 4ANRA 4CGEA 4ZIXA 173LA 1HEWA 4J7VA 3A95A 2B72A 5JENB 4XYYA 1LGUA 1JEFA 1RCMA 4DQJA 177LA 4GCEA 1T8FA 1D6QA 1OQMA 1IR7A 1QTZA 155LA 1CV0A 3CSZA 2BQKA 1LW9A 2ZIKA 2BLYA 2BLXA 4GBRB 1L37A 1LAAA 2DBTA 3DN6A 1L34A 1LLHA 209LA 5I14A 1IP3A 1L41A 3QY4A 110LA 1LZ5A 2RB2X 1TEWA 1LJFA 1LZTA 1LSMA 1CX6A 1T6HA 3P66A 1FBIX 1P6YA 3WMKA 240LA 2F2NA 4CFOA 1IOCA 4YENA 3M18B 1YKXX 156LA 1C60A 2YBIA 4EJ4A 2RAZX 3A96A 197LA 1C46A 4WM5A 4UWUA 2HEBA 4AXTA 1G0LA 4DD1A 1HHLA 5A3EA 1GB0A 4DD9A 2EIZC 3WUAA 3LYOA 1JTPL 5KXMA 1CUQA 4HV1A 1A4VA 1QTCA 1JIYA 1UUZC 1IP2A 1JJ0A 2YDGA 1IC5Y 1GBXA 4J1AA 3HDFA 1IP7A 234LA 1GAYA 1GE3A 7LZMA 3CDTA 3CT0A 4NHSA 1LJHA 1LJKA 1V7SA 3T36A 1QQYA 1LZ4A 1HSXA 1QTBA 1UIFA 1LHKA 1B5WA 5EBHA 1L03A 132LA 174LA 1AT5A 4P2EA 3TXKA 2RBOA 1JPOA 4G49A 210LA 1GXXA 191LA 1VDTA 1GB3A 1L21A 2RB1X 1JSFA 1QSQA 5C6LA 1ZVHL 4LDEA 1J1XY 166LA 189LA 126LA 2BQAA 3HBHA 1IWYA 1IR9A 4I7SA 2OU9A 4I7NA 1QUGA 4H9AA 1QT6A 5HMJA 1XSFA 1LMTA 4RLMA 2FBBA 1C6BA 1L56A 1DKJA 3JR6A 3CQLA 4W94A 1L86A 5DL9A 4D9ZA 6LZMA 1T97A 1WVUA 4TUNA 1C45A 3A91A 1LOZA 1OUJA 2LYMA 1YROA 4KT3A 1L51A 4TX7A 3EO5A 252LA 4B4EA 2BQGA 1SX2A 218LA 1IVMA 1GDWA 4PJZA 4W56A 1J1OY 1QTHA 3W6BA 1LSZA 1LZ9A 1NWGA 2IGCA 1DXJA 1BQLY 1AT6A 1UIEA 3W6FA 1NDMC 4HJYA 4NHQA 3CT5A 4XJFA 2DQGY 5LAGA 236LA 3W6EA 1LZRA 3LZMA 1LGXA 1L72A 4I7LA 3TXFA 4LYOA 1YANA 134LA 2B73A 4XADA 1CV6A 4R6CA 1XGUC 4ET8A
chains in the Genus database with same CATH topology
2G4NA 3B0KA 4DQ7A 1LZ1A 3NY9A 3WU8A 4WM6A 4PPOA 1L12A 4YEMA 1LYDA 4W53A 2W1YA 4M6DA 2HUKA 1HF4A 4LYZA 5FCPA 5L9JA 4DDAA 223LA 4LT0A 3CSQA 1LSNA 1C68A 1L82A 4LYMA 2H9JA 3HTGA 1L65A 188LA 2RBNA 4H8XA 4WLDA 4W57A 3AZ7A 142LA 3G3VA 1C6CA 1IORA 1IR8A 4YM8A 178LA 2O79A 5E9RA 3WXUA 151LA 3RZEA 4MCKA 208LA 5HLLA 4ET9A 4G4BA 1YKZX 5KXSA 4ZEEA 1H87A 4GCDA 245LA 1L43A 3LN2A 1LYJA 1DYEA 3G3WA 5LZMA 3ZVQB 3HFMY 4OWCA 1GF4A 1LYYA 1UIGA 1LZGA 1UIAA 4GN4A 5I4WA 3AW6A 3CDVA 1JHLA 2H9KA 4N9RA 2L78A 1REXA 3HT9A 1JWRA 1WQNA 5KXXA 1C65A 1I1ZA 2HEAA 148LE 1G1WA 4MR1A 3EXDA 1LKRA 2Z38A 4LFPA 1GB5A 3A94A 8LYZA 3GUJA 1AKIA 2B6WA 1IEEA 4ETAA 1D9UA 4LT3A 1L77A 1UCOA 1C10A 4NHIA 1CKCA 1WTNA 104LA 2BPUA 2MEFA 4GN5C 2B75A 111LA 4ETEA 3ATNA 222LA 1C6HA 1QS5A 1L05A 2LZMA 4ZFPA 4NG8A 3AZ6A 1KXYA 1L40A 4ARPA 119LA 1OWZA 1LYEA 4HTKA 3J4GA 4YEOA 3VW7A 1TDYA 3RT5X 120LA 1JQUA 2ZNWY 2DQJY 1L14A 1D3FA 213LA 3GUNA 4OWEA 5LYMA 133LA 2OE9X 1L79A 161LA 1HMKA 1PZYA 2D6BA 1L94A 3K3TA 1IC4Y 2CGIA 1C69A 5D5CA 190LA 1GFAA 5LAFA 3HU8A 4Z98A 3HWLA 3HH4A 3WULA 2MECA 171LA 1LYSA 1LZDA 5FELA 1ZVYB 1GFTA 3GUIA 5F16A 1HENA 4DYGA 3FA0A 3C81A 4PRQA 2HTXA 4EPFA 3HUQA 1UICA 2MEBA 1XGQC 2YBLA 4TSBA 114LA 4B0DA 5KXNA 3W6DA 2WARA 182LA 2I26L 1TCYA 3ZVQA 3WW6A 2Q0MX 159LA 1L53A 2YVBA 164LA 1WQPA 6LYTA 1WTHA 5C6JA 3T6UA 1QT7A 3CDOA 4LYCA 1VAUA 4WM2A 3OJPA 1QTDA 2YBNA 3SB8A 5L3IA 2GV0A 1L25A 1O23A 1QT4A 211LA 4DD2A 3SBBC 1KIPC 4MSTA 1LJ3A 1LCNA 3L2XA 1L73A 1GFUA 3AJNA 3RUNA 200LA 3A3QA 5KXKA 4A7DA 1RE2A 227LA 1LWGA 1TBYA 4H93A 1G0MA 2LZTA 5I53A 4XN6A 1UIDA 5KXTA 1B7SA 1HEQA 1WQQA 3GUKA 5APDA 5I5QA 3TMUA 2Z19A 1L04A 1OUGA 1LYGA 1NBZC 3GULA 1GB9A 1UC0A 3CDQA 224LA 4I7PA 1L45A 1GFRA 2OEAX 1HERA 3AGHA 1GBYA 1UIBA 1QSWA 2DQCY 4WLYA 4N1CC 1DI4A 4B4JA 1B7LA 1CV5A 1DPXA 1L54A 1L29A 4NWEA 1JKBA 1F10A 221LA 4XJDA 1LGWA 2RB0X 1B2KA 1FKVA 3FI7A 1CV3A 4KL7A 244LA 139LA 2F4AA 2MEHA 3C82A 3HTFA 1GB7A 5APCA 1GHLA 4W55A 4NSIA 3W6AA 1L07A 4XENA 1SSYA 1E8LA 1QT3A 1WVVA 4H8ZA 215LA 4NSHA 3QNGA 1DI3A 3TXBA 146LA 1LSYA 1LZCA 1BWJA 2EKSC 1G0KA 5LA8A 4H90A 4GCBA 3CDRA 3AZ5A 2BQMA 4H9IA 152LA 5L3HA 1L24A 1YILA 2W1MA 1LZEA 4N0JA 1OV7A 4W51A 4KPMA 3P4ZA 1L47A 1C43A 1PQMA 1B6IA 4NHTA 2B5ZA 4G9SA 3DMVA 1EL1A 1OUCA 4YF2A 1L36A 3CB7A 3DMXA 192LA 3D9AC 1PQJA 5KXZA 2O4WA 5KXYA 1KNIA 1IWXA 3EMLA 1LYOA 3WU7A 4XJHA 5APEA 5M1YA 3DN2A 1L30A 1YL0X 1L61A 1D0LA 1D3MA 4II8A 3OE6A 3WH1A 4ZPUA 1GF9A 1XEPA 2HU1A 1G07A 4WMGA 4NSJA 1YAMA 3J6KA 4W52A 1L48A 3MGWA 261LA 1YAPA 3C8SA 2A4TA 108LA 5DM9A 206LA 3TMVA 2HUMA 1ALCA 5ILCA 1GWDA 4K5YA 2ZYCA 1L31A 233LA 2D4IA 5FEKA 1FN5A 3PBLA 1IP4A 1LHHA 1L85A 4H9CA 1GFEA 2MEGA 1NHBA 1CV1A 1LMOA 3WVXA 1B5XA 1OUDA 2B6YA 2Q9EA 4CJ2A 2NTGA 3HBEX 2OE7X 2Q9DA 4TSCA 1L98A 1BB4A 1P56A 1XGPC 1BB5A 1CKHA 1F0WA 1GB2A 3TXGA 4LGKA 107LA 1L71A 3HUKA 1L0KA 4Z41A 1L89A 1L59A 176LA 1ZURA 2RBPA 3D4SA 1L69A 2F4GA 1DKKA 1KW7A 1LSAA 1FLYA 1KY1A 4HTQA 4PJ2C 5KXRA 1LYHA 2F32A 2RH1A 4TTDA 4N5RA 4EKQA 4BADA 1CU2A 1WQOA 3L64A 1LMCA 1C6IA 1B5UA 1L80A 2HEEA 1IOSA 4GLAA 1L96A 2AUBA 4OW1A 1JISA 1XJTA 1ZMYL 2RAYX 2C8PA 3BKHA 1LMNA 3HBDA 1IP1A 1L66A 1VDPA 1SX7A 2LYOA 154LA 130LA 1L58A 243LA 2ANVA 5I4YA 2D4KA 3AYQA 1DI5A 1LSPA 3WL2A 1LHMA 5LVKA 4NEBA 2HECA 1YL1X 1XEJA 1LHIA 4KXIA 3WPJA 1GFGA 1PQIA 4M4OA 2XBRA 3BKVA 1LYIA 4QY9A 1OV5A 3IJUA 3GUMA 4GRVA 1JKCA 3HU9A 4NGLA 4N1EI 5B06A 1L75A 1LSCA 4AGAA 1QTKA 4NGYA 103LA 1L97A 3HUAA 1JITA 1XFPL 3WU9A 4ETBA 2YBHA 1D3NA 3WVYA 1OUFA 1GB6A 4G4HA 2NWDX 216LA 1G1VA 201LA 1L09A 1DYDA 1GDXA 1JSEA 3DN1A 1LI3A 150LA 4NSGA 1JUGA 228LA 3GXRA 135LA 1LI6A 1IX0A 4EKPA 199LA 3B0IA 2HU3A 1L81A 138LA 123LA 1QSBA 1HEOA 3AGIA 1RJCB 5F9UA 3WUNA 1LHLA 3DN3A 5LVIA 185LA 3A92A 5I4XA 1IWUA 4E3UA 4I7RA 3VWOA 1P5CA 1C67A 4PHIA 5LA5A 5D5FA 1LZYA 4OWBA 1P64A 1B7OA 2CUUA 1G0PA 1C6FA 2F47A 1L26A 3F9LA 1C6PA 1LSGA 2OE4X 1BGIA 4H91A 4H8YA 3NYAA 1XJUA 1OUHA 3DN4A 1LPIA 229LA 1FDLY 1BHZA 1C66A 4FDYA 1CTWA 1D0MA 1KXWA 1XGTC 4BS7A 1FLWA 4LYBA 1XEKA 2LHMA 3EBAB 1L99A 2Z2EA 1C7PA 1L01A 1L68A 4CFPA 5KXOA 5B1FA 4LZMA 1P3NA 1GE2A 2DQHY 1L67A 3DN0A 2I6ZA 3TXHA 1LWKA 3IWRA 183LA 3A34A 1QDTA 1T8GA 5F9XA 1UACY 1PQOA 2C8OA 4L41A 5LVJA 1L19A 1FLQA 1GFHA 169LA 1QS9A 4ARMB 1G0GA 1GE0A 1LJJA 4W59A 4ARJA 1XEIA 1GB8A 2FBDA 2LYZA 170LA 1ZYTA 3A6BY 4RLNA 1L62A 3P68A 3P64A 1F6RA 4H9FA 1SQ2L 3W3EA 2DQIY 1HFXA 231LA 1OUEA 4DDBA 1GF0A 5J7CA 2RBRA 3WXTA 5B05A 1GEVA 3N9AA 1B7QA 1REMA 4OOOA 3DN8A 3C7YA 1C64A 2B74A 1L06A 3A67Y 4EPIA 1DQJC 1IP5A 1GF5A 2OTZX 2N5ZA 3CSRA 260LA 1UA6Y 4TWSA 7LYZA 1G7LC 2B70A 1CKDA 1W6ZA 2FYCA 1G0QA 1C6JA 4EMNA 1Z55A 2EPEA 1FLUA 4B1AA 1GF6A 128LA 1G7HC 4W54A 256LA 3V2YA 1GBOA 4QDNA 2YSSC 5B59A 4ARLA 4C5FA 1V7TA 4WG7A 1P7SA 2H5ZA 1DYBA 1L28A 4OOTA 1QIOA 4H94A 4GLVA 153LA 3ULRA 2ZQ4A 3DNAA 4I7TA 1IY3A 2IFFY 1P2RA 3ATOA 1CV4A 4NWHA 1EQEA 1C62A 254LA 1CU0A 1GFKA 242LA 2MEAA 1QTVA 1LZ8A 2QB0B 1LJEA 1L50A 1J1PY 3DKEX 232LA 4DD3A 4Z3MA 4HPIA 4YXCA 4LT1A 3RNXA 4H9HA 1GF8A 1KW5A 3LZTA 1LZNA 1I20A 1P37A 3SP3A 4I7JA 3HTBA 4EOFA 3C8RA 4C3WA 3RZ4A 1HEMA 1OUBA 1QT8A 4I0CA 2F2QA 2Z2FA 127LA 5LVHA 1LSBA 1LJGA 1CX7A 230LA 5HNLA 1LTMA 109LA 1GXV2 4NG1A 3TXJA 3AZ4A 144LA 4I7OA 238LA 2VB1A 3GXKA 2HEDA 1JTOL 4B4IA 1L64A 255LA 1CJ9A 4J0LA 125LA 4ARMA 1G06A 1B5VA 2F30A 1CKGA 1LZ6A 5B07A 1L60A 217LA 239LA 4PGJB 3W6CA 2X0AA 118LA 4PRUA 3RU5A 2BQLA 4DC4A 1L63A 141LA 1QUTA 4HPEA 1OVJA 4IATA 1L20A 167LA 165LA 4ARQB 4DWXA 1P2LA 1OUIA 2Z6BA 4WM4A 4H1PA 1D2YA 1P36A 1REZA 1SSWA 3TXIA 4HP0A 4G4CA 2BQCA 1HFYA 1G7IC 1L32A 3E3DA 5KKJA 3C83A 1L92A 4QEQA 2EQLA 4IJ4A 248LA 1PS5A 4I8SA 3B72A 3A8ZA 4FJRA 4J1BA 3G3AB 4WO9A 1FKQA 1YKYX 1JTMA 1LZBA 112LA 2DQFC 1LI2A 2CJLA 1UIHA 1LYFA 2MEEA 4WOAA 2D4JA 4IAPA 1QUSA 1REYA 1LHJA 5AMYA 1LSDA 193LA 3FI5A 2YBMA 258LA 3M3UA 1LMAA 4OO9A 2XQOA 1LSFA 1MELL 2BQEA 4W58A 1C08C 1NHEA 5A3ZA 163LA 1C63A 1L17A 3OE8A 4GN3A 2G4PA 4WM3A 5T3FA 1EQ4A 2B7XA 158LA 1L13A 1HEPA 3IJVA 3HT6A 2B6XA 3G3BB 1CJ7A 4W96A 1QUDA 3LHMA 4IASA 162LA 2IHLA 1ZV5L 4QGZA 2W1LA 2Z39A 1L52A 4HV2A 1C6QA 1L93A 3KAMA 5KXWA 1BB3A 1L33A 2DQEY 1C61A 3K2RA 2BQIA 2MEIA 1VATA 1K28A 235LA 247LA 1CNSA 3FE0A 257LA 122LA 1BB7A 5F81A 1RI8B 2RBSA 1D0KA 1JJ1A 205LA 3B6LA 4WLTA 1DYCA 196LA 1IWWA 4LZTA 4RDSA 5II3A 4DKLA 1LZAA 1HSWA 5IELA 1GF7A 3ODUA 1L90A 214LA 1ZWNA 1GBWA 3HDEA 5DN4A 1B9OA 4BAFA 1NKHA 1T3PA 4I7MA 4ARQA 1H6MA 5KJ9A 4CHXA 1G7MC 3OE9A 181LA 1NBYC 3GUPA 253LA 4YXAC 4ML7A 2CDSA 2B6ZA 3PDSA 1HNLA 2O7AA 1DYAA 1D3JA 5HMVA 1KY0A 1SLYA 4HSFA 3WYHA 2YBJA 1LPYA 3AW7A 2LC9A 1CUPA 1KIQC 1L70A 4NGOA 4H9BA 4YOPA 2BQDA 4UWVA 3RW8A 1L87A 194LA 1GFVA 3B0OA 4NGZA 5B1GA 137LA 2OU8A 1L35A 1XGRC 3SB5A 3FADA 1VDQA 4LT2A 5APFA 1B7PA 2ZILA 1QT5A 1WQMA 2PC2A 1L46A 3TMXA 3A6CY 1VEDA 1AZFA 1QSAA 175LA 1EPYA 1L18A 3QE8A 160LA 1B7MA 207LA 5IDDA 1DYFA 1L88A 2BQOA 3C8QA 3HH6A 4XJBA 1I56A 5KXPA 4DT3A 3TXDA 3V2WA 1B7NA 3WPLA 4GCCA 3SBAA 1KXXA 1NQIA 3N9EA 2NTHA 3C7ZA 1D2WA 1F6SA 1QUOA 131LA 186LA 4B49A 3F8VA 1BWHA 5ILFA 4LDOA 2Y8PA 1T6VL 2LZ2A 1C6LA 1UBZA 3HH3A 5HQ1A 1OVHA 1L91A 4U3XB 2Z18A 3LYZA 1WTMA 3UONA 4PK0A 4WG1A 3AGGG 2DKVA 3LZ2A 4H92A 1L00A 157LA 1LJ4A 115LA 2CWIA 4XJGA 1L55A 1L49A 1L42A 1OVKA 4WL6A 149LA 1IIZA 5K7OA 1WQRA 4WM1A 1IO5A 1KS3A 2HULA 1DYGA 2G4QA 1LYZA 2BQFA 5LYTA 140LA 2MEDA 1HC0A 1C6KA 1C6EA 1B7RA 5LYZA 1L95A 3TMWA 4NGWA 2BAAA 1C6GA 1L57A 4WLXA 1TLAA 3AB6A 2ZIJA 1L44A 5DLAA 2ZQ3A 3CT1A 4DQ5A 1B0DA 4GCFA 1JTNA 4HJZA 4NGVA 4AQNA 1NMMA 4NFVA 5KY1A 3LYTA 172LA 1KIRC 3GUOA 4OWAA 3DMZA 1EQ5A 241LA 1QUHA 2W1XA 1NF5A 1D6PA 2A7DA 1GPQC 3EMSA 1L11A 1HMLA 251LA 1L83A 1CU6A 2BQNA 2OTYX 1B5ZA 1BWIA 1C6AA 6LYZA 1YIKA 1CJ6A 4NIJA 5F14A 1SWZA 1B5YA 1LKSA 1GE1A 1IC7Y 1DPWA 5IHGA 4LFXA 2HEFA 3QAKA 4DJHA 5LXWA 1QTEA 1A2YC 4HJVA 4N8ZA 3WPKA 1NDGC 3ZEKA 4LDLA 5KKIA 1L16A 1GD6A 2ZYPA 1L27A 3HT8A 4DD0A 1L08A 4I7QA 1L38A 1IWZA 1BVXA 113LA 3SN6R 1LJNA 3C80A 5LIOA 3P65A 3HH5A 3A3RX 1L74A 1HELA 1JTTL 1BVKC 3TXEA 1CU5A 1DZBX 3WW5A 4E97A 4H9EA 3LYMA 2Z37A 262LA 3G3XA 2B6TA 5FHWA 1IP6A 237LA 1IY4A 4Z46A 1C6MA 4RW1A 180LA 1BB6A 2BQBA 1LJIA 4LYTA 1GBSA 1C6TA 1L02A 4NY5A 1L23A 3D3DA 4WL7A 1GAZA 4XJIA 1YQVY 3SB6A 4I7KA 1IWVA 2QARC 250LA 4O34A 4DD7A 1D9WA 1L10A 3HT7A 2XJWA 5HNCA 2ZNXY 2BQJA 3N9CA 1IOQA 2BQHA 4NGJA 1YAOA 259LA 1L84A 3A90A 1W08A 1CVKA 5FSTA 2RBQA 4EKRA 3NY8A 1HFZA 226LA 219LA 1TAYA 4BAPA 1PQDA 4ETDA 2HUBA 4NGKA 2I25L 1L76A 2FYDA 1G0JA 1P46A 2D91A 1RFPA 1JKAA 5I54A 1L22A 129LA 147LA 2ANXA 5LVGA 3OE0A 1IOTA 1AM7A 1P2CC 195LA 1LMPA 1L39A 5FDJA 1L15A 2DQAA 3C7WA 1SWYA 1GBZA 1CKFA 1PQKA 3A93A 5LINA 246LA 102LA 4NGIA 220LA 1MLCE 1LZSA 3OK0A 1VFBC 145LA 2XBSA 3SB9A 4S0WA 4EKSA 2ZWBA 184LA 4DDCA 2DQDY 1GE4A 2LCBA 4WO6A 4DAJA 1QDRA 1OP9B 1IWTA 2RSCA 1JJ3A 212LA 1LSEA 1GFJA 4X3BA 1T8AA 9LYZA 1YAQA 1C6DA 1OUAA 1OWYA 4EXMA 1CU3A 1N4FA 1GF3A 1C6NA 5KXLA 4RW2A 4UWNA 1CJ8A 1LMQA 249LA 4NHPA 225LA 1INUA 1L0JA 3F6ZA 3HTDA 1GEZA 168LA 187LA 2XTHA 1VDSA 4YX7C 3WUMA 1JKDA 1I6SA 2Z12A 3SB7A 4OWHA 5C6IA 4HTNA 2A7FA 143LA 4R0FA 4ETCA 1G7JC 2OU0X 1OYUA 5DN5A 198LA 5E4PA 4ANRA 4CGEA 4ZIXA 173LA 1HEWA 4J7VA 3A95A 2B72A 5JENB 4XYYA 1LGUA 1JEFA 1RCMA 4DQJA 177LA 4GCEA 1T8FA 1D6QA 1OQMA 1IR7A 1QTZA 155LA 1CV0A 3CSZA 2BQKA 1LW9A 2ZIKA 2BLYA 2BLXA 4GBRB 1L37A 1LAAA 2DBTA 3DN6A 1L34A 1LLHA 209LA 5I14A 1IP3A 1L41A 3QY4A 110LA 1LZ5A 2RB2X 1TEWA 1LJFA 1LZTA 1LSMA 1CX6A 1T6HA 3P66A 1FBIX 1P6YA 3WMKA 240LA 2F2NA 4CFOA 1IOCA 4YENA 3M18B 1YKXX 156LA 1C60A 2YBIA 4EJ4A 2RAZX 3A96A 197LA 1C46A 4WM5A 4UWUA 2HEBA 4AXTA 1G0LA 4DD1A 1HHLA 5A3EA 1GB0A 4DD9A 2EIZC 3WUAA 3LYOA 1JTPL 5KXMA 1CUQA 4HV1A 1A4VA 1QTCA 1JIYA 1UUZC 1IP2A 1JJ0A 2YDGA 1IC5Y 1GBXA 4J1AA 3HDFA 1IP7A 234LA 1GAYA 1GE3A 7LZMA 3CDTA 3CT0A 4NHSA 1LJHA 1LJKA 1V7SA 3T36A 1QQYA 1LZ4A 1HSXA 1QTBA 1UIFA 1LHKA 1B5WA 5EBHA 1L03A 132LA 174LA 1AT5A 4P2EA 3TXKA 2RBOA 1JPOA 4G49A 210LA 1GXXA 191LA 1VDTA 1GB3A 1L21A 2RB1X 1JSFA 1QSQA 5C6LA 1ZVHL 4LDEA 1J1XY 166LA 189LA 126LA 2BQAA 3HBHA 1IWYA 1IR9A 4I7SA 2OU9A 4I7NA 1QUGA 4H9AA 1QT6A 5HMJA 1XSFA 1LMTA 4RLMA 2FBBA 1C6BA 1L56A 1DKJA 3JR6A 3CQLA 4W94A 1L86A 5DL9A 4D9ZA 6LZMA 1T97A 1WVUA 4TUNA 1C45A 3A91A 1LOZA 1OUJA 2LYMA 1YROA 4KT3A 1L51A 4TX7A 3EO5A 252LA 4B4EA 2BQGA 1SX2A 218LA 1IVMA 1GDWA 4PJZA 4W56A 1J1OY 1QTHA 3W6BA 1LSZA 1LZ9A 1NWGA 2IGCA 1DXJA 1BQLY 1AT6A 1UIEA 3W6FA 1NDMC 4HJYA 4NHQA 3CT5A 4XJFA 2DQGY 5LAGA 236LA 3W6EA 1LZRA 3LZMA 1LGXA 1L72A 4I7LA 3TXFA 4LYOA 1YANA 134LA 2B73A 4XADA 1CV6A 4R6CA 1XGUC 4ET8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J1P Y;  4NIJ A;  2G4N A;  5F14 A;  1LYO A;  3B0K A;  3WU7 A;  1LZ1 A;  4XJH A;  4DD3 A;  4Z3M A;  1B5Y A;  4HPI A;  1LKS A;  1GE1 A;  1IC7 Y;  1DPW A;  3WU8 A;  5IHG A;  5APE A;  4LT1 A;  4LFX A;  3RNX A;  4H9H A;  5M1Y A;  1GF8 A;  2HEF A;  4WM6 A;  4PPO A;  4YEM A;  1YL0 X;  3LZT A;  1D0L A;  2W1Y A;  4II8 A;  5LXW A;  1QTE A;  4M6D A;  1A2Y C;  1I20 A;  1LZN A;  4HJV A;  4N8Z A;  3WH1 A;  3WPK A;  1NDG C;  3ZEK A;  5KKI A;  3SP3 A;  1GD6 A;  1GF9 A;  1HF4 A;  2HU1 A;  2ZYP A;  4EOF A;  4C3W A;  3RZ4 A;  4LYZ A;  5FCP A;  1HEM A;  1OUB A;  5L9J A;  4I0C A;  4WMG A;  4DDA A;  4NSJ A;  1YAM A;  4DD0 A;  2Z2F A;  3J6K A;  4LT0 A;  3MGW A;  5LVH A;  1LSB A;  1LJG A;  1IWZ A;  3CSQ A;  5HNL A;  1BVX A;  1YAP A;  1LSN A;  5DM9 A;  1LTM A;  3TMV A;  1GXV 2;  1LJN A;  4LYM A;  4NG1 A;  3TXJ A;  1ALC A;  2H9J A;  3AZ4 A;  5ILC A;  1GWD A;  5LIO A;  2ZYC A;  3P65 A;  2D4I A;  3A3R X;  5FEK A;  1FN5 A;  2VB1 A;  1HEL A;  3GXK A;  2HED A;  1JTO L;  1JTT L;  4B4I A;  1IP4 A;  1BVK C;  3TXE A;  4H8X A;  1LHH A;  4WLD A;  1DZB X;  3WW5 A;  4ET8 A;  3AZ7 A;  1CJ9 A;  4H9C A;  4J0L A;  1GFE A;  5B59 A;  2MEG A;  4H9E A;  1IOR A;  3LYM A;  2Z37 A;  1IR8 A;  5FHW A;  4YM8 A;  1B5V A;  1LMO A;  1IP6 A;  5E9R A;  1IY4 A;  2F30 A;  3WXU A;  1CKG A;  1B5X A;  1LZ6 A;  5B07 A;  3WVX A;  4Z46 A;  1OUD A;  4MCK A;  4CJ2 A;  208L A;  5HLL A;  4PGJ B;  3W6C A;  2X0A A;  3HBE X;  4RW1 A;  4ET9 A;  1BB6 A;  4TSC A;  2BQB A;  4G4B A;  1LJI A;  2BQL A;  4PRU A;  3RU5 A;  4DC4 A;  1BB4 A;  1YKZ X;  4LYT A;  1QUT A;  1XGP C;  4HPE A;  5KXS A;  4ZEE A;  1GBS A;  1H87 A;  1BB5 A;  4GCD A;  4IAT A;  4NY5 A;  3D3D A;  4DWX A;  4WL7 A;  1CKH A;  1F0W A;  1GB2 A;  1GAZ A;  1OUI A;  1YQV Y;  3LN2 A;  4XJI A;  1IWV A;  3TXG A;  4WM4 A;  4LGK A;  4O34 A;  4DD7 A;  4H1P A;  3ZVQ B;  3HFM Y;  4Z41 A;  1REZ A;  4OWC A;  1GF4 A;  2XJW A;  1LYY A;  1UIG A;  5HNC A;  2ZNX Y;  3TXI A;  2BQJ A;  3N9C A;  1LZG A;  1IOQ A;  4G4C A;  2BQH A;  4HP0 A;  1UIA A;  2BQC A;  1HFY A;  4GN4 A;  1YAO A;  1G7I C;  3AW6 A;  3E3D A;  4NGJ A;  5I4W A;  5KKJ A;  4QEQ A;  1JHL A;  1DKK A;  2F4G A;  1LSA A;  1FLY A;  2EQL A;  2H9K A;  4HTQ A;  3A90 A;  4N9R A;  4PJ2 C;  5KXR A;  4IJ4 A;  1W08 A;  1REX A;  5FST A;  1PS5 A;  4I8S A;  1JWR A;  1HFZ A;  1WQN A;  3A8Z A;  3B72 A;  4FJR A;  4J1B A;  1I1Z A;  1TAY A;  3G3A B;  5KXX A;  4WO9 A;  2HEA A;  4TTD A;  4BAP A;  4MR1 A;  4N5R A;  1FKQ A;  3EXD A;  4ETD A;  1YKY X;  2HUB A;  1LKR A;  4NGK A;  1LZB A;  2I25 L;  1GB5 A;  2Z38 A;  2FYD A;  4LFP A;  3A94 A;  2DQF C;  2CJL A;  4BAD A;  1UIH A;  2D91 A;  1RFP A;  1WQO A;  2MEE A;  1JKA A;  4WOA A;  2D4J A;  8LYZ A;  1QUS A;  5I54 A;  1AKI A;  1LMC A;  1IEE A;  1B5U A;  4ETA A;  1REY A;  1D9U A;  4LT3 A;  1UCO A;  5LVG A;  1LHJ A;  1C10 A;  4NHI A;  5AMY A;  1IOT A;  193L A;  1LSD A;  1AM7 A;  1P2C C;  1IOS A;  1CKC A;  1WTN A;  1LMP A;  2HEE A;  2YBM A;  3M3U A;  4GLA A;  2BPU A;  2MEF A;  4GN5 C;  5FDJ A;  2DQA A;  4OW1 A;  2AUB A;  4ETE A;  1JIS A;  1LMA A;  1ZMY L;  1GBZ A;  2C8P A;  1CKF A;  3BKH A;  3ATN A;  3A93 A;  1LSF A;  5LIN A;  1LMN A;  1MEL L;  2BQE A;  3HBD A;  1IP1 A;  4NGI A;  1MLC E;  1LZS A;  3OK0 A;  1C08 C;  1NHE A;  5A3Z A;  1VFB C;  2XBS A;  1VDP A;  4ZFP A;  4NG8 A;  2ZWB A;  2LYO A;  154L A;  3AZ6 A;  1KXY A;  4DDC A;  4GN3 A;  2G4P A;  2DQD Y;  4WM3 A;  1GE4 A;  4HTK A;  1EQ4 A;  3J4G A;  4YEO A;  5T3F A;  1TDY A;  3RT5 X;  5I4Y A;  2D4K A;  3AYQ A;  1DI5 A;  1LSP A;  4WO6 A;  1LHM A;  3WL2 A;  2ZNW Y;  5LVK A;  4NEB A;  2HEC A;  1QDR A;  2DQJ Y;  1OP9 B;  1HEP A;  1IWT A;  1YL1 X;  2RSC A;  3IJV A;  1JJ3 A;  1LSE A;  1GFJ A;  1XEJ A;  4OWE A;  4X3B A;  5LYM A;  133L A;  9LYZ A;  3G3B B;  1YAQ A;  1CJ7 A;  1OUA A;  1LHI A;  4W96 A;  4KXI A;  3WPJ A;  3LHM A;  1GFG A;  1N4F A;  1GF3 A;  4IAS A;  2IHL A;  4M4O A;  5KXL A;  1ZV5 L;  2XBR A;  1HMK A;  2W1L A;  2Z39 A;  3BKV A;  1PZY A;  2D6B A;  4QGZ A;  4RW2 A;  4HV2 A;  4UWN A;  4QY9 A;  1CJ8 A;  3K3T A;  1IC4 Y;  3KAM A;  1LMQ A;  3IJU A;  4NHP A;  2CGI A;  1JKC A;  5KXW A;  1BB3 A;  5D5C A;  1INU A;  4NGL A;  4N1E I;  5B06 A;  1GFA A;  3F6Z A;  1LSC A;  2DQE Y;  4AGA A;  1QTK A;  4NGY A;  5LAF A;  2BQI A;  2MEI A;  1GEZ A;  4Z98 A;  1VAT A;  2XTH A;  1VDS A;  3WUL A;  1JIT A;  1XFP L;  3WUM A;  2MEC A;  1LYS A;  3WU9 A;  4ETB A;  1JKD A;  2YBH A;  1CNS A;  3FE0 A;  3WVY A;  2Z12 A;  4OWH A;  1OUF A;  5C6I A;  1LZD A;  1GB6 A;  1BB7 A;  4HTN A;  2A7F A;  5FEL A;  5F81 A;  1ZVY B;  1GFT A;  1RI8 B;  4G4H A;  5F16 A;  2NWD X;  4R0F A;  4ETC A;  1G7J C;  1HEN A;  4DYG A;  5DN5 A;  1D0K A;  1JJ1 A;  4PRQ A;  2HTX A;  3B6L A;  1GDX A;  4WLT A;  5E4P A;  1JSE A;  4ANR A;  4CGE A;  1UIC A;  1IWW A;  1HEW A;  4J7V A;  4ZIX A;  4LZT A;  3A95 A;  5JEN B;  4RDS A;  5II3 A;  4NSG A;  1LZA A;  1HSW A;  5IEL A;  1GF7 A;  4XYY A;  1JUG A;  2MEB A;  1XGQ C;  1GBW A;  2YBL A;  1JEF A;  4TSB A;  1RCM A;  3GXR A;  135L A;  5DN4 A;  1B9O A;  4BAF A;  1IX0 A;  1NKH A;  4GCE A;  4B0D A;  1D6Q A;  1T3P A;  1OQM A;  3B0I A;  1IR7 A;  5KXN A;  3W6D A;  1H6M A;  5KJ9 A;  4CHX A;  2WAR A;  1G7M C;  1NBY C;  3CSZ A;  2BQK A;  2HU3 A;  2I26 L;  2ZIK A;  2BLY A;  2BLX A;  1HEO A;  2CDS A;  3AGI A;  4ML7 A;  1RJC B;  1LAA A;  1TCY A;  5F9U A;  3WUN A;  2DBT A;  3ZVQ A;  3WW6 A;  1LHL A;  2Q0M X;  1HNL A;  2YVB A;  5LVI A;  5HMV A;  1IP3 A;  1WQP A;  6LYT A;  3QY4 A;  5C6J A;  1LZ5 A;  3A92 A;  3T6U A;  5I4X A;  1TEW A;  1IWU A;  4E3U A;  1LJF A;  3VWO A;  4LYC A;  1VAU A;  4PHI A;  1SLY A;  4WM2 A;  1LZT A;  1LSM A;  1LZY A;  3OJP A;  4OWB A;  4HSF A;  5D5F A;  3WYH A;  2YBJ A;  2YBN A;  3AW7 A;  5L3I A;  1B7O A;  2GV0 A;  1KIQ C;  3P66 A;  4NGO A;  1O23 A;  1FBI X;  4H9B A;  4YOP A;  3WMK A;  2BQD A;  2F2N A;  4UWV A;  4CFO A;  3RW8 A;  1LSG A;  4DD2 A;  1BGI A;  4H91 A;  194L A;  1IOC A;  4H8Y A;  4YEN A;  3M18 B;  1KIP C;  4MST A;  1LJ3 A;  1GFV A;  1OUH A;  1YKX X;  1LCN A;  2YBI A;  3B0O A;  3A96 A;  1LPI A;  4NGZ A;  1FDL Y;  1BHZ A;  5B1G A;  1C46 A;  4FDY A;  4UWU A;  4WM5 A;  1D0M A;  1GFU A;  1KXW A;  1XGT C;  2HEB A;  4AXT A;  3AJN A;  4BS7 A;  4DD1 A;  1HHL A;  5A3E A;  1FLW A;  1GB0 A;  4DD9 A;  3A3Q A;  2EIZ C;  5KXK A;  1XGR C;  4LYB A;  3WUA A;  3LYO A;  1JTP L;  4A7D A;  1XEK A;  1RE2 A;  5KXM A;  1TBY A;  2LHM A;  4H93 A;  3EBA B;  2Z2E A;  1C7P A;  1VDQ A;  1A4V A;  2LZT A;  4HV1 A;  4LT2 A;  1JIY A;  5APF A;  1UUZ C;  5I53 A;  1B7P A;  4XN6 A;  1IP2 A;  4CFP A;  1JJ0 A;  1UID A;  2YDG A;  5KXT A;  5KXO A;  1IC5 Y;  1B7S A;  1HEQ A;  1GBX A;  2ZIL A;  4J1A A;  5B1F A;  1WQQ A;  1WQM A;  1GE2 A;  2DQH Y;  2PC2 A;  5APD A;  5I5Q A;  3TMX A;  3A6C Y;  2I6Z A;  1IP7 A;  1VED A;  1AZF A;  3TMU A;  3TXH A;  1GAY A;  2Z19 A;  1GE3 A;  1OUG A;  3IWR A;  1QSA A;  3CT0 A;  3A34 A;  1NBZ C;  3QE8 A;  4NHS A;  1LJH A;  1QDT A;  1LJK A;  1B7M A;  1V7S A;  5F9X A;  3T36 A;  1UAC Y;  1GB9 A;  1UC0 A;  207L A;  1QQY A;  1LZ4 A;  1HSX A;  5IDD A;  2BQO A;  4XJB A;  1GFR A;  1I56 A;  1UIF A;  5KXP A;  4DT3 A;  3TXD A;  1HER A;  1B7N A;  2C8O A;  4L41 A;  1LHK A;  3AGH A;  3WPL A;  4GCC A;  1B5W A;  5LVJ A;  1GBY A;  1KXX A;  5EBH A;  1NQI A;  1FLQ A;  3N9E A;  132L A;  1AT5 A;  4P2E A;  3TXK A;  1GFH A;  1UIB A;  1JPO A;  1QSW A;  4G49 A;  2DQC Y;  1F6S A;  4WLY A;  4N1C C;  1GXX A;  1VDT A;  1DI4 A;  1GE0 A;  1LJJ A;  1GB3 A;  4B49 A;  4B4J A;  1XEI A;  1B7L A;  1GB8 A;  1BWH A;  5ILF A;  1DPX A;  2FBD A;  2LYZ A;  1JSF A;  3A6B Y;  2Y8P A;  4NWE A;  4RLN A;  1T6V L;  2LZ2 A;  3P68 A;  1UBZ A;  5C6L A;  1JKB A;  3P64 A;  5HQ1 A;  1F10 A;  4XJD A;  1F6R A;  1ZVH L;  2Z18 A;  1B2K A;  1J1X Y;  1SQ2 L;  4H9F A;  3LYZ A;  2DQI Y;  1HFX A;  1WTM A;  3W3E A;  1OUE A;  2BQA A;  4DDB A;  4WG1 A;  1GF0 A;  5J7C A;  1FKV A;  3AGG G;  3HBH A;  3WXT A;  5B05 A;  1IWY A;  2DKV A;  3FI7 A;  1GEV A;  1IR9 A;  3LZ2 A;  4KL7 A;  3N9A A;  4H92 A;  4H9A A;  1B7Q A;  1LJ4 A;  5LA5 A;  2F4A A;  1REM A;  2CWI A;  4XJG A;  2MEH A;  4OOO A;  5HMJ A;  1XSF A;  1LMT A;  4RLM A;  4WL6 A;  2FBB A;  1IIZ A;  5K7O A;  1WQR A;  1GB7 A;  4WM1 A;  1IO5 A;  3A67 Y;  1DKJ A;  5APC A;  1DQJ C;  1IP5 A;  1GF5 A;  1GHL A;  4NSI A;  3W6A A;  2N5Z A;  3CSR A;  2G4Q A;  1LYZ A;  1UA6 Y;  3CQL A;  2BQF A;  4TWS A;  4W94 A;  4XEN A;  7LYZ A;  5LYT A;  1G7L C;  1E8L A;  5DL9 A;  1CKD A;  1W6Z A;  1WVV A;  2FYC A;  4H8Z A;  4D9Z A;  1WVU A;  2MED A;  4NSH A;  4TUN A;  1C45 A;  3QNG A;  1HC0 A;  1DI3 A;  3A91 A;  1LOZ A;  1OUJ A;  2LYM A;  3TXB A;  1YRO A;  1B7R A;  4EMN A;  1Z55 A;  2EPE A;  1FLU A;  1LSY A;  5LYZ A;  3TMW A;  1LZC A;  1BWJ A;  2EKS C;  4NGW A;  4B1A A;  1GF6 A;  4KT3 A;  2BAA A;  5LA8 A;  4H90 A;  4GCB A;  4TX7 A;  3EO5 A;  4WLX A;  1G7H C;  3AZ5 A;  4B4E A;  2BQG A;  2BQM A;  3AB6 A;  1GBO A;  2ZIJ A;  4H9I A;  2YSS C;  4QDN A;  4U3X B;  5DLA A;  1YIL A;  2ZQ3 A;  3CT1 A;  2W1M A;  5L3H A;  1B0D A;  4C5F A;  1LZE A;  1IVM A;  1GDW A;  4N0J A;  1V7T A;  4WG7 A;  4KPM A;  3P4Z A;  2H5Z A;  1J1O Y;  1C43 A;  4GCF A;  3W6B A;  4HJZ A;  4NGV A;  1LSZ A;  4OOT A;  1NMM A;  1QIO A;  1LZ9 A;  1NWG A;  1DXJ A;  1BQL Y;  1AT6 A;  4H94 A;  4NFV A;  5KY1 A;  1UIE A;  3LYT A;  3W6F A;  4GLV A;  1NDM C;  4HJY A;  4NHQ A;  1KIR C;  3CT5 A;  153L A;  4XJF A;  3ULR A;  2ZQ4 A;  4OWA A;  2DQG Y;  4NHT A;  2B5Z A;  4G9S A;  5LAG A;  3W6E A;  1LZR A;  1EQ5 A;  1IY3 A;  2IFF Y;  2W1X A;  3ATO A;  1EL1 A;  1NF5 A;  1D6P A;  3TXF A;  4LYO A;  1GPQ C;  1YAN A;  1OUC A;  2A7D A;  1HML A;  3EMS A;  134L A;  4NWH A;  1EQE A;  4YF2 A;  3CB7 A;  1GFK A;  2BQN A;  4XAD A;  2MEA A;  1B5Z A;  1BWI A;  6LYZ A;  3D9A C;  1LZ8 A;  5KXZ A;  1YIK A;  1CJ6 A;  1LJE A;  4R6C A;  1XGU C;  5KXY A;  1IWX A; 
#chains in the Genus database with same CATH topology
 2G4N A;  3B0K A;  4DQ7 A;  1LZ1 A;  3NY9 A;  3WU8 A;  4WM6 A;  4PPO A;  1L12 A;  4YEM A;  1LYD A;  4W53 A;  2W1Y A;  4M6D A;  2HUK A;  1HF4 A;  4LYZ A;  5FCP A;  5L9J A;  4DDA A;  223L A;  4LT0 A;  3CSQ A;  1LSN A;  1C68 A;  1L82 A;  4LYM A;  2H9J A;  3HTG A;  1L65 A;  188L A;  2RBN A;  4H8X A;  4WLD A;  4W57 A;  3AZ7 A;  142L A;  3G3V A;  1C6C A;  1IOR A;  1IR8 A;  4YM8 A;  178L A;  2O79 A;  5E9R A;  3WXU A;  151L A;  3RZE A;  4MCK A;  208L A;  5HLL A;  4ET9 A;  4G4B A;  1YKZ X;  5KXS A;  4ZEE A;  1H87 A;  4GCD A;  245L A;  1L43 A;  3LN2 A;  1LYJ A;  1DYE A;  3G3W A;  5LZM A;  3ZVQ B;  3HFM Y;  4OWC A;  1GF4 A;  1LYY A;  1UIG A;  1LZG A;  1UIA A;  4GN4 A;  5I4W A;  3AW6 A;  3CDV A;  1JHL A;  2H9K A;  4N9R A;  2L78 A;  1REX A;  3HT9 A;  1JWR A;  1WQN A;  5KXX A;  1C65 A;  1I1Z A;  2HEA A;  148L E;  1G1W A;  4MR1 A;  3EXD A;  1LKR A;  2Z38 A;  4LFP A;  1GB5 A;  3A94 A;  8LYZ A;  3GUJ A;  1AKI A;  2B6W A;  1IEE A;  4ETA A;  1D9U A;  4LT3 A;  1L77 A;  1UCO A;  1C10 A;  4NHI A;  1CKC A;  1WTN A;  104L A;  2BPU A;  2MEF A;  4GN5 C;  2B75 A;  111L A;  4ETE A;  3ATN A;  222L A;  1C6H A;  1QS5 A;  1L05 A;  2LZM A;  4ZFP A;  4NG8 A;  3AZ6 A;  1KXY A;  1L40 A;  4ARP A;  119L A;  1OWZ A;  1LYE A;  4HTK A;  3J4G A;  4YEO A;  3VW7 A;  1TDY A;  3RT5 X;  120L A;  1JQU A;  2ZNW Y;  2DQJ Y;  1L14 A;  1D3F A;  213L A;  3GUN A;  4OWE A;  5LYM A;  133L A;  2OE9 X;  1L79 A;  161L A;  1HMK A;  1PZY A;  2D6B A;  1L94 A;  3K3T A;  1IC4 Y;  2CGI A;  1C69 A;  5D5C A;  190L A;  1GFA A;  5LAF A;  3HU8 A;  4Z98 A;  3HWL A;  3HH4 A;  3WUL A;  2MEC A;  171L A;  1LYS A;  1LZD A;  5FEL A;  1ZVY B;  1GFT A;  3GUI A;  5F16 A;  1HEN A;  4DYG A;  3FA0 A;  3C81 A;  4PRQ A;  2HTX A;  4EPF A;  3HUQ A;  1UIC A;  2MEB A;  1XGQ C;  2YBL A;  4TSB A;  114L A;  4B0D A;  5KXN A;  3W6D A;  2WAR A;  182L A;  2I26 L;  1TCY A;  3ZVQ A;  3WW6 A;  2Q0M X;  159L A;  1L53 A;  2YVB A;  164L A;  1WQP A;  6LYT A;  1WTH A;  5C6J A;  3T6U A;  1QT7 A;  3CDO A;  4LYC A;  1VAU A;  4WM2 A;  3OJP A;  1QTD A;  2YBN A;  3SB8 A;  5L3I A;  2GV0 A;  1L25 A;  1O23 A;  1QT4 A;  211L A;  4DD2 A;  3SBB C;  1KIP C;  4MST A;  1LJ3 A;  1LCN A;  3L2X A;  1L73 A;  1GFU A;  3AJN A;  3RUN A;  200L A;  3A3Q A;  5KXK A;  4A7D A;  1RE2 A;  227L A;  1LWG A;  1TBY A;  4H93 A;  1G0M A;  2LZT A;  5I53 A;  4XN6 A;  1UID A;  5KXT A;  1B7S A;  1HEQ A;  1WQQ A;  3GUK A;  5APD A;  5I5Q A;  3TMU A;  2Z19 A;  1L04 A;  1OUG A;  1LYG A;  1NBZ C;  3GUL A;  1GB9 A;  1UC0 A;  3CDQ A;  224L A;  4I7P A;  1L45 A;  1GFR A;  2OEA X;  1HER A;  3AGH A;  1GBY A;  1UIB A;  1QSW A;  2DQC Y;  4WLY A;  4N1C C;  1DI4 A;  4B4J A;  1B7L A;  1CV5 A;  1DPX A;  1L54 A;  1L29 A;  4NWE A;  1JKB A;  1F10 A;  221L A;  4XJD A;  1LGW A;  2RB0 X;  1B2K A;  1FKV A;  3FI7 A;  1CV3 A;  4KL7 A;  244L A;  139L A;  2F4A A;  2MEH A;  3C82 A;  3HTF A;  1GB7 A;  5APC A;  1GHL A;  4W55 A;  4NSI A;  3W6A A;  1L07 A;  4XEN A;  1SSY A;  1E8L A;  1QT3 A;  1WVV A;  4H8Z A;  215L A;  4NSH A;  3QNG A;  1DI3 A;  3TXB A;  146L A;  1LSY A;  1LZC A;  1BWJ A;  2EKS C;  1G0K A;  5LA8 A;  4H90 A;  4GCB A;  3CDR A;  3AZ5 A;  2BQM A;  4H9I A;  152L A;  5L3H A;  1L24 A;  1YIL A;  2W1M A;  1LZE A;  4N0J A;  1OV7 A;  4W51 A;  4KPM A;  3P4Z A;  1L47 A;  1C43 A;  1PQM A;  1B6I A;  4NHT A;  2B5Z A;  4G9S A;  3DMV A;  1EL1 A;  1OUC A;  4YF2 A;  1L36 A;  3CB7 A;  3DMX A;  192L A;  3D9A C;  1PQJ A;  5KXZ A;  2O4W A;  5KXY A;  1KNI A;  1IWX A;  3EML A;  1LYO A;  3WU7 A;  4XJH A;  5APE A;  5M1Y A;  3DN2 A;  1L30 A;  1YL0 X;  1L61 A;  1D0L A;  1D3M A;  4II8 A;  3OE6 A;  3WH1 A;  4ZPU A;  1GF9 A;  1XEP A;  2HU1 A;  1G07 A;  4WMG A;  4NSJ A;  1YAM A;  3J6K A;  4W52 A;  1L48 A;  3MGW A;  261L A;  1YAP A;  3C8S A;  2A4T A;  108L A;  5DM9 A;  206L A;  3TMV A;  2HUM A;  1ALC A;  5ILC A;  1GWD A;  4K5Y A;  2ZYC A;  1L31 A;  233L A;  2D4I A;  5FEK A;  1FN5 A;  3PBL A;  1IP4 A;  1LHH A;  1L85 A;  4H9C A;  1GFE A;  2MEG A;  1NHB A;  1CV1 A;  1LMO A;  3WVX A;  1B5X A;  1OUD A;  2B6Y A;  2Q9E A;  4CJ2 A;  2NTG A;  3HBE X;  2OE7 X;  2Q9D A;  4TSC A;  1L98 A;  1BB4 A;  1P56 A;  1XGP C;  1BB5 A;  1CKH A;  1F0W A;  1GB2 A;  3TXG A;  4LGK A;  107L A;  1L71 A;  3HUK A;  1L0K A;  4Z41 A;  1L89 A;  1L59 A;  176L A;  1ZUR A;  2RBP A;  3D4S A;  1L69 A;  2F4G A;  1DKK A;  1KW7 A;  1LSA A;  1FLY A;  1KY1 A;  4HTQ A;  4PJ2 C;  5KXR A;  1LYH A;  2F32 A;  2RH1 A;  4TTD A;  4N5R A;  4EKQ A;  4BAD A;  1CU2 A;  1WQO A;  3L64 A;  1LMC A;  1C6I A;  1B5U A;  1L80 A;  2HEE A;  1IOS A;  4GLA A;  1L96 A;  2AUB A;  4OW1 A;  1JIS A;  1XJT A;  1ZMY L;  2RAY X;  2C8P A;  3BKH A;  1LMN A;  3HBD A;  1IP1 A;  1L66 A;  1VDP A;  1SX7 A;  2LYO A;  154L A;  130L A;  1L58 A;  243L A;  2ANV A;  5I4Y A;  2D4K A;  3AYQ A;  1DI5 A;  1LSP A;  3WL2 A;  1LHM A;  5LVK A;  4NEB A;  2HEC A;  1YL1 X;  1XEJ A;  1LHI A;  4KXI A;  3WPJ A;  1GFG A;  1PQI A;  4M4O A;  2XBR A;  3BKV A;  1LYI A;  4QY9 A;  1OV5 A;  3IJU A;  3GUM A;  4GRV A;  1JKC A;  3HU9 A;  4NGL A;  4N1E I;  5B06 A;  1L75 A;  1LSC A;  4AGA A;  1QTK A;  4NGY A;  103L A;  1L97 A;  3HUA A;  1JIT A;  1XFP L;  3WU9 A;  4ETB A;  2YBH A;  1D3N A;  3WVY A;  1OUF A;  1GB6 A;  4G4H A;  2NWD X;  216L A;  1G1V A;  201L A;  1L09 A;  1DYD A;  1GDX A;  1JSE A;  3DN1 A;  1LI3 A;  150L A;  4NSG A;  1JUG A;  228L A;  3GXR A;  135L A;  1LI6 A;  1IX0 A;  4EKP A;  199L A;  3B0I A;  2HU3 A;  1L81 A;  138L A;  123L A;  1QSB A;  1HEO A;  3AGI A;  1RJC B;  5F9U A;  3WUN A;  1LHL A;  3DN3 A;  5LVI A;  185L A;  3A92 A;  5I4X A;  1IWU A;  4E3U A;  4I7R A;  3VWO A;  1P5C A;  1C67 A;  4PHI A;  5LA5 A;  5D5F A;  1LZY A;  4OWB A;  1P64 A;  1B7O A;  2CUU A;  1G0P A;  1C6F A;  2F47 A;  1L26 A;  3F9L A;  1C6P A;  1LSG A;  2OE4 X;  1BGI A;  4H91 A;  4H8Y A;  3NYA A;  1XJU A;  1OUH A;  3DN4 A;  1LPI A;  229L A;  1FDL Y;  1BHZ A;  1C66 A;  4FDY A;  1CTW A;  1D0M A;  1KXW A;  1XGT C;  4BS7 A;  1FLW A;  4LYB A;  1XEK A;  2LHM A;  3EBA B;  1L99 A;  2Z2E A;  1C7P A;  1L01 A;  1L68 A;  4CFP A;  5KXO A;  5B1F A;  4LZM A;  1P3N A;  1GE2 A;  2DQH Y;  1L67 A;  3DN0 A;  2I6Z A;  3TXH A;  1LWK A;  3IWR A;  183L A;  3A34 A;  1QDT A;  1T8G A;  5F9X A;  1UAC Y;  1PQO A;  2C8O A;  4L41 A;  5LVJ A;  1L19 A;  1FLQ A;  1GFH A;  169L A;  1QS9 A;  4ARM B;  1G0G A;  1GE0 A;  1LJJ A;  4W59 A;  4ARJ A;  1XEI A;  1GB8 A;  2FBD A;  2LYZ A;  170L A;  1ZYT A;  3A6B Y;  4RLN A;  1L62 A;  3P68 A;  3P64 A;  1F6R A;  4H9F A;  1SQ2 L;  3W3E A;  2DQI Y;  1HFX A;  231L A;  1OUE A;  4DDB A;  1GF0 A;  5J7C A;  2RBR A;  3WXT A;  5B05 A;  1GEV A;  3N9A A;  1B7Q A;  1REM A;  4OOO A;  3DN8 A;  3C7Y A;  1C64 A;  2B74 A;  1L06 A;  3A67 Y;  4EPI A;  1DQJ C;  1IP5 A;  1GF5 A;  2OTZ X;  2N5Z A;  3CSR A;  260L A;  1UA6 Y;  4TWS A;  7LYZ A;  1G7L C;  2B70 A;  1CKD A;  1W6Z A;  2FYC A;  1G0Q A;  1C6J A;  4EMN A;  1Z55 A;  2EPE A;  1FLU A;  4B1A A;  1GF6 A;  128L A;  1G7H C;  4W54 A;  256L A;  3V2Y A;  1GBO A;  4QDN A;  2YSS C;  5B59 A;  4ARL A;  4C5F A;  1V7T A;  4WG7 A;  1P7S A;  2H5Z A;  1DYB A;  1L28 A;  4OOT A;  1QIO A;  4H94 A;  4GLV A;  153L A;  3ULR A;  2ZQ4 A;  3DNA A;  4I7T A;  1IY3 A;  2IFF Y;  1P2R A;  3ATO A;  1CV4 A;  4NWH A;  1EQE A;  1C62 A;  254L A;  1CU0 A;  1GFK A;  242L A;  2MEA A;  1QTV A;  1LZ8 A;  2QB0 B;  1LJE A;  1L50 A;  1J1P Y;  3DKE X;  232L A;  4DD3 A;  4Z3M A;  4HPI A;  4YXC A;  4LT1 A;  3RNX A;  4H9H A;  1GF8 A;  1KW5 A;  3LZT A;  1LZN A;  1I20 A;  1P37 A;  3SP3 A;  4I7J A;  3HTB A;  4EOF A;  3C8R A;  4C3W A;  3RZ4 A;  1HEM A;  1OUB A;  1QT8 A;  4I0C A;  2F2Q A;  2Z2F A;  127L A;  5LVH A;  1LSB A;  1LJG A;  1CX7 A;  230L A;  5HNL A;  1LTM A;  109L A;  1GXV 2;  4NG1 A;  3TXJ A;  3AZ4 A;  144L A;  4I7O A;  238L A;  2VB1 A;  3GXK A;  2HED A;  1JTO L;  4B4I A;  1L64 A;  255L A;  1CJ9 A;  4J0L A;  125L A;  4ARM A;  1G06 A;  1B5V A;  2F30 A;  1CKG A;  1LZ6 A;  5B07 A;  1L60 A;  217L A;  239L A;  4PGJ B;  3W6C A;  2X0A A;  118L A;  4PRU A;  3RU5 A;  2BQL A;  4DC4 A;  1L63 A;  141L A;  1QUT A;  4HPE A;  1OVJ A;  4IAT A;  1L20 A;  167L A;  165L A;  4ARQ B;  4DWX A;  1P2L A;  1OUI A;  2Z6B A;  4WM4 A;  4H1P A;  1D2Y A;  1P36 A;  1REZ A;  1SSW A;  3TXI A;  4HP0 A;  4G4C A;  2BQC A;  1HFY A;  1G7I C;  1L32 A;  3E3D A;  5KKJ A;  3C83 A;  1L92 A;  4QEQ A;  2EQL A;  4IJ4 A;  248L A;  1PS5 A;  4I8S A;  3B72 A;  3A8Z A;  4FJR A;  4J1B A;  3G3A B;  4WO9 A;  1FKQ A;  1YKY X;  1JTM A;  1LZB A;  112L A;  2DQF C;  1LI2 A;  2CJL A;  1UIH A;  1LYF A;  2MEE A;  4WOA A;  2D4J A;  4IAP A;  1QUS A;  1REY A;  1LHJ A;  5AMY A;  1LSD A;  193L A;  3FI5 A;  2YBM A;  258L A;  3M3U A;  1LMA A;  4OO9 A;  2XQO A;  1LSF A;  1MEL L;  2BQE A;  4W58 A;  1C08 C;  1NHE A;  5A3Z A;  163L A;  1C63 A;  1L17 A;  3OE8 A;  4GN3 A;  2G4P A;  4WM3 A;  5T3F A;  1EQ4 A;  2B7X A;  158L A;  1L13 A;  1HEP A;  3IJV A;  3HT6 A;  2B6X A;  3G3B B;  1CJ7 A;  4W96 A;  1QUD A;  3LHM A;  4IAS A;  162L A;  2IHL A;  1ZV5 L;  4QGZ A;  2W1L A;  2Z39 A;  1L52 A;  4HV2 A;  1C6Q A;  1L93 A;  3KAM A;  5KXW A;  1BB3 A;  1L33 A;  2DQE Y;  1C61 A;  3K2R A;  2BQI A;  2MEI A;  1VAT A;  1K28 A;  235L A;  247L A;  1CNS A;  3FE0 A;  257L A;  122L A;  1BB7 A;  5F81 A;  1RI8 B;  2RBS A;  1D0K A;  1JJ1 A;  205L A;  3B6L A;  4WLT A;  1DYC A;  196L A;  1IWW A;  4LZT A;  4RDS A;  5II3 A;  4DKL A;  1LZA A;  1HSW A;  5IEL A;  1GF7 A;  3ODU A;  1L90 A;  214L A;  1ZWN A;  1GBW A;  3HDE A;  5DN4 A;  1B9O A;  4BAF A;  1NKH A;  1T3P A;  4I7M A;  4ARQ A;  1H6M A;  5KJ9 A;  4CHX A;  1G7M C;  3OE9 A;  181L A;  1NBY C;  3GUP A;  253L A;  4YXA C;  4ML7 A;  2CDS A;  2B6Z A;  3PDS A;  1HNL A;  2O7A A;  1DYA A;  1D3J A;  5HMV A;  1KY0 A;  1SLY A;  4HSF A;  3WYH A;  2YBJ A;  1LPY A;  3AW7 A;  2LC9 A;  1CUP A;  1KIQ C;  1L70 A;  4NGO A;  4H9B A;  4YOP A;  2BQD A;  4UWV A;  3RW8 A;  1L87 A;  194L A;  1GFV A;  3B0O A;  4NGZ A;  5B1G A;  137L A;  2OU8 A;  1L35 A;  1XGR C;  3SB5 A;  3FAD A;  1VDQ A;  4LT2 A;  5APF A;  1B7P A;  2ZIL A;  1QT5 A;  1WQM A;  2PC2 A;  1L46 A;  3TMX A;  3A6C Y;  1VED A;  1AZF A;  1QSA A;  175L A;  1EPY A;  1L18 A;  3QE8 A;  160L A;  1B7M A;  207L A;  5IDD A;  1DYF A;  1L88 A;  2BQO A;  3C8Q A;  3HH6 A;  4XJB A;  1I56 A;  5KXP A;  4DT3 A;  3TXD A;  3V2W A;  1B7N A;  3WPL A;  4GCC A;  3SBA A;  1KXX A;  1NQI A;  3N9E A;  2NTH A;  3C7Z A;  1D2W A;  1F6S A;  1QUO A;  131L A;  186L A;  4B49 A;  3F8V A;  1BWH A;  5ILF A;  4LDO A;  2Y8P A;  1T6V L;  2LZ2 A;  1C6L A;  1UBZ A;  3HH3 A;  5HQ1 A;  1OVH A;  1L91 A;  4U3X B;  2Z18 A;  3LYZ A;  1WTM A;  3UON A;  4PK0 A;  4WG1 A;  3AGG G;  2DKV A;  3LZ2 A;  4H92 A;  1L00 A;  157L A;  1LJ4 A;  115L A;  2CWI A;  4XJG A;  1L55 A;  1L49 A;  1L42 A;  1OVK A;  4WL6 A;  149L A;  1IIZ A;  5K7O A;  1WQR A;  4WM1 A;  1IO5 A;  1KS3 A;  2HUL A;  1DYG A;  2G4Q A;  1LYZ A;  2BQF A;  5LYT A;  140L A;  2MED A;  1HC0 A;  1C6K A;  1C6E A;  1B7R A;  5LYZ A;  1L95 A;  3TMW A;  4NGW A;  2BAA A;  1C6G A;  1L57 A;  4WLX A;  1TLA A;  3AB6 A;  2ZIJ A;  1L44 A;  5DLA A;  2ZQ3 A;  3CT1 A;  4DQ5 A;  1B0D A;  4GCF A;  1JTN A;  4HJZ A;  4NGV A;  4AQN A;  1NMM A;  4NFV A;  5KY1 A;  3LYT A;  172L A;  1KIR C;  3GUO A;  4OWA A;  3DMZ A;  1EQ5 A;  241L A;  1QUH A;  2W1X A;  1NF5 A;  1D6P A;  2A7D A;  1GPQ C;  3EMS A;  1L11 A;  1HML A;  251L A;  1L83 A;  1CU6 A;  2BQN A;  2OTY X;  1B5Z A;  1BWI A;  1C6A A;  6LYZ A;  1YIK A;  1CJ6 A;  4NIJ A;  5F14 A;  1SWZ A;  1B5Y A;  1LKS A;  1GE1 A;  1IC7 Y;  1DPW A;  5IHG A;  4LFX A;  2HEF A;  3QAK A;  4DJH A;  5LXW A;  1QTE A;  1A2Y C;  4HJV A;  4N8Z A;  3WPK A;  1NDG C;  3ZEK A;  4LDL A;  5KKI A;  1L16 A;  1GD6 A;  2ZYP A;  1L27 A;  3HT8 A;  4DD0 A;  1L08 A;  4I7Q A;  1L38 A;  1IWZ A;  1BVX A;  113L A;  3SN6 R;  1LJN A;  3C80 A;  5LIO A;  3P65 A;  3HH5 A;  3A3R X;  1L74 A;  1HEL A;  1JTT L;  1BVK C;  3TXE A;  1CU5 A;  1DZB X;  3WW5 A;  4E97 A;  4H9E A;  3LYM A;  2Z37 A;  262L A;  3G3X A;  2B6T A;  5FHW A;  1IP6 A;  237L A;  1IY4 A;  4Z46 A;  1C6M A;  4RW1 A;  180L A;  1BB6 A;  2BQB A;  1LJI A;  4LYT A;  1GBS A;  1C6T A;  1L02 A;  4NY5 A;  1L23 A;  3D3D A;  4WL7 A;  1GAZ A;  4XJI A;  1YQV Y;  3SB6 A;  4I7K A;  1IWV A;  2QAR C;  250L A;  4O34 A;  4DD7 A;  1D9W A;  1L10 A;  3HT7 A;  2XJW A;  5HNC A;  2ZNX Y;  2BQJ A;  3N9C A;  1IOQ A;  2BQH A;  4NGJ A;  1YAO A;  259L A;  1L84 A;  3A90 A;  1W08 A;  1CVK A;  5FST A;  2RBQ A;  4EKR A;  3NY8 A;  1HFZ A;  226L A;  219L A;  1TAY A;  4BAP A;  1PQD A;  4ETD A;  2HUB A;  4NGK A;  2I25 L;  1L76 A;  2FYD A;  1G0J A;  1P46 A;  2D91 A;  1RFP A;  1JKA A;  5I54 A;  1L22 A;  129L A;  147L A;  2ANX A;  5LVG A;  3OE0 A;  1IOT A;  1AM7 A;  1P2C C;  195L A;  1LMP A;  1L39 A;  5FDJ A;  1L15 A;  2DQA A;  3C7W A;  1SWY A;  1GBZ A;  1CKF A;  1PQK A;  3A93 A;  5LIN A;  246L A;  102L A;  4NGI A;  220L A;  1MLC E;  1LZS A;  3OK0 A;  1VFB C;  145L A;  2XBS A;  3SB9 A;  4S0W A;  4EKS A;  2ZWB A;  184L A;  4DDC A;  2DQD Y;  1GE4 A;  2LCB A;  4WO6 A;  4DAJ A;  1QDR A;  1OP9 B;  1IWT A;  2RSC A;  1JJ3 A;  212L A;  1LSE A;  1GFJ A;  4X3B A;  1T8A A;  9LYZ A;  1YAQ A;  1C6D A;  1OUA A;  1OWY A;  4EXM A;  1CU3 A;  1N4F A;  1GF3 A;  1C6N A;  5KXL A;  4RW2 A;  4UWN A;  1CJ8 A;  1LMQ A;  249L A;  4NHP A;  225L A;  1INU A;  1L0J A;  3F6Z A;  3HTD A;  1GEZ A;  168L A;  187L A;  2XTH A;  1VDS A;  4YX7 C;  3WUM A;  1JKD A;  1I6S A;  2Z12 A;  3SB7 A;  4OWH A;  5C6I A;  4HTN A;  2A7F A;  143L A;  4R0F A;  4ETC A;  1G7J C;  2OU0 X;  1OYU A;  5DN5 A;  198L A;  5E4P A;  4ANR A;  4CGE A;  4ZIX A;  173L A;  1HEW A;  4J7V A;  3A95 A;  2B72 A;  5JEN B;  4XYY A;  1LGU A;  1JEF A;  1RCM A;  4DQJ A;  177L A;  4GCE A;  1T8F A;  1D6Q A;  1OQM A;  1IR7 A;  1QTZ A;  155L A;  1CV0 A;  3CSZ A;  2BQK A;  1LW9 A;  2ZIK A;  2BLY A;  2BLX A;  4GBR B;  1L37 A;  1LAA A;  2DBT A;  3DN6 A;  1L34 A;  1LLH A;  209L A;  5I14 A;  1IP3 A;  1L41 A;  3QY4 A;  110L A;  1LZ5 A;  2RB2 X;  1TEW A;  1LJF A;  1LZT A;  1LSM A;  1CX6 A;  1T6H A;  3P66 A;  1FBI X;  1P6Y A;  3WMK A;  240L A;  2F2N A;  4CFO A;  1IOC A;  4YEN A;  3M18 B;  1YKX X;  156L A;  1C60 A;  2YBI A;  4EJ4 A;  2RAZ X;  3A96 A;  197L A;  1C46 A;  4WM5 A;  4UWU A;  2HEB A;  4AXT A;  1G0L A;  4DD1 A;  1HHL A;  5A3E A;  1GB0 A;  4DD9 A;  2EIZ C;  3WUA A;  3LYO A;  1JTP L;  5KXM A;  1CUQ A;  4HV1 A;  1A4V A;  1QTC A;  1JIY A;  1UUZ C;  1IP2 A;  1JJ0 A;  2YDG A;  1IC5 Y;  1GBX A;  4J1A A;  3HDF A;  1IP7 A;  234L A;  1GAY A;  1GE3 A;  7LZM A;  3CDT A;  3CT0 A;  4NHS A;  1LJH A;  1LJK A;  1V7S A;  3T36 A;  1QQY A;  1LZ4 A;  1HSX A;  1QTB A;  1UIF A;  1LHK A;  1B5W A;  5EBH A;  1L03 A;  132L A;  174L A;  1AT5 A;  4P2E A;  3TXK A;  2RBO A;  1JPO A;  4G49 A;  210L A;  1GXX A;  191L A;  1VDT A;  1GB3 A;  1L21 A;  2RB1 X;  1JSF A;  1QSQ A;  5C6L A;  1ZVH L;  4LDE A;  1J1X Y;  166L A;  189L A;  126L A;  2BQA A;  3HBH A;  1IWY A;  1IR9 A;  4I7S A;  2OU9 A;  4I7N A;  1QUG A;  4H9A A;  1QT6 A;  5HMJ A;  1XSF A;  1LMT A;  4RLM A;  2FBB A;  1C6B A;  1L56 A;  1DKJ A;  3JR6 A;  3CQL A;  4W94 A;  1L86 A;  5DL9 A;  4D9Z A;  6LZM A;  1T97 A;  1WVU A;  4TUN A;  1C45 A;  3A91 A;  1LOZ A;  1OUJ A;  2LYM A;  1YRO A;  4KT3 A;  1L51 A;  4TX7 A;  3EO5 A;  252L A;  4B4E A;  2BQG A;  1SX2 A;  218L A;  1IVM A;  1GDW A;  4PJZ A;  4W56 A;  1J1O Y;  1QTH A;  3W6B A;  1LSZ A;  1LZ9 A;  1NWG A;  2IGC A;  1DXJ A;  1BQL Y;  1AT6 A;  1UIE A;  3W6F A;  1NDM C;  4HJY A;  4NHQ A;  3CT5 A;  4XJF A;  2DQG Y;  5LAG A;  236L A;  3W6E A;  1LZR A;  3LZM A;  1LGX A;  1L72 A;  4I7L A;  3TXF A;  4LYO A;  1YAN A;  134L A;  2B73 A;  4XAD A;  1CV6 A;  4R6C A;  1XGU C;  4ET8 A; 
#chains in the Genus database with same CATH homology
 2G4N A;  3B0K A;  4DQ7 A;  1LZ1 A;  3NY9 A;  3WU8 A;  4WM6 A;  4PPO A;  1L12 A;  4YEM A;  1LYD A;  4W53 A;  2W1Y A;  4M6D A;  2HUK A;  1HF4 A;  4LYZ A;  5FCP A;  5L9J A;  4DDA A;  223L A;  4LT0 A;  3CSQ A;  1LSN A;  1C68 A;  1L82 A;  4LYM A;  2H9J A;  3HTG A;  1L65 A;  188L A;  2RBN A;  4H8X A;  4WLD A;  4W57 A;  3AZ7 A;  142L A;  3G3V A;  1C6C A;  1IOR A;  1IR8 A;  4YM8 A;  178L A;  2O79 A;  5E9R A;  3WXU A;  151L A;  3RZE A;  4MCK A;  208L A;  5HLL A;  4ET9 A;  4G4B A;  1YKZ X;  5KXS A;  4ZEE A;  1H87 A;  4GCD A;  245L A;  1L43 A;  3LN2 A;  1LYJ A;  1DYE A;  3G3W A;  5LZM A;  3ZVQ B;  3HFM Y;  4OWC A;  1GF4 A;  1LYY A;  1UIG A;  1LZG A;  1UIA A;  4GN4 A;  5I4W A;  3AW6 A;  3CDV A;  1JHL A;  2H9K A;  4N9R A;  2L78 A;  1REX A;  3HT9 A;  1JWR A;  1WQN A;  5KXX A;  1C65 A;  1I1Z A;  2HEA A;  148L E;  1G1W A;  4MR1 A;  3EXD A;  1LKR A;  2Z38 A;  4LFP A;  1GB5 A;  3A94 A;  8LYZ A;  3GUJ A;  1AKI A;  2B6W A;  1IEE A;  4ETA A;  1D9U A;  4LT3 A;  1L77 A;  1UCO A;  1C10 A;  4NHI A;  1CKC A;  1WTN A;  104L A;  2BPU A;  2MEF A;  4GN5 C;  2B75 A;  111L A;  4ETE A;  3ATN A;  222L A;  1C6H A;  1QS5 A;  1L05 A;  2LZM A;  4ZFP A;  4NG8 A;  3AZ6 A;  1KXY A;  1L40 A;  4ARP A;  119L A;  1OWZ A;  1LYE A;  4HTK A;  3J4G A;  4YEO A;  3VW7 A;  1TDY A;  3RT5 X;  120L A;  1JQU A;  2ZNW Y;  2DQJ Y;  1L14 A;  1D3F A;  213L A;  3GUN A;  4OWE A;  5LYM A;  133L A;  2OE9 X;  1L79 A;  161L A;  1HMK A;  1PZY A;  2D6B A;  1L94 A;  3K3T A;  1IC4 Y;  2CGI A;  1C69 A;  5D5C A;  190L A;  1GFA A;  5LAF A;  3HU8 A;  4Z98 A;  3HWL A;  3HH4 A;  3WUL A;  2MEC A;  171L A;  1LYS A;  1LZD A;  5FEL A;  1ZVY B;  1GFT A;  3GUI A;  5F16 A;  1HEN A;  4DYG A;  3FA0 A;  3C81 A;  4PRQ A;  2HTX A;  4EPF A;  3HUQ A;  1UIC A;  2MEB A;  1XGQ C;  2YBL A;  4TSB A;  114L A;  4B0D A;  5KXN A;  3W6D A;  2WAR A;  182L A;  2I26 L;  1TCY A;  3ZVQ A;  3WW6 A;  2Q0M X;  159L A;  1L53 A;  2YVB A;  164L A;  1WQP A;  6LYT A;  1WTH A;  5C6J A;  3T6U A;  1QT7 A;  3CDO A;  4LYC A;  1VAU A;  4WM2 A;  3OJP A;  1QTD A;  2YBN A;  3SB8 A;  5L3I A;  2GV0 A;  1L25 A;  1O23 A;  1QT4 A;  211L A;  4DD2 A;  3SBB C;  1KIP C;  4MST A;  1LJ3 A;  1LCN A;  3L2X A;  1L73 A;  1GFU A;  3AJN A;  3RUN A;  200L A;  3A3Q A;  5KXK A;  4A7D A;  1RE2 A;  227L A;  1LWG A;  1TBY A;  4H93 A;  1G0M A;  2LZT A;  5I53 A;  4XN6 A;  1UID A;  5KXT A;  1B7S A;  1HEQ A;  1WQQ A;  3GUK A;  5APD A;  5I5Q A;  3TMU A;  2Z19 A;  1L04 A;  1OUG A;  1LYG A;  1NBZ C;  3GUL A;  1GB9 A;  1UC0 A;  3CDQ A;  224L A;  4I7P A;  1L45 A;  1GFR A;  2OEA X;  1HER A;  3AGH A;  1GBY A;  1UIB A;  1QSW A;  2DQC Y;  4WLY A;  4N1C C;  1DI4 A;  4B4J A;  1B7L A;  1CV5 A;  1DPX A;  1L54 A;  1L29 A;  4NWE A;  1JKB A;  1F10 A;  221L A;  4XJD A;  1LGW A;  2RB0 X;  1B2K A;  1FKV A;  3FI7 A;  1CV3 A;  4KL7 A;  244L A;  139L A;  2F4A A;  2MEH A;  3C82 A;  3HTF A;  1GB7 A;  5APC A;  1GHL A;  4W55 A;  4NSI A;  3W6A A;  1L07 A;  4XEN A;  1SSY A;  1E8L A;  1QT3 A;  1WVV A;  4H8Z A;  215L A;  4NSH A;  3QNG A;  1DI3 A;  3TXB A;  146L A;  1LSY A;  1LZC A;  1BWJ A;  2EKS C;  1G0K A;  5LA8 A;  4H90 A;  4GCB A;  3CDR A;  3AZ5 A;  2BQM A;  4H9I A;  152L A;  5L3H A;  1L24 A;  1YIL A;  2W1M A;  1LZE A;  4N0J A;  1OV7 A;  4W51 A;  4KPM A;  3P4Z A;  1L47 A;  1C43 A;  1PQM A;  1B6I A;  4NHT A;  2B5Z A;  4G9S A;  3DMV A;  1EL1 A;  1OUC A;  4YF2 A;  1L36 A;  3CB7 A;  3DMX A;  192L A;  3D9A C;  1PQJ A;  5KXZ A;  2O4W A;  5KXY A;  1KNI A;  1IWX A;  3EML A;  1LYO A;  3WU7 A;  4XJH A;  5APE A;  5M1Y A;  3DN2 A;  1L30 A;  1YL0 X;  1L61 A;  1D0L A;  1D3M A;  4II8 A;  3OE6 A;  3WH1 A;  4ZPU A;  1GF9 A;  1XEP A;  2HU1 A;  1G07 A;  4WMG A;  4NSJ A;  1YAM A;  3J6K A;  4W52 A;  1L48 A;  3MGW A;  261L A;  1YAP A;  3C8S A;  2A4T A;  108L A;  5DM9 A;  206L A;  3TMV A;  2HUM A;  1ALC A;  5ILC A;  1GWD A;  4K5Y A;  2ZYC A;  1L31 A;  233L A;  2D4I A;  5FEK A;  1FN5 A;  3PBL A;  1IP4 A;  1LHH A;  1L85 A;  4H9C A;  1GFE A;  2MEG A;  1NHB A;  1CV1 A;  1LMO A;  3WVX A;  1B5X A;  1OUD A;  2B6Y A;  2Q9E A;  4CJ2 A;  2NTG A;  3HBE X;  2OE7 X;  2Q9D A;  4TSC A;  1L98 A;  1BB4 A;  1P56 A;  1XGP C;  1BB5 A;  1CKH A;  1F0W A;  1GB2 A;  3TXG A;  4LGK A;  107L A;  1L71 A;  3HUK A;  1L0K A;  4Z41 A;  1L89 A;  1L59 A;  176L A;  1ZUR A;  2RBP A;  3D4S A;  1L69 A;  2F4G A;  1DKK A;  1KW7 A;  1LSA A;  1FLY A;  1KY1 A;  4HTQ A;  4PJ2 C;  5KXR A;  1LYH A;  2F32 A;  2RH1 A;  4TTD A;  4N5R A;  4EKQ A;  4BAD A;  1CU2 A;  1WQO A;  3L64 A;  1LMC A;  1C6I A;  1B5U A;  1L80 A;  2HEE A;  1IOS A;  4GLA A;  1L96 A;  2AUB A;  4OW1 A;  1JIS A;  1XJT A;  1ZMY L;  2RAY X;  2C8P A;  3BKH A;  1LMN A;  3HBD A;  1IP1 A;  1L66 A;  1VDP A;  1SX7 A;  2LYO A;  154L A;  130L A;  1L58 A;  243L A;  2ANV A;  5I4Y A;  2D4K A;  3AYQ A;  1DI5 A;  1LSP A;  3WL2 A;  1LHM A;  5LVK A;  4NEB A;  2HEC A;  1YL1 X;  1XEJ A;  1LHI A;  4KXI A;  3WPJ A;  1GFG A;  1PQI A;  4M4O A;  2XBR A;  3BKV A;  1LYI A;  4QY9 A;  1OV5 A;  3IJU A;  3GUM A;  4GRV A;  1JKC A;  3HU9 A;  4NGL A;  4N1E I;  5B06 A;  1L75 A;  1LSC A;  4AGA A;  1QTK A;  4NGY A;  103L A;  1L97 A;  3HUA A;  1JIT A;  1XFP L;  3WU9 A;  4ETB A;  2YBH A;  1D3N A;  3WVY A;  1OUF A;  1GB6 A;  4G4H A;  2NWD X;  216L A;  1G1V A;  201L A;  1L09 A;  1DYD A;  1GDX A;  1JSE A;  3DN1 A;  1LI3 A;  150L A;  4NSG A;  1JUG A;  228L A;  3GXR A;  135L A;  1LI6 A;  1IX0 A;  4EKP A;  199L A;  3B0I A;  2HU3 A;  1L81 A;  138L A;  123L A;  1QSB A;  1HEO A;  3AGI A;  1RJC B;  5F9U A;  3WUN A;  1LHL A;  3DN3 A;  5LVI A;  185L A;  3A92 A;  5I4X A;  1IWU A;  4E3U A;  4I7R A;  3VWO A;  1P5C A;  1C67 A;  4PHI A;  5LA5 A;  5D5F A;  1LZY A;  4OWB A;  1P64 A;  1B7O A;  2CUU A;  1G0P A;  1C6F A;  2F47 A;  1L26 A;  3F9L A;  1C6P A;  1LSG A;  2OE4 X;  1BGI A;  4H91 A;  4H8Y A;  3NYA A;  1XJU A;  1OUH A;  3DN4 A;  1LPI A;  229L A;  1FDL Y;  1BHZ A;  1C66 A;  4FDY A;  1CTW A;  1D0M A;  1KXW A;  1XGT C;  4BS7 A;  1FLW A;  4LYB A;  1XEK A;  2LHM A;  3EBA B;  1L99 A;  2Z2E A;  1C7P A;  1L01 A;  1L68 A;  4CFP A;  5KXO A;  5B1F A;  4LZM A;  1P3N A;  1GE2 A;  2DQH Y;  1L67 A;  3DN0 A;  2I6Z A;  3TXH A;  1LWK A;  3IWR A;  183L A;  3A34 A;  1QDT A;  1T8G A;  5F9X A;  1UAC Y;  1PQO A;  2C8O A;  4L41 A;  5LVJ A;  1L19 A;  1FLQ A;  1GFH A;  169L A;  1QS9 A;  4ARM B;  1G0G A;  1GE0 A;  1LJJ A;  4W59 A;  4ARJ A;  1XEI A;  1GB8 A;  2FBD A;  2LYZ A;  170L A;  1ZYT A;  3A6B Y;  4RLN A;  1L62 A;  3P68 A;  3P64 A;  1F6R A;  4H9F A;  1SQ2 L;  3W3E A;  2DQI Y;  1HFX A;  231L A;  1OUE A;  4DDB A;  1GF0 A;  5J7C A;  2RBR A;  3WXT A;  5B05 A;  1GEV A;  3N9A A;  1B7Q A;  1REM A;  4OOO A;  3DN8 A;  3C7Y A;  1C64 A;  2B74 A;  1L06 A;  3A67 Y;  4EPI A;  1DQJ C;  1IP5 A;  1GF5 A;  2OTZ X;  2N5Z A;  3CSR A;  260L A;  1UA6 Y;  4TWS A;  7LYZ A;  1G7L C;  2B70 A;  1CKD A;  1W6Z A;  2FYC A;  1G0Q A;  1C6J A;  4EMN A;  1Z55 A;  2EPE A;  1FLU A;  4B1A A;  1GF6 A;  128L A;  1G7H C;  4W54 A;  256L A;  3V2Y A;  1GBO A;  4QDN A;  2YSS C;  5B59 A;  4ARL A;  4C5F A;  1V7T A;  4WG7 A;  1P7S A;  2H5Z A;  1DYB A;  1L28 A;  4OOT A;  1QIO A;  4H94 A;  4GLV A;  153L A;  3ULR A;  2ZQ4 A;  3DNA A;  4I7T A;  1IY3 A;  2IFF Y;  1P2R A;  3ATO A;  1CV4 A;  4NWH A;  1EQE A;  1C62 A;  254L A;  1CU0 A;  1GFK A;  242L A;  2MEA A;  1QTV A;  1LZ8 A;  2QB0 B;  1LJE A;  1L50 A;  1J1P Y;  3DKE X;  232L A;  4DD3 A;  4Z3M A;  4HPI A;  4YXC A;  4LT1 A;  3RNX A;  4H9H A;  1GF8 A;  1KW5 A;  3LZT A;  1LZN A;  1I20 A;  1P37 A;  3SP3 A;  4I7J A;  3HTB A;  4EOF A;  3C8R A;  4C3W A;  3RZ4 A;  1HEM A;  1OUB A;  1QT8 A;  4I0C A;  2F2Q A;  2Z2F A;  127L A;  5LVH A;  1LSB A;  1LJG A;  1CX7 A;  230L A;  5HNL A;  1LTM A;  109L A;  1GXV 2;  4NG1 A;  3TXJ A;  3AZ4 A;  144L A;  4I7O A;  238L A;  2VB1 A;  3GXK A;  2HED A;  1JTO L;  4B4I A;  1L64 A;  255L A;  1CJ9 A;  4J0L A;  125L A;  4ARM A;  1G06 A;  1B5V A;  2F30 A;  1CKG A;  1LZ6 A;  5B07 A;  1L60 A;  217L A;  239L A;  4PGJ B;  3W6C A;  2X0A A;  118L A;  4PRU A;  3RU5 A;  2BQL A;  4DC4 A;  1L63 A;  141L A;  1QUT A;  4HPE A;  1OVJ A;  4IAT A;  1L20 A;  167L A;  165L A;  4ARQ B;  4DWX A;  1P2L A;  1OUI A;  2Z6B A;  4WM4 A;  4H1P A;  1D2Y A;  1P36 A;  1REZ A;  1SSW A;  3TXI A;  4HP0 A;  4G4C A;  2BQC A;  1HFY A;  1G7I C;  1L32 A;  3E3D A;  5KKJ A;  3C83 A;  1L92 A;  4QEQ A;  2EQL A;  4IJ4 A;  248L A;  1PS5 A;  4I8S A;  3B72 A;  3A8Z A;  4FJR A;  4J1B A;  3G3A B;  4WO9 A;  1FKQ A;  1YKY X;  1JTM A;  1LZB A;  112L A;  2DQF C;  1LI2 A;  2CJL A;  1UIH A;  1LYF A;  2MEE A;  4WOA A;  2D4J A;  4IAP A;  1QUS A;  1REY A;  1LHJ A;  5AMY A;  1LSD A;  193L A;  3FI5 A;  2YBM A;  258L A;  3M3U A;  1LMA A;  4OO9 A;  2XQO A;  1LSF A;  1MEL L;  2BQE A;  4W58 A;  1C08 C;  1NHE A;  5A3Z A;  163L A;  1C63 A;  1L17 A;  3OE8 A;  4GN3 A;  2G4P A;  4WM3 A;  5T3F A;  1EQ4 A;  2B7X A;  158L A;  1L13 A;  1HEP A;  3IJV A;  3HT6 A;  2B6X A;  3G3B B;  1CJ7 A;  4W96 A;  1QUD A;  3LHM A;  4IAS A;  162L A;  2IHL A;  1ZV5 L;  4QGZ A;  2W1L A;  2Z39 A;  1L52 A;  4HV2 A;  1C6Q A;  1L93 A;  3KAM A;  5KXW A;  1BB3 A;  1L33 A;  2DQE Y;  1C61 A;  3K2R A;  2BQI A;  2MEI A;  1VAT A;  1K28 A;  235L A;  247L A;  1CNS A;  3FE0 A;  257L A;  122L A;  1BB7 A;  5F81 A;  1RI8 B;  2RBS A;  1D0K A;  1JJ1 A;  205L A;  3B6L A;  4WLT A;  1DYC A;  196L A;  1IWW A;  4LZT A;  4RDS A;  5II3 A;  4DKL A;  1LZA A;  1HSW A;  5IEL A;  1GF7 A;  3ODU A;  1L90 A;  214L A;  1ZWN A;  1GBW A;  3HDE A;  5DN4 A;  1B9O A;  4BAF A;  1NKH A;  1T3P A;  4I7M A;  4ARQ A;  1H6M A;  5KJ9 A;  4CHX A;  1G7M C;  3OE9 A;  181L A;  1NBY C;  3GUP A;  253L A;  4YXA C;  4ML7 A;  2CDS A;  2B6Z A;  3PDS A;  1HNL A;  2O7A A;  1DYA A;  1D3J A;  5HMV A;  1KY0 A;  1SLY A;  4HSF A;  3WYH A;  2YBJ A;  1LPY A;  3AW7 A;  2LC9 A;  1CUP A;  1KIQ C;  1L70 A;  4NGO A;  4H9B A;  4YOP A;  2BQD A;  4UWV A;  3RW8 A;  1L87 A;  194L A;  1GFV A;  3B0O A;  4NGZ A;  5B1G A;  137L A;  2OU8 A;  1L35 A;  1XGR C;  3SB5 A;  3FAD A;  1VDQ A;  4LT2 A;  5APF A;  1B7P A;  2ZIL A;  1QT5 A;  1WQM A;  2PC2 A;  1L46 A;  3TMX A;  3A6C Y;  1VED A;  1AZF A;  1QSA A;  175L A;  1EPY A;  1L18 A;  3QE8 A;  160L A;  1B7M A;  207L A;  5IDD A;  1DYF A;  1L88 A;  2BQO A;  3C8Q A;  3HH6 A;  4XJB A;  1I56 A;  5KXP A;  4DT3 A;  3TXD A;  3V2W A;  1B7N A;  3WPL A;  4GCC A;  3SBA A;  1KXX A;  1NQI A;  3N9E A;  2NTH A;  3C7Z A;  1D2W A;  1F6S A;  1QUO A;  131L A;  186L A;  4B49 A;  3F8V A;  1BWH A;  5ILF A;  4LDO A;  2Y8P A;  1T6V L;  2LZ2 A;  1C6L A;  1UBZ A;  3HH3 A;  5HQ1 A;  1OVH A;  1L91 A;  4U3X B;  2Z18 A;  3LYZ A;  1WTM A;  3UON A;  4PK0 A;  4WG1 A;  3AGG G;  2DKV A;  3LZ2 A;  4H92 A;  1L00 A;  157L A;  1LJ4 A;  115L A;  2CWI A;  4XJG A;  1L55 A;  1L49 A;  1L42 A;  1OVK A;  4WL6 A;  149L A;  1IIZ A;  5K7O A;  1WQR A;  4WM1 A;  1IO5 A;  1KS3 A;  2HUL A;  1DYG A;  2G4Q A;  1LYZ A;  2BQF A;  5LYT A;  140L A;  2MED A;  1HC0 A;  1C6K A;  1C6E A;  1B7R A;  5LYZ A;  1L95 A;  3TMW A;  4NGW A;  2BAA A;  1C6G A;  1L57 A;  4WLX A;  1TLA A;  3AB6 A;  2ZIJ A;  1L44 A;  5DLA A;  2ZQ3 A;  3CT1 A;  4DQ5 A;  1B0D A;  4GCF A;  1JTN A;  4HJZ A;  4NGV A;  4AQN A;  1NMM A;  4NFV A;  5KY1 A;  3LYT A;  172L A;  1KIR C;  3GUO A;  4OWA A;  3DMZ A;  1EQ5 A;  241L A;  1QUH A;  2W1X A;  1NF5 A;  1D6P A;  2A7D A;  1GPQ C;  3EMS A;  1L11 A;  1HML A;  251L A;  1L83 A;  1CU6 A;  2BQN A;  2OTY X;  1B5Z A;  1BWI A;  1C6A A;  6LYZ A;  1YIK A;  1CJ6 A;  4NIJ A;  5F14 A;  1SWZ A;  1B5Y A;  1LKS A;  1GE1 A;  1IC7 Y;  1DPW A;  5IHG A;  4LFX A;  2HEF A;  3QAK A;  4DJH A;  5LXW A;  1QTE A;  1A2Y C;  4HJV A;  4N8Z A;  3WPK A;  1NDG C;  3ZEK A;  4LDL A;  5KKI A;  1L16 A;  1GD6 A;  2ZYP A;  1L27 A;  3HT8 A;  4DD0 A;  1L08 A;  4I7Q A;  1L38 A;  1IWZ A;  1BVX A;  113L A;  3SN6 R;  1LJN A;  3C80 A;  5LIO A;  3P65 A;  3HH5 A;  3A3R X;  1L74 A;  1HEL A;  1JTT L;  1BVK C;  3TXE A;  1CU5 A;  1DZB X;  3WW5 A;  4E97 A;  4H9E A;  3LYM A;  2Z37 A;  262L A;  3G3X A;  2B6T A;  5FHW A;  1IP6 A;  237L A;  1IY4 A;  4Z46 A;  1C6M A;  4RW1 A;  180L A;  1BB6 A;  2BQB A;  1LJI A;  4LYT A;  1GBS A;  1C6T A;  1L02 A;  4NY5 A;  1L23 A;  3D3D A;  4WL7 A;  1GAZ A;  4XJI A;  1YQV Y;  3SB6 A;  4I7K A;  1IWV A;  2QAR C;  250L A;  4O34 A;  4DD7 A;  1D9W A;  1L10 A;  3HT7 A;  2XJW A;  5HNC A;  2ZNX Y;  2BQJ A;  3N9C A;  1IOQ A;  2BQH A;  4NGJ A;  1YAO A;  259L A;  1L84 A;  3A90 A;  1W08 A;  1CVK A;  5FST A;  2RBQ A;  4EKR A;  3NY8 A;  1HFZ A;  226L A;  219L A;  1TAY A;  4BAP A;  1PQD A;  4ETD A;  2HUB A;  4NGK A;  2I25 L;  1L76 A;  2FYD A;  1G0J A;  1P46 A;  2D91 A;  1RFP A;  1JKA A;  5I54 A;  1L22 A;  129L A;  147L A;  2ANX A;  5LVG A;  3OE0 A;  1IOT A;  1AM7 A;  1P2C C;  195L A;  1LMP A;  1L39 A;  5FDJ A;  1L15 A;  2DQA A;  3C7W A;  1SWY A;  1GBZ A;  1CKF A;  1PQK A;  3A93 A;  5LIN A;  246L A;  102L A;  4NGI A;  220L A;  1MLC E;  1LZS A;  3OK0 A;  1VFB C;  145L A;  2XBS A;  3SB9 A;  4S0W A;  4EKS A;  2ZWB A;  184L A;  4DDC A;  2DQD Y;  1GE4 A;  2LCB A;  4WO6 A;  4DAJ A;  1QDR A;  1OP9 B;  1IWT A;  2RSC A;  1JJ3 A;  212L A;  1LSE A;  1GFJ A;  4X3B A;  1T8A A;  9LYZ A;  1YAQ A;  1C6D A;  1OUA A;  1OWY A;  4EXM A;  1CU3 A;  1N4F A;  1GF3 A;  1C6N A;  5KXL A;  4RW2 A;  4UWN A;  1CJ8 A;  1LMQ A;  249L A;  4NHP A;  225L A;  1INU A;  1L0J A;  3F6Z A;  3HTD A;  1GEZ A;  168L A;  187L A;  2XTH A;  1VDS A;  4YX7 C;  3WUM A;  1JKD A;  1I6S A;  2Z12 A;  3SB7 A;  4OWH A;  5C6I A;  4HTN A;  2A7F A;  143L A;  4R0F A;  4ETC A;  1G7J C;  2OU0 X;  1OYU A;  5DN5 A;  198L A;  5E4P A;  4ANR A;  4CGE A;  4ZIX A;  173L A;  1HEW A;  4J7V A;  3A95 A;  2B72 A;  5JEN B;  4XYY A;  1LGU A;  1JEF A;  1RCM A;  4DQJ A;  177L A;  4GCE A;  1T8F A;  1D6Q A;  1OQM A;  1IR7 A;  1QTZ A;  155L A;  1CV0 A;  3CSZ A;  2BQK A;  1LW9 A;  2ZIK A;  2BLY A;  2BLX A;  4GBR B;  1L37 A;  1LAA A;  2DBT A;  3DN6 A;  1L34 A;  1LLH A;  209L A;  5I14 A;  1IP3 A;  1L41 A;  3QY4 A;  110L A;  1LZ5 A;  2RB2 X;  1TEW A;  1LJF A;  1LZT A;  1LSM A;  1CX6 A;  1T6H A;  3P66 A;  1FBI X;  1P6Y A;  3WMK A;  240L A;  2F2N A;  4CFO A;  1IOC A;  4YEN A;  3M18 B;  1YKX X;  156L A;  1C60 A;  2YBI A;  4EJ4 A;  2RAZ X;  3A96 A;  197L A;  1C46 A;  4WM5 A;  4UWU A;  2HEB A;  4AXT A;  1G0L A;  4DD1 A;  1HHL A;  5A3E A;  1GB0 A;  4DD9 A;  2EIZ C;  3WUA A;  3LYO A;  1JTP L;  5KXM A;  1CUQ A;  4HV1 A;  1A4V A;  1QTC A;  1JIY A;  1UUZ C;  1IP2 A;  1JJ0 A;  2YDG A;  1IC5 Y;  1GBX A;  4J1A A;  3HDF A;  1IP7 A;  234L A;  1GAY A;  1GE3 A;  7LZM A;  3CDT A;  3CT0 A;  4NHS A;  1LJH A;  1LJK A;  1V7S A;  3T36 A;  1QQY A;  1LZ4 A;  1HSX A;  1QTB A;  1UIF A;  1LHK A;  1B5W A;  5EBH A;  1L03 A;  132L A;  174L A;  1AT5 A;  4P2E A;  3TXK A;  2RBO A;  1JPO A;  4G49 A;  210L A;  1GXX A;  191L A;  1VDT A;  1GB3 A;  1L21 A;  2RB1 X;  1JSF A;  1QSQ A;  5C6L A;  1ZVH L;  4LDE A;  1J1X Y;  166L A;  189L A;  126L A;  2BQA A;  3HBH A;  1IWY A;  1IR9 A;  4I7S A;  2OU9 A;  4I7N A;  1QUG A;  4H9A A;  1QT6 A;  5HMJ A;  1XSF A;  1LMT A;  4RLM A;  2FBB A;  1C6B A;  1L56 A;  1DKJ A;  3JR6 A;  3CQL A;  4W94 A;  1L86 A;  5DL9 A;  4D9Z A;  6LZM A;  1T97 A;  1WVU A;  4TUN A;  1C45 A;  3A91 A;  1LOZ A;  1OUJ A;  2LYM A;  1YRO A;  4KT3 A;  1L51 A;  4TX7 A;  3EO5 A;  252L A;  4B4E A;  2BQG A;  1SX2 A;  218L A;  1IVM A;  1GDW A;  4PJZ A;  4W56 A;  1J1O Y;  1QTH A;  3W6B A;  1LSZ A;  1LZ9 A;  1NWG A;  2IGC A;  1DXJ A;  1BQL Y;  1AT6 A;  1UIE A;  3W6F A;  1NDM C;  4HJY A;  4NHQ A;  3CT5 A;  4XJF A;  2DQG Y;  5LAG A;  236L A;  3W6E A;  1LZR A;  3LZM A;  1LGX A;  1L72 A;  4I7L A;  3TXF A;  4LYO A;  1YAN A;  134L A;  2B73 A;  4XAD A;  1CV6 A;  4R6C A;  1XGU C;  4ET8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...