1LSZA

Crystal structure of the mutant d52s hen egg white lysozyme with an oligosaccharide product
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
129
structure length
129
Chain Sequence
KVFGRCELAAAMKRHGLDNYRGYSLGNWVCAAKFESNFNTQATNRNTDGSTSYGILQINSRWWCNDGRTPGSRNLCNIPCSALLSSDITASVNCAKKIVSDGNGMNAWVAWRNRCKGTDVQAWIRGCRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(o-glycosyl)
molecule keywords HEN EGG WHITE LYSOZYME
publication title Crystal structure of the mutant D52S hen egg white lysozyme with an oligosaccharide product.
pubmed doi rcsb
source organism Gallus gallus
total genus 49
structure length 129
sequence length 129
ec nomenclature ec 3.2.1.17: Lysozyme.
pdb deposition date 1994-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00062 Lys C-type lysozyme/alpha-lactalbumin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.530.10 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 1lszA00
4H1PA 1XEJA 4CJ2A 1BGIA 3B72A 3TXHA 1WQRA 2W1MA 4YF2A 2G4PA 3B0IA 2XBSA 3OK0A 4QY9A 1NF5A 2C8PA 1HERA 1GFKA 1YAPA 2YDGA 3W6BA 4DWXA 4HTNA 3WPJA 1LMNA 4M4OA 2Z37A 4WM2A 1LSPA 5FELA 2GV0A 5KXPA 5KXXA 4N0JA 4NHPA 4XADA 5HQ1A 4MSTA 4QEQA 5HMVA 2YBNA 4AXTA 2DQEY 2A7FA 5KKJA 1UACY 5B07A 5I54A 1XFPL 4N1EI 1QUSA 4H90A 1GFVA 1YKZX 5LA5A 1B7MA 4W94A 4NSHA 1F0WA 1WQMA 3AB6A 4DD0A 4HPIA 3ZVQA 1KIRC 2YVBA 1IOSA 4J7VA 4XJHA 5KXWA 1LSEA 4M6DA 2G4NA 2ZQ3A 1UIDA 2D4KA 1REZA 4DD3A 4WLDA 1I1ZA 4H9FA 2Z2EA 4R6CA 5D5CA 1IC7Y 1GF8A 1UA6Y 2EPEA 4DD1A 1GB0A 4NG1A 1OUDA 1SQ2L 1BVXA 1JSFA 1AT5A 1LHMA 3LZ2A 2CJLA 2D4IA 3OJPA 5E9RA 1OQMA 1WTMA 5II3A 5HLLA 1F6SA 1QIOA 4DC4A 2HEAA 1XGPC 2DQAA 4YOPA 3K3TA 3WUAA 1BB3A 5DL9A 1LMPA 1OUGA 1FDLY 4XJIA 5D5FA 4RLNA 3AW7A 4KPMA 1D6QA 1LZ1A 2LYOA 3TXJA 1GFGA 4NSJA 4YENA 3AZ5A 1BB4A 1DKKA 3A34A 1HEPA 1WQOA 2H9JA 4DDCA 1G7JC 3A92A 207LA 3A67Y 3W6DA 4IASA 1LMCA 1AZFA 5APCA 2Y8PA 4PHIA 3P66A 4OWHA 1LZAA 4WL7A 1KIQC 4CFPA 135LA 2YBLA 1YL0X 1GPQC 1LJJA 4XENA 3LN2A 3RZ4A 1TCYA 1LCNA 1DQJC 4C3WA 3CSRA 3QNGA 1GDXA 1GE3A 2DQDY 4B4IA 4B49A 2MEDA 5LYZA 4NEBA 1LMTA 4GCCA 4Z3MA 3ZVQB 3WW5A 1GBOA 3TMUA 2VB1A 4Z46A 5ILCA 2HEDA 1AKIA 1IO5A 1ZMYL 1OUFA 3RNXA 4HV2A 4LYBA 1CKFA 4G9SA 3FE0A 3A6CY 2B5ZA 4UWVA 2XTHA 3LYZA 1C46A 2LYZA 4H8XA 1LSZA 2BQIA 4G4HA 3AZ7A 4HV1A 3B6LA 4OW1A 2BLXA 2BQAA 3W6AA 1GB7A 5T3FA 1C10A 2HUBA 2EKSC 2ZNXY 5A3EA 1IOTA 1REXA 1OUJA 1IP4A 4GN5C 4Z98A 1YQVY 3WPLA 1EQ5A 4WLTA 1LZ8A 1IP5A 1JPOA 1LYYA 2BQOA 1DKJA 4ETCA 1MELL 5KJ9A 1HMKA 5E4PA 1GF3A 1GBSA 1JITA 1IC5Y 1UICA 1XGUC 1UC0A 1YL1X 2BLYA 2CWIA 4TWSA 4WM6A 3WVXA 5KXOA 3GXKA 1G7IC 1GBXA 1IY3A 2BQHA 1INUA 2MEBA 1TEWA 3BKVA 3HBHA 3M3UA 5C6LA 5KXLA 2HEBA 1HENA 5AMYA 4TX7A 1LHLA 3WXTA 4OWAA 1LYZA 2BQKA 3LYMA 1KXWA 4NHTA 4ETAA 2YBJA 4II8A 1NBZC 4H9BA 1D9UA 1LJEA 4RW2A 1IOCA 5B06A 1GFAA 5KXRA 1NWGA 3WW6A 1FLYA 2YBIA 3CT0A 1IR7A 4BS7A 9LYZA 1AM7A 1KIPC 1V7SA 1TAYA 1LSBA 2BQLA 1B7RA 1LAAA 5ILFA 1IOQA 1HSXA 1TDYA 5IDDA 5LVKA 1D0LA 4DYGA 1REMA 2DQIY 2I25L 3N9AA 1ZVHL 1OUEA 4NG8A 4YEMA 1MLCE 2D4JA 1IP2A 1LSDA 4NFVA 3WMKA 1IX0A 4GLVA 1LZBA 1QUTA 5DN4A 2LHMA 2MEGA 2HU1A 1YAMA 2BQEA 5M1YA 4RLMA 4LYCA 3J6KA 1FLUA 1XEKA 1LJNA 1LTMA 2G4QA 5KXMA 4H92A 4HSFA 5F16A 1GFRA 2LZ2A 5L3IA 3TXDA 4HTQA 2BQFA 1EL1A 1IP3A 1JTOL 1LSMA 4R0FA 4OWEA 1JKCA 2ZQ4A 3ZEKA 4WL6A 2ZYCA 1BB5A 3G3BB 1BWJA 1LZNA 1IIZA 4AGAA 1W6ZA 2EIZC 8LYZA 4NIJA 4X3BA 1JKDA 4J1BA 134LA 2FBDA 2ZIKA 5I4XA 3J4GA 4XJGA 1LZ4A 3W3EA 4WM5A 1JKAA 1GHLA 4H9IA 1FN5A 1GE4A 1KXXA 3TXGA 5L3HA 4DD2A 3WL2A 1LMAA 2BQMA 2FYCA 4FJRA 1D0MA 4NGVA 3VWOA 1B7LA 1BWHA 5L9JA 2PC2A 4LFPA 1BWIA 4OWBA 1LSFA 4WM1A 1GF6A 4BAPA 4KXIA 1ZVYB 2A7DA 5B05A 208LA 3CSZA 3WU7A 4BADA 4XJBA 1DPWA 2C8OA 2DQJY 4ANRA 1GFJA 5KXTA 5DN5A 5F9XA 1GDWA 3TXFA 3AGIA 4FDYA 3E3DA 4WOAA 1HFYA 4H9AA 1LHIA 1ALCA 1BB6A 1IC4Y 1A4VA 1GEZA 4BAFA 3TXBA 1GEVA 2IHLA 1BB7A 1UIBA 3WYHA 4QDNA 4O34A 4TTDA 3A95A 1C43A 3P4ZA 4WM3A 4H8YA 3KAMA 1B0DA 1W08A 2BQNA 1AT6A 3IWRA 4J0LA 4DD7A 1LJ3A 1IWTA 2F4GA 1B2KA 1LZYA 3LHMA 4H8ZA 7LYZA 1B9OA 1HNLA 1LHJA 4B4JA 5IHGA 2D91A 3AZ6A 1GXV2 1F10A 5I5QA 1ZV5L 1GAYA 1HEWA 3A3RX 4A7DA 1HFXA 4ETBA 5LAGA 1IY4A 3RT5X 1LSCA 2YBMA 2BQJA 2ZWBA 2IFFY 4XYYA 4UWUA 4NGZA 1LJIA 1DI4A 1LKSA 4ET9A 1LZ9A 2H9KA 3N9CA 4NSIA 1NDMC 4N8ZA 3CB7A 2W1YA 5LAFA 3M18B 5KXYA 1VEDA 1C45A 3WH1A 3QE8A 3G3AB 4H9EA 4OOTA 1HFZA 1GE2A 4XJDA 4NWHA 2BQCA 4HJZA 3TMWA 1VAUA 1LMQA 1Z55A 2HEEA 2BQDA 5FEKA 2XBRA 1GB2A 1GB9A 4RDSA 1GF7A 4GCEA 5LIOA 5K7OA 4CGEA 4B1AA 1G7HC 3A93A 3AYQA 4OOOA 4CHXA 1UIHA 1B7QA 1QQYA 3WUNA 1A2YC 1YKXX 1G7LC 6LYTA 3W6CA 1IWVA 2YSSC 4P2EA 4ML7A 1REYA 4ETEA 1B5UA 3P68A 2F4AA 4D9ZA 1P2CC 1FKVA 1H87A 1IORA 2W1XA 1YANA 1HEQA 1CJ6A 1OUAA 4RW1A 1WQQA 1GXXA 1LPIA 3A96A 1UIFA 3HBEX 1GF5A 1NDGC 3HBDA 1FKQA 4N9RA 4LGKA 5LA8A 4EOFA 2MEFA 1VDSA 2F2NA 1LZDA 3AZ4A 2D6BA 3LYOA 4N5RA 5I53A 5KKIA 132LA 1FBIX 1JHLA 1GFTA 1TBYA 1GF9A 3A3QA 3HFMY 4GCBA 4NGKA 3A8ZA 3WULA 1LKRA 2CDSA 4J1AA 1SLYA 2RSCA 2MECA 3MGWA 1T3PA 4L41A 3TXEA 5DM9A 1GF4A 4HJVA 5APFA 3TXIA 1YIKA 1JISA 3RW8A 4NSGA 1VFBC 1QSAA 4GN4A 4I8SA 5I4YA 1LZSA 4ET8A 1J1PY 2HU3A 3ATOA 3A91A 1C7PA 1LZGA 1IWWA 1LJHA 1B7NA 1JSEA 2ZYPA 1LZTA 4WO6A 5KXNA 4YM8A 2BQGA 4ZIXA 1IWXA 3IJVA 2BQBA 1YKYX 4DDAA 2MEEA 2MEHA 1HF4A 4MCKA 4U3XB 1IR8A 1D6PA 2YBHA 5F9UA 1CNSA 2Z18A 1LJFA 3EXDA 4LYOA 4NGYA 1IR9A 3AGGG 1GAZA 1JIYA 3CQLA 4GLAA 4WO9A 1CKDA 1GE0A 4NHIA 3WUMA 4NGJA 4G49A 2BPUA 1NMMA 1NBYC 3AGHA 1GFHA 1GBYA 2LYMA 4NGLA 1JJ3A 1JTPL 1CJ7A 1I20A 2HECA 4MR1A 1DI3A 1G7MC 1PZYA 1IEEA 1RCMA 1XEIA 4NHSA 4QGZA 5IELA 1CJ9A 1VDQA 2NWDX 5LYTA 1IP1A 4NHQA 1YAOA 1J1XY 3AJNA 5HMJA 1GB5A 3CT1A 2DQFC 4NGWA 5FHWA 2LZTA 4LT2A 1UUZC 5F14A 4LT3A 1F6RA 1LYOA 1JEFA 2FYDA 1QDTA 2DKVA 3LYTA 3LZTA 4GN3A 4H93A 1DXJA 1LJKA 1LZRA 1XGQC 2N5ZA 4NY5A 4LYZA 1WQPA 1OUHA 4W96A 1CKHA 1CJ8A 4H94A 1GB3A 4ETDA 4HPEA 1GBWA 1XSFA 5KXKA 5B59A 3A94A 1XGRC 5B1GA 5LVHA 133LA 4ZEEA 4B0DA 1RI8B 1BHZA 1QTEA 5EBHA 5KXSA 1NHEA 1V7TA 4H91A 4C5FA 4WG7A 1LZ5A 1CKCA 1GWDA 4DT3A 2ZNWY 1JKBA 1JTTL 5LINA 3T36A 4WM4A 1B7OA 5JENB 4LFXA 5APEA 1JWRA 1LOZA 1UCOA 4I0CA 3WXUA 4KT3A 154LA 1VDPA 3IJUA 1LZ6A 5LYMA 2FBBA 1HHLA 2XJWA 3F6ZA 4LT0A 4LZTA 1GE1A 3TXKA 4PRUA 1LHKA 1WQNA 4Z41A 153LA 5DLAA 4DD9A 3P64A 4TSBA 5FCPA 1EQEA 2EQLA 2Z2FA 1IVMA 3ULRA 4NGIA 1NQIA 5LVGA 1IWZA 1JUGA 1I56A 1QSWA 2AUBA 5LVIA 5C6IA 1FLQA 2DQGY 2W1LA 5HNCA 4ZFPA 4LYTA 5I4WA 1VDTA 1LJ4A 1GB8A 5LXWA 4IJ4A 1E8LA 3W6FA 1T6VL 4N1CC 4DDBA 1LSAA 193LA 4NWEA 1JJ1A 3A90A 1YILA 2WARA 2I6ZA 3T6UA 1KXYA 1DZBX 4CFOA 1IP7A 1D0KA 1O23A 1OUCA 3BKHA 1XGTC 2DQCY 4UWNA 4LT1A 1LZEA 1UIAA 1LJGA 4WLYA 2MEIA 3WVYA 1CKGA 3CT5A 4H9HA 3WU8A 2Z39A 4G4BA 3D9AC 1B5XA 4E3UA 1RE2A 1GD6A 3D3DA 2Z12A 1PS5A 4KL7A 3RU5A 4WMGA 4PJ2C 4OWCA 4WLXA 1B5WA 4YEOA 5FSTA 4IATA 1C08C 2BAAA 3TMXA 1OP9B 1BVKC 2ZIJA 3GXRA 1HMLA 1RFPA 4TSCA 1HSWA 1DPXA 4PPOA 1JJ0A 1B7SA 2DBTA 5J7CA 1IWUA 1HELA 194LA 2X0AA 1QDRA 4HP0A 2DQHY 3N9EA 3QY4A 3B0KA 1LSGA 3B0OA 4PRQA 5HNLA 1LZCA 1J1OY 1LHHA 1WTNA 1B5VA 2Q0MX 3CSQA 2F30A 3FI7A 4NGOA 5FDJA 3WPKA 1GF0A 6LYZA 1B5YA 3AW6A 1VATA 1YROA 1HEOA 1GFUA 2HTXA 1IP6A 2Z38A 2CGIA 4G4CA 4HJYA 3EMSA 5F81A 1N4FA 4PGJB 1UIGA 1GFEA 2H5ZA 3EO5A 1H6MA 3WU9A 1HEMA 1EQ4A 2HEFA 3W6EA 4EMNA 4HTKA 4LYMA 1NKHA 1FLWA 1WVUA 4B4EA 5KY1A 3EBAB 1BQLY 1GBZA 1YAQA 1HC0A 5APDA 1LMOA 4GCDA 1IWYA 1WVVA 4GCFA 5LVJA 4XN6A 4WG1A 1LSNA 4H9CA 4XJFA 5KXZA 1DI5A 1UIEA 3TMVA 5A3ZA 1RJCB 1OUBA 1LSYA 1B5ZA 1OUIA 2Z19A 5B1FA 2ZILA 3P65A 4TUNA 3A6BY 2I26L 5C6JA 1B7PA 2MEAA 1QTKA 3SP3A 3ATNA 1UBZA 1GB6A 1LYSA
chains in the Genus database with same CATH superfamily
3TXHA 3B0IA 1C6IA 1L09A 2GV0A 4NHPA 4XADA 4QEQA 1L23A 1JTNA 1KW5A 2YBNA 1LWGA 1LYJA 1OV5A 5KKJA 1B7MA 2A4TA 3AB6A 3ZVQA 2YVBA 5KXWA 2G4NA 2D4KA 4GRVA 2Z2EA 1IC7Y 3HDFA 1OUDA 3DNAA 1JSFA 3FA0A 2D4IA 1PQDA 1OQMA 4EKPA 1WTMA 5HLLA 1CX6A 1QIOA 3PBLA 4YOPA 2LZMA 5DL9A 1OUGA 1DKKA 1QT5A 2H9JA 4DDCA 1L16A 207LA 3A67Y 2RB0X 1AZFA 3G3VA 1LZAA 1CV4A 249LA 1LYDA 1GPQC 1LCNA 1DQJC 4C3WA 3CSRA 2RB1X 1GDXA 2MEDA 4NEBA 4GCCA 2VB1A 1L93A 1OUFA 3RNXA 1L26A 4LYBA 1L35A 3LYZA 1CX7A 1L41A 4G4HA 3AZ7A 4HV1A 1P6YA 4ARQA 2HUBA 2EKSC 3HU8A 3HUAA 5A3EA 4GN5C 4WLTA 1LZ8A 238LA 2BQOA 5E4PA 1CU3A 1GBSA 1GF3A 2CWIA 4WM6A 145LA 1G7IC 7LZMA 1LYZA 3G3XA 3LYMA 2YBJA 1LJEA 4RW2A 247LA 1OVKA 4BS7A 1AM7A 3QAKA 3HTBA 1TAYA 2BQLA 5IDDA 1D0LA 152LA 1OUEA 1L92A 1MLCE 1L66A 1SSYA 2MEGA 2HU1A 4S0WA 260LA 2BQEA 1L12A 4LYCA 1XEKA 5KXMA 1CV1A 4H92A 2LZ2A 1EL1A 242LA 159LA 3C81A 4OWEA 1PQMA 210LA 1P36A 8LYZA 4NIJA 3DMVA 3J4GA 4XJGA 226LA 2RBOA 1L82A 212LA 4WM5A 1CUPA 5L3HA 3WL2A 2BQMA 1B7LA 1G0GA 1L31A 1BWHA 1KY0A 1LSFA 1GF6A 2RAZX 4KXIA 4XJBA 2C8OA 4I7SA 1L68A 3E3DA 1L88A 1L95A 236LA 3SB8A 3TXBA 1QTZA 4W55A 3WYHA 4EPFA 1QTHA 1CU5A 4H8YA 3KAMA 107LA 1B0DA 2BQNA 4W59A 3GUOA 228LA 1LJ3A 2RBNA 1C61A 1B9OA 1HNLA 1LHJA 2D91A 1GAYA 1C64A 245LA 110LA 5LAGA 178LA 6LZMA 2W1YA 3VW7A 1C45A 1QSBA 1L47A 1GE2A 4HJZA 1Z55A 5FEKA 4GCEA 5LIOA 5K7OA 1G7HC 3AYQA 1G7LC 1QUDA 4P2EA 4ML7A 4ETEA 1B5UA 1YANA 1CJ6A 1L55A 1C6BA 3HBEX 4N9RA 1VDSA 1LZDA 155LA 1C60A 1FBIX 3WULA 3HFMY 1LKRA 1L69A 1SLYA 5DM9A 1GF4A 3TXIA 1YIKA 1L21A 205LA 1LZSA 3ATOA 3FADA 1C7PA 1CU6A 4YM8A 5KXNA 237LA 2BQGA 261LA 144LA 1D6PA 158LA 1LJFA 4LYOA 4NGYA 234LA 1JIYA 1L42A 4NGJA 3WUMA 4G49A 4W56A 3AGHA 2LYMA 1CJ7A 4ARPA 219LA 4QGZA 3L64A 1CJ9A 1VDQA 1IP1A 1G0JA 1YAOA 1J1XY 5HMJA 3CT1A 5FHWA 1G1WA 1JQUA 2LZTA 4LYZA 1QTVA 1CKHA 1LYGA 5KXKA 1L96A 3A94A 1XGRC 221LA 1L74A 115LA 5EBHA 5KXSA 1V7TA 1LZ5A 1CKCA 2ZNWY 1C63A 240LA 4WM4A 4LFXA 5APEA 3WXUA 1LGUA 4KT3A 112LA 1LZ6A 3HU9A 122LA 1HHLA 1JTMA 4LZTA 1LHKA 3FI5A 4DD9A 2QB0B 3P64A 1EQEA 166LA 2Z2FA 147LA 2AUBA 1FLQA 1OVHA 4LYTA 186LA 4NWEA 1DZBX 1IP7A 5APFA 3BKHA 1XGTC 4LT1A 1LZEA 1LJGA 3OE8A 3WVYA 223LA 1CKGA 4H9HA 2RB2X 1RE2A 148LE 1PS5A 4PJ2C 1B5WA 3TMXA 4IATA 1C08C 4W52A 1BVKC 1HMLA 142LA 1L28A 3HT7A 4HP0A 3B0KA 1LSGA 4PRQA 2Q0MX 3WPKA 1WTNA 3CSQA 1SWZA 1B5YA 118LA 168LA 1GFEA 4DKLA 3WU9A 1HEMA 1C66A 3CDVA 2OE7X 4I7RA 1FLWA 1WVUA 3EBAB 151LA 1BQLY 1LMOA 1L52A 4GCDA 1L33A 5LVJA 214LA 3NYAA 4WG1A 200LA 2QARC 1LSYA 1OUIA 4I7TA 4TUNA 3A6BY 1C6QA 3ATNA 149LA 1GB6A 4XJDA 1LYSA 4CJ2A 1WQRA 2W1MA 4QY9A 2XBSA 1NF5A 1HERA 2YDGA 1LMNA 4E97A 131LA 3DKEX 3HH6A 4AXTA 2A7FA 5B07A 1L65A 1YKZX 4NSHA 1C6JA 4DD0A 4J7VA 4M6DA 1UIDA 1REZA 4DD3A 1UA6Y 229LA 1L87A 4DD1A 1GB0A 1SQ2L 181LA 1BVXA 4GBRB 3GUIA 3OJPA 5E9RA 1QSQA 1C67A 1L02A 4DC4A 2HEAA 1XGPC 4K5YA 1BB3A 4IAPA 4ZPUA 4RLNA 1LZ1A 2LYOA 3TXJA 4NSJA 1L83A 3DN4A 3OE0A 2Y8PA 3P66A 1KIQC 2YBLA 1YL0X 3LN2A 1TCYA 4B49A 2HEDA 4HV2A 4G9SA 3FE0A 1LSZA 3B6LA 4OW1A 2BLXA 2BQAA 3HTDA 2ZNXY 1IP4A 4Z98A 3WPLA 1YQVY 1EQ5A 1D3FA 1IP5A 1LYYA 1MELL 3RUNA 1IY3A 2NTGA 5KXLA 5C6LA 3M3UA 1G0MA 1LHLA 4ETAA 4II8A 1NBZC 1IOCA 1GFAA 1L46A 1FLYA 3HT8A 1V7SA 1LSBA 5ILFA 1IOQA 1HSXA 1TDYA 2DQIY 4NG8A 1IP2A 4GLVA 1LZBA 1C6CA 2LHMA 235LA 1C6NA 1L38A 3SB7A 2RBSA 1L13A 1LJNA 1GFRA 2LCBA 1CU0A 1CUQA 4HTQA 1JTOL 3EMLA 3ZEKA 4WL6A 1LZNA 1P5CA 1W6ZA 4AGAA 4I7OA 1PQIA 4J1BA 239LA 5I4XA 1LZ4A 3W3EA 1JKAA 1GE4A 1KXXA 4I7PA 1L58A 4FJRA 4NGVA 1L76A 3VWOA 1L61A 1BWIA 4ARMB 4BAPA 170LA 2A7DA 5B05A 3WU7A 4ANRA 1GFJA 5F9XA 4WOAA 4ARJA 1HFYA 1ALCA 1A4VA 1GEZA 4BAFA 1P7SA 4EXMA 1G0LA 2IHLA 4LDEA 216LA 1L79A 1KW7A 1LPYA 4O34A 3UONA 1C43A 3P4ZA 4WM3A 5I14A 177LA 1W08A 211LA 259LA 1IWTA 2F4GA 1LZYA 7LYZA 4B4JA 1C6AA 1GXV2 1F10A 3C83A 3A3RX 1B6IA 2BQJA 2B70A 1L86A 4ET9A 1LZ9A 3N9CA 257LA 4W51A 5LAFA 5KXYA 1VEDA 3WH1A 3QE8A 3G3AB 4OOTA 1HFZA 1L11A 2BQCA 1VAUA 1KS3A 1CV6A 1LMQA 1G0QA 2BQDA 1GB2A 1GB9A 1P64A 4B1AA 3A93A 1LWKA 4OOOA 3HH5A 4CHXA 1UIHA 3F8VA 5LZMA 1C6KA 187LA 231LA 1REYA 3P68A 1C65A 4D9ZA 1P2CC 1FKVA 1L00A 1L90A 3A96A 1UIFA 1GF5A 3HBDA 1FKQA 4EOFA 1D2YA 2MEFA 3LYOA 4N5RA 3AZ4A 132LA 2RBQA 1GF9A 3A3QA 3A8ZA 1L0JA 3CDTA 4J1AA 3MGWA 201LA 1P3NA 1PQOA 251LA 4I7NA 1SWYA 5I4YA 4ET8A 2HU3A 4WO6A 1JSEA 1LZTA 3IJVA 2B6TA 4DDAA 2MEHA 1HF4A 4MCKA 1IR8A 1CNSA 1L03A 1IR9A 4DQ5A 138LA 3HWLA 1L81A 4WO9A 3C8QA 1L89A 1GE0A 2ANXA 213LA 1NHBA 254LA 1NMMA 1JJ3A 4MR1A 250LA 141LA 4NHQA 1XEPA 2CUUA 1GB5A 1L91A 4NGWA 2B6XA 4I7MA 1JEFA 1QDTA 3HT6A 3LZTA 4GN3A 1LZRA 2N5ZA 1LGWA 3RZEA 3DN8A 4W53A 1QTEA 1L71A 4WG7A 1QTBA 1GWDA 1JTTL 2RBPA 2B72A 5JENB 1LOZA 1G0PA 1L94A 1L85A 5LYMA 1C6MA 1WQNA 3C82A 153LA 4TSBA 5FCPA 1IVMA 4NGIA 243LA 1OWZA 1L63A 5HNCA 2W1LA 173LA 4ZFPA 1SSWA 4DDBA 1LSAA 193LA 1JJ1A 1YILA 2WARA 2I6ZA 162LA 3T6UA 4DQJA 1KXYA 1D0KA 1OUCA 1UIAA 3WU8A 3CT5A 3GUPA 2Z39A 1CV3A 4E3UA 1B5XA 3GUJA 2L78A 4WMGA 4OWCA 1D3MA 4WLXA 4YEOA 2BAAA 1QT7A 209LA 1DPXA 4PPOA 1B7SA 4OO9A 4W58A 2DBTA 2HULA 1IWUA 194LA 1QDRA 1LZCA 5FDJA 1LGXA 3FI7A 3DN3A 1LYIA 3AW6A 1HEOA 2HTXA 1IP6A 4HJYA 3EMSA 5F81A 1H6MA 1EQ4A 109LA 1QUOA 1GBZA 1ZYTA 108LA 1WVVA 1QUHA 1LSNA 4H9CA 1UIEA 3TMVA 5A3ZA 1B5ZA 3HDEA 4DAJA 2MEAA 1G0KA 1XEJA 4YF2A 3B72A 2C8PA 4DWXA 4N0JA 2Q9EA 5HMVA 3SB6A 2DQEY 1D9WA 4I7KA 1LYHA 2RAYX 5I54A 1XFPL 4N1EI 4H90A 1L37A 5LA5A 4HPIA 1DYGA 4XJHA 1QS9A 1L44A 4WLDA 1I1ZA 4H9FA 4R6CA 2B75A 5D5CA 2EPEA 2OU0X 125LA 4LDOA 2B74A 1D3NA 1I6SA 5II3A 4EKRA 1F6SA 198LA 3K3TA 1OVJA 1LMPA 225LA 2XQOA 1FDLY 4XJIA 1D6QA 1XJUA 1GFGA 4YENA 1HEPA 1QUGA 1WQOA 3W6DA 4IASA 5APCA 2LC9A 4CFPA 222LA 233LA 1LJJA 227LA 3RZ4A 3V2YA 1GE3A 2DQDY 2B7XA 5LYZA 199LA 1LMTA 4Z3MA 3ZVQB 3WW5A 1GBOA 111LA 3TMUA 3DN6A 4Z46A 2OEAX 5ILCA 1CKFA 4I7JA 4UWVA 172LA 1LI6A 4H8XA 2BQIA 1C10A 1IOTA 3G3WA 119LA 1JITA 6LYTA 4TWSA 1UC0A 3WVXA 5KXOA 1GBXA 2BQHA 1T8FA 1INUA 2MEBA 3BKVA 1HENA 5AMYA 180LA 1ZURA 2BQKA 1KXWA 4NHTA 1L54A 4H9BA 2OTZX 5B06A 175LA 1L39A 1NWGA 3WW6A 3CT0A 1KIPC 1B7RA 1LAAA 2B6WA 5LVKA 4DYGA 167LA 1REMA 3ODUA 1LSDA 3WMKA 1IX0A 1QUTA 241LA 2O79A 1L98A 1CV5A 4RLMA 1XJTA 4I7LA 4HSFA 5L3IA 3TXDA 2BQFA 2IGCA 1IP3A 1LSMA 1JKCA 2ZYCA 1BB5A 3G3BB 1BWJA 2EIZC 4ARQB 1L17A 1JKDA 3PDSA 4X3BA 2ZIKA 1GHLA 3TXGA 1L07A 3C7WA 1L0KA 1LMAA 1D0MA 2B6YA 4OWBA 1QT3A 3CSZA 244LA 1G1VA 1GDWA 1QS5A 3TXFA 3AGIA 4FDYA 4H9AA 1LHIA 1L06A 1BB7A 2OU8A 4QDNA 1L43A 4TTDA 3A95A 197LA 4J0LA 3IWRA 1DYAA 206LA 2B73A 3AZ6A 5I5QA 4A7DA 1C6EA 160LA 1IY4A 3OE9A 3RT5X 1LSCA 2YBMA 3JR6A 2ZWBA 4XYYA 4UWUA 1LJIA 1LKSA 4NSIA 4PK0A 4N8ZA 1L70A 3M18B 4H9EA 1C69A 3TMWA 1L50A 4RDSA 3DN1A 4CGEA 3HUKA 2Q9DA 252LA 2OTYX 1L84A 3WUNA 2F4AA 1H87A 1L64A 1OUAA 4RW1A 1WQQA 1GXXA 1LPIA 2F2QA 1NDGC 2F2NA 1TLAA 1TBYA 4GCBA 1C6LA 1L01A 1L20A 2MECA 4L41A 4HJVA 1JISA 3RW8A 1VFBC 4GN4A 4I8SA 3SB5A 3A91A 1B7NA 1IWXA 2BQBA 2MEEA 4U3XB 3GUKA 258LA 3EXDA 4GLAA 3CQLA 1CKDA 4NHIA 1LI2A 2BPUA 4DQ7A 1GFHA 1GBYA 1L14A 4NGLA 1JTPL 4YXAC 1DI3A 1PZYA 171LA 1IEEA 4NHSA 5IELA 2NWDX 3DMXA 127LA 1C6DA 1L97A 3AJNA 2DQFC 1UUZC 1F6RA 2DKVA 4H93A 1DXJA 1XGQC 4NY5A 1WQPA 1OUHA 4W96A 4H94A 1CJ8A 1GB3A 4ETDA 1XSFA 4LZMA 5B59A 5LVHA 1C6FA 4B0DA 1RI8B 3DN2A 4DT3A 103LA 1T6HA 3T36A 154LA 1JWRA 1UCOA 4I0CA 1ZWNA 126LA 2XJWA 3F6ZA 1GE1A 1DYFA 4PRUA 4Z41A 1NQIA 5LVGA 1QSWA 1I56A 2DQGY 130LA 1VDTA 1GB8A 4IJ4A 1E8LA 4N1CC 4YX7C 256LA 1L73A 2RH1A 182LA 4CFOA 4UWNA 3GULA 163LA 4G4BA 2Z12A 217LA 4KL7A 3RU5A 1L49A 5FSTA 2ZIJA 3GXRA 1LW9A 1C6PA 2RBRA 4TSCA 1L99A 1L27A 5J7CA 4AQNA 2X0AA 1CTWA 3NY9A 3QY4A 2OU9A 1QT8A 1VATA 1GFUA 2OE4X 192LA 1L04A 185LA 4G4CA 1CU2A 1UIGA 4PGJB 1L67A 102LA 3W6EA 4HTKA 4LYMA 1L62A 248LA 4B4EA 3L2XA 1YAQA 3D4SA 1IWYA 3HH4A 1DYDA 1P46A 1L40A 2Z6BA 4XJFA 1K28A 5KXZA 1DI5A 1L56A 4W54A 5B1FA 2ZILA 3P65A 2I26L 5C6JA 1B7PA 1L53A 1QTKA 3SP3A 1UBZA 4H1PA 1BGIA 2G4PA 3OK0A 1YAPA 1GFKA 1L05A 3W6BA 150LA 4HTNA 3WPJA 4M4OA 2Z37A 4WM2A 1LSPA 5FELA 189LA 5KXPA 5KXXA 3CDOA 5HQ1A 4MSTA 1UACY 1QUSA 1GFVA 1L36A 4W94A 1F0WA 1WQMA 1SX7A 1KIRC 1IOSA 1LSEA 3F9LA 2ZQ3A 169LA 1L59A 1GF8A 1OYUA 1L60A 1AT5A 1LHMA 3LZ2A 2CJLA 1L80A 255LA 2DQAA 3WUAA 1G06A 1C6GA 4DJHA 2B6ZA 5D5FA 215LA 3AW7A 4KPMA 3AZ5A 1BB4A 3A34A 1G7JC 3A92A 1LMCA 4PHIA 4OWHA 4WL7A 135LA 232LA 2O7AA 3CDQA 3HUQA 4XENA 2NTHA 3QNGA 3HH3A 2F32A 4B4IA 1L18A 4EKQA 3C8SA 1CVKA 1AKIA 1IO5A 1C62A 1ZMYL 3A6CY 2B5ZA 2XTHA 1C46A 2LYZA 3W6AA 1GB7A 230LA 5T3FA 1REXA 1OUJA 1L25A 184LA 1JPOA 5KJ9A 4ETCA 1DKJA 3GUNA 1HMKA 4NG1A 1UICA 1P37A 1IC5Y 1XGUC 1YL1X 2BLYA 2HUMA 3GXKA 191LA 1TEWA 3HBHA 2HEBA 4ARMA 4TX7A 3WXTA 4OWAA 4W57A 1CV0A 1L10A 164LA 1D9UA 5KXRA 128LA 2OE9X 2YBIA 1IR7A 9LYZA 3OE6A 1L72A 2I25L 3N9AA 1ZVHL 1C6HA 4YEMA 4YXCA 2D4JA 4NFVA 4PJZA 1EPYA 5DN4A 1YAMA 5M1YA 3J6KA 1FLUA 2G4QA 1LTMA 5F16A 1D2WA 1OV7A 4R0FA 4I7QA 2ZQ4A 1IIZA 4EJ4A 139LA 3SB9A 134LA 1LI3A 2FBDA 4H9IA 1FN5A 4DD2A 2FYCA 5L9JA 2PC2A 4LFPA 2F47A 4WM1A 3C80A 1ZVYB 208LA 4BADA 1DPWA 1LYEA 2DQJY 5KXTA 5DN5A 3LZMA 183LA 137LA 1BB6A 1IC4Y 3SN6R 1GEVA 188LA 1UIBA 3DMZA 157LA 176LA 1T97A 1AT6A 4DD7A 1B2KA 3LHMA 4H8ZA 5IHGA 1ZV5L 1HEWA 1PQJA 1HFXA 4ETBA 1L19A 1OWYA 2IFFY 4NGZA 1DI4A 2H9KA 1NDMC 2HUKA 3CB7A 1L75A 4NWHA 1LYFA 120LA 2HEEA 140LA 2XBRA 129LA 1GF7A 4EPIA 3C8RA 1B7QA 1QQYA 1A2YC 1YKXX 3C7ZA 3W6CA 1IWVA 2YSSC 2W1XA 1IORA 1HEQA 114LA 4LGKA 5LA8A 2D6BA 5I53A 5KKIA 1GFTA 104LA 1JHLA 4NGKA 2CDSA 1L08A 2RSCA 1T3PA 3TXEA 1WTHA 4NSGA 1QSAA 1T8GA 113LA 253LA 1J1PY 2ZYPA 1IWWA 1LJHA 1LZGA 1P2RA 1QTDA 220LA 4ZIXA 3SBBC 1YKYX 3V2WA 1T8AA 2YBHA 5F9UA 2Z18A 1L77A 1G07A 1L32A 3AGGG 1GAZA 3DN0A 1NBYC 165LA 1I20A 2HECA 1G7MC 1XEIA 1RCMA 5LYTA 174LA 4LT2A 5F14A 4LT3A 1LYOA 2FYDA 246LA 3LYTA 3NY8A 3K2RA 1LJKA 1QT6A 4HPEA 1GBWA 5B1GA 133LA 3HTGA 4ZEEA 1L51A 195LA 1BHZA 1C68A 1NHEA 4H91A 4C5FA 1JKBA 5LINA 1B7OA 1LLHA 3HTFA 161LA 1VDPA 3IJUA 4LDLA 2FBBA 3HT9A 4LT0A 1L15A 1L30A 3TXKA 1DYEA 1P2LA 5DLAA 2EQLA 224LA 3ULRA 1D3JA 1IWZA 1JUGA 5LVIA 5C6IA 5I4WA 1LJ4A 5LXWA 262LA 3W6FA 143LA 1T6VL 1L48A 3A90A 1O23A 2DQCY 4WLYA 2MEIA 1L24A 156LA 1KNIA 2O4WA 3D9AC 1GD6A 3D3DA 218LA 1P56A 196LA 4ARLA 1OP9B 1L22A 1RFPA 1HSWA 1JJ0A 1QT4A 1QTCA 1HELA 2DQHY 3N9EA 123LA 146LA 3B0OA 5HNLA 1J1OY 1LHHA 1B5VA 4NGOA 6LYZA 2F30A 1KY1A 1GF0A 1L45A 1YROA 2Z38A 2CGIA 1N4FA 2H5ZA 3EO5A 4EKSA 1DYCA 1PQKA 2HEFA 4EMNA 1NKHA 5KY1A 1L57A 1HC0A 5APDA 190LA 4GCFA 1L29A 1C6TA 4XN6A 1SX2A 2ANVA 3GUMA 1DYBA 1L34A 3SBAA 1RJCB 1OUBA 3CDRA 2Z19A 3C7YA
chains in the Genus database with same CATH topology
3TXHA 3B0IA 1C6IA 1L09A 2GV0A 4NHPA 4XADA 4QEQA 1L23A 1JTNA 1KW5A 2YBNA 1LWGA 1LYJA 1OV5A 5KKJA 1B7MA 2A4TA 3AB6A 3ZVQA 2YVBA 5KXWA 2G4NA 2D4KA 4GRVA 2Z2EA 1IC7Y 3HDFA 1OUDA 3DNAA 1JSFA 3FA0A 2D4IA 1PQDA 1OQMA 4EKPA 1WTMA 5HLLA 1CX6A 1QIOA 3PBLA 4YOPA 2LZMA 5DL9A 1OUGA 1DKKA 1QT5A 2H9JA 4DDCA 1L16A 207LA 3A67Y 2RB0X 1AZFA 3G3VA 1LZAA 1CV4A 249LA 1LYDA 1GPQC 1LCNA 1DQJC 4C3WA 3CSRA 2RB1X 1GDXA 2MEDA 4NEBA 4GCCA 2VB1A 1L93A 1OUFA 3RNXA 1L26A 4LYBA 1L35A 3LYZA 1CX7A 1L41A 4G4HA 3AZ7A 4HV1A 1P6YA 4ARQA 2HUBA 2EKSC 3HU8A 3HUAA 5A3EA 4GN5C 4WLTA 1LZ8A 238LA 2BQOA 5E4PA 1CU3A 1GBSA 1GF3A 2CWIA 4WM6A 145LA 1G7IC 7LZMA 1LYZA 3G3XA 3LYMA 2YBJA 1LJEA 4RW2A 247LA 1OVKA 4BS7A 1AM7A 3QAKA 3HTBA 1TAYA 2BQLA 5IDDA 1D0LA 152LA 1OUEA 1L92A 1MLCE 1L66A 1SSYA 2MEGA 2HU1A 4S0WA 260LA 2BQEA 1L12A 4LYCA 1XEKA 5KXMA 1CV1A 4H92A 2LZ2A 1EL1A 242LA 159LA 3C81A 4OWEA 1PQMA 210LA 1P36A 8LYZA 4NIJA 3DMVA 3J4GA 4XJGA 226LA 2RBOA 1L82A 212LA 4WM5A 1CUPA 5L3HA 3WL2A 2BQMA 1B7LA 1G0GA 1L31A 1BWHA 1KY0A 1LSFA 1GF6A 2RAZX 4KXIA 4XJBA 2C8OA 4I7SA 1L68A 3E3DA 1L88A 1L95A 236LA 3SB8A 3TXBA 1QTZA 4W55A 3WYHA 4EPFA 1QTHA 1CU5A 4H8YA 3KAMA 107LA 1B0DA 2BQNA 4W59A 3GUOA 228LA 1LJ3A 2RBNA 1C61A 1B9OA 1HNLA 1LHJA 2D91A 1GAYA 1C64A 245LA 110LA 5LAGA 178LA 6LZMA 2W1YA 3VW7A 1C45A 1QSBA 1L47A 1GE2A 4HJZA 1Z55A 5FEKA 4GCEA 5LIOA 5K7OA 1G7HC 3AYQA 1G7LC 1QUDA 4P2EA 4ML7A 4ETEA 1B5UA 1YANA 1CJ6A 1L55A 1C6BA 3HBEX 4N9RA 1VDSA 1LZDA 155LA 1C60A 1FBIX 3WULA 3HFMY 1LKRA 1L69A 1SLYA 5DM9A 1GF4A 3TXIA 1YIKA 1L21A 205LA 1LZSA 3ATOA 3FADA 1C7PA 1CU6A 4YM8A 5KXNA 237LA 2BQGA 261LA 144LA 1D6PA 158LA 1LJFA 4LYOA 4NGYA 234LA 1JIYA 1L42A 4NGJA 3WUMA 4G49A 4W56A 3AGHA 2LYMA 1CJ7A 4ARPA 219LA 4QGZA 3L64A 1CJ9A 1VDQA 1IP1A 1G0JA 1YAOA 1J1XY 5HMJA 3CT1A 5FHWA 1G1WA 1JQUA 2LZTA 4LYZA 1QTVA 1CKHA 1LYGA 5KXKA 1L96A 3A94A 1XGRC 221LA 1L74A 115LA 5EBHA 5KXSA 1V7TA 1LZ5A 1CKCA 2ZNWY 1C63A 240LA 4WM4A 4LFXA 5APEA 3WXUA 1LGUA 4KT3A 112LA 1LZ6A 3HU9A 122LA 1HHLA 1JTMA 4LZTA 1LHKA 3FI5A 4DD9A 2QB0B 3P64A 1EQEA 166LA 2Z2FA 147LA 2AUBA 1FLQA 1OVHA 4LYTA 186LA 4NWEA 1DZBX 1IP7A 5APFA 3BKHA 1XGTC 4LT1A 1LZEA 1LJGA 3OE8A 3WVYA 223LA 1CKGA 4H9HA 2RB2X 1RE2A 148LE 1PS5A 4PJ2C 1B5WA 3TMXA 4IATA 1C08C 4W52A 1BVKC 1HMLA 142LA 1L28A 3HT7A 4HP0A 3B0KA 1LSGA 4PRQA 2Q0MX 3WPKA 1WTNA 3CSQA 1SWZA 1B5YA 118LA 168LA 1GFEA 4DKLA 3WU9A 1HEMA 1C66A 3CDVA 2OE7X 4I7RA 1FLWA 1WVUA 3EBAB 151LA 1BQLY 1LMOA 1L52A 4GCDA 1L33A 5LVJA 214LA 3NYAA 4WG1A 200LA 2QARC 1LSYA 1OUIA 4I7TA 4TUNA 3A6BY 1C6QA 3ATNA 149LA 1GB6A 4XJDA 1LYSA 4CJ2A 1WQRA 2W1MA 4QY9A 2XBSA 1NF5A 1HERA 2YDGA 1LMNA 4E97A 131LA 3DKEX 3HH6A 4AXTA 2A7FA 5B07A 1L65A 1YKZX 4NSHA 1C6JA 4DD0A 4J7VA 4M6DA 1UIDA 1REZA 4DD3A 1UA6Y 229LA 1L87A 4DD1A 1GB0A 1SQ2L 181LA 1BVXA 4GBRB 3GUIA 3OJPA 5E9RA 1QSQA 1C67A 1L02A 4DC4A 2HEAA 1XGPC 4K5YA 1BB3A 4IAPA 4ZPUA 4RLNA 1LZ1A 2LYOA 3TXJA 4NSJA 1L83A 3DN4A 3OE0A 2Y8PA 3P66A 1KIQC 2YBLA 1YL0X 3LN2A 1TCYA 4B49A 2HEDA 4HV2A 4G9SA 3FE0A 1LSZA 3B6LA 4OW1A 2BLXA 2BQAA 3HTDA 2ZNXY 1IP4A 4Z98A 3WPLA 1YQVY 1EQ5A 1D3FA 1IP5A 1LYYA 1MELL 3RUNA 1IY3A 2NTGA 5KXLA 5C6LA 3M3UA 1G0MA 1LHLA 4ETAA 4II8A 1NBZC 1IOCA 1GFAA 1L46A 1FLYA 3HT8A 1V7SA 1LSBA 5ILFA 1IOQA 1HSXA 1TDYA 2DQIY 4NG8A 1IP2A 4GLVA 1LZBA 1C6CA 2LHMA 235LA 1C6NA 1L38A 3SB7A 2RBSA 1L13A 1LJNA 1GFRA 2LCBA 1CU0A 1CUQA 4HTQA 1JTOL 3EMLA 3ZEKA 4WL6A 1LZNA 1P5CA 1W6ZA 4AGAA 4I7OA 1PQIA 4J1BA 239LA 5I4XA 1LZ4A 3W3EA 1JKAA 1GE4A 1KXXA 4I7PA 1L58A 4FJRA 4NGVA 1L76A 3VWOA 1L61A 1BWIA 4ARMB 4BAPA 170LA 2A7DA 5B05A 3WU7A 4ANRA 1GFJA 5F9XA 4WOAA 4ARJA 1HFYA 1ALCA 1A4VA 1GEZA 4BAFA 1P7SA 4EXMA 1G0LA 2IHLA 4LDEA 216LA 1L79A 1KW7A 1LPYA 4O34A 3UONA 1C43A 3P4ZA 4WM3A 5I14A 177LA 1W08A 211LA 259LA 1IWTA 2F4GA 1LZYA 7LYZA 4B4JA 1C6AA 1GXV2 1F10A 3C83A 3A3RX 1B6IA 2BQJA 2B70A 1L86A 4ET9A 1LZ9A 3N9CA 257LA 4W51A 5LAFA 5KXYA 1VEDA 3WH1A 3QE8A 3G3AB 4OOTA 1HFZA 1L11A 2BQCA 1VAUA 1KS3A 1CV6A 1LMQA 1G0QA 2BQDA 1GB2A 1GB9A 1P64A 4B1AA 3A93A 1LWKA 4OOOA 3HH5A 4CHXA 1UIHA 3F8VA 5LZMA 1C6KA 187LA 231LA 1REYA 3P68A 1C65A 4D9ZA 1P2CC 1FKVA 1L00A 1L90A 3A96A 1UIFA 1GF5A 3HBDA 1FKQA 4EOFA 1D2YA 2MEFA 3LYOA 4N5RA 3AZ4A 132LA 2RBQA 1GF9A 3A3QA 3A8ZA 1L0JA 3CDTA 4J1AA 3MGWA 201LA 1P3NA 1PQOA 251LA 4I7NA 1SWYA 5I4YA 4ET8A 2HU3A 4WO6A 1JSEA 1LZTA 3IJVA 2B6TA 4DDAA 2MEHA 1HF4A 4MCKA 1IR8A 1CNSA 1L03A 1IR9A 4DQ5A 138LA 3HWLA 1L81A 4WO9A 3C8QA 1L89A 1GE0A 2ANXA 213LA 1NHBA 254LA 1NMMA 1JJ3A 4MR1A 250LA 141LA 4NHQA 1XEPA 2CUUA 1GB5A 1L91A 4NGWA 2B6XA 4I7MA 1JEFA 1QDTA 3HT6A 3LZTA 4GN3A 1LZRA 2N5ZA 1LGWA 3RZEA 3DN8A 4W53A 1QTEA 1L71A 4WG7A 1QTBA 1GWDA 1JTTL 2RBPA 2B72A 5JENB 1LOZA 1G0PA 1L94A 1L85A 5LYMA 1C6MA 1WQNA 3C82A 153LA 4TSBA 5FCPA 1IVMA 4NGIA 243LA 1OWZA 1L63A 5HNCA 2W1LA 173LA 4ZFPA 1SSWA 4DDBA 1LSAA 193LA 1JJ1A 1YILA 2WARA 2I6ZA 162LA 3T6UA 4DQJA 1KXYA 1D0KA 1OUCA 1UIAA 3WU8A 3CT5A 3GUPA 2Z39A 1CV3A 4E3UA 1B5XA 3GUJA 2L78A 4WMGA 4OWCA 1D3MA 4WLXA 4YEOA 2BAAA 1QT7A 209LA 1DPXA 4PPOA 1B7SA 4OO9A 4W58A 2DBTA 2HULA 1IWUA 194LA 1QDRA 1LZCA 5FDJA 1LGXA 3FI7A 3DN3A 1LYIA 3AW6A 1HEOA 2HTXA 1IP6A 4HJYA 3EMSA 5F81A 1H6MA 1EQ4A 109LA 1QUOA 1GBZA 1ZYTA 108LA 1WVVA 1QUHA 1LSNA 4H9CA 1UIEA 3TMVA 5A3ZA 1B5ZA 3HDEA 4DAJA 2MEAA 1G0KA 1XEJA 4YF2A 3B72A 2C8PA 4DWXA 4N0JA 2Q9EA 5HMVA 3SB6A 2DQEY 1D9WA 4I7KA 1LYHA 2RAYX 5I54A 1XFPL 4N1EI 4H90A 1L37A 5LA5A 4HPIA 1DYGA 4XJHA 1QS9A 1L44A 4WLDA 1I1ZA 4H9FA 4R6CA 2B75A 5D5CA 2EPEA 2OU0X 125LA 4LDOA 2B74A 1D3NA 1I6SA 5II3A 4EKRA 1F6SA 198LA 3K3TA 1OVJA 1LMPA 225LA 2XQOA 1FDLY 4XJIA 1D6QA 1XJUA 1GFGA 4YENA 1HEPA 1QUGA 1WQOA 3W6DA 4IASA 5APCA 2LC9A 4CFPA 222LA 233LA 1LJJA 227LA 3RZ4A 3V2YA 1GE3A 2DQDY 2B7XA 5LYZA 199LA 1LMTA 4Z3MA 3ZVQB 3WW5A 1GBOA 111LA 3TMUA 3DN6A 4Z46A 2OEAX 5ILCA 1CKFA 4I7JA 4UWVA 172LA 1LI6A 4H8XA 2BQIA 1C10A 1IOTA 3G3WA 119LA 1JITA 6LYTA 4TWSA 1UC0A 3WVXA 5KXOA 1GBXA 2BQHA 1T8FA 1INUA 2MEBA 3BKVA 1HENA 5AMYA 180LA 1ZURA 2BQKA 1KXWA 4NHTA 1L54A 4H9BA 2OTZX 5B06A 175LA 1L39A 1NWGA 3WW6A 3CT0A 1KIPC 1B7RA 1LAAA 2B6WA 5LVKA 4DYGA 167LA 1REMA 3ODUA 1LSDA 3WMKA 1IX0A 1QUTA 241LA 2O79A 1L98A 1CV5A 4RLMA 1XJTA 4I7LA 4HSFA 5L3IA 3TXDA 2BQFA 2IGCA 1IP3A 1LSMA 1JKCA 2ZYCA 1BB5A 3G3BB 1BWJA 2EIZC 4ARQB 1L17A 1JKDA 3PDSA 4X3BA 2ZIKA 1GHLA 3TXGA 1L07A 3C7WA 1L0KA 1LMAA 1D0MA 2B6YA 4OWBA 1QT3A 3CSZA 244LA 1G1VA 1GDWA 1QS5A 3TXFA 3AGIA 4FDYA 4H9AA 1LHIA 1L06A 1BB7A 2OU8A 4QDNA 1L43A 4TTDA 3A95A 197LA 4J0LA 3IWRA 1DYAA 206LA 2B73A 3AZ6A 5I5QA 4A7DA 1C6EA 160LA 1IY4A 3OE9A 3RT5X 1LSCA 2YBMA 3JR6A 2ZWBA 4XYYA 4UWUA 1LJIA 1LKSA 4NSIA 4PK0A 4N8ZA 1L70A 3M18B 4H9EA 1C69A 3TMWA 1L50A 4RDSA 3DN1A 4CGEA 3HUKA 2Q9DA 252LA 2OTYX 1L84A 3WUNA 2F4AA 1H87A 1L64A 1OUAA 4RW1A 1WQQA 1GXXA 1LPIA 2F2QA 1NDGC 2F2NA 1TLAA 1TBYA 4GCBA 1C6LA 1L01A 1L20A 2MECA 4L41A 4HJVA 1JISA 3RW8A 1VFBC 4GN4A 4I8SA 3SB5A 3A91A 1B7NA 1IWXA 2BQBA 2MEEA 4U3XB 3GUKA 258LA 3EXDA 4GLAA 3CQLA 1CKDA 4NHIA 1LI2A 2BPUA 4DQ7A 1GFHA 1GBYA 1L14A 4NGLA 1JTPL 4YXAC 1DI3A 1PZYA 171LA 1IEEA 4NHSA 5IELA 2NWDX 3DMXA 127LA 1C6DA 1L97A 3AJNA 2DQFC 1UUZC 1F6RA 2DKVA 4H93A 1DXJA 1XGQC 4NY5A 1WQPA 1OUHA 4W96A 4H94A 1CJ8A 1GB3A 4ETDA 1XSFA 4LZMA 5B59A 5LVHA 1C6FA 4B0DA 1RI8B 3DN2A 4DT3A 103LA 1T6HA 3T36A 154LA 1JWRA 1UCOA 4I0CA 1ZWNA 126LA 2XJWA 3F6ZA 1GE1A 1DYFA 4PRUA 4Z41A 1NQIA 5LVGA 1QSWA 1I56A 2DQGY 130LA 1VDTA 1GB8A 4IJ4A 1E8LA 4N1CC 4YX7C 256LA 1L73A 2RH1A 182LA 4CFOA 4UWNA 3GULA 163LA 4G4BA 2Z12A 217LA 4KL7A 3RU5A 1L49A 5FSTA 2ZIJA 3GXRA 1LW9A 1C6PA 2RBRA 4TSCA 1L99A 1L27A 5J7CA 4AQNA 2X0AA 1CTWA 3NY9A 3QY4A 2OU9A 1QT8A 1VATA 1GFUA 2OE4X 192LA 1L04A 185LA 4G4CA 1CU2A 1UIGA 4PGJB 1L67A 102LA 3W6EA 4HTKA 4LYMA 1L62A 248LA 4B4EA 3L2XA 1YAQA 3D4SA 1IWYA 3HH4A 1DYDA 1P46A 1L40A 2Z6BA 4XJFA 1K28A 5KXZA 1DI5A 1L56A 4W54A 5B1FA 2ZILA 3P65A 2I26L 5C6JA 1B7PA 1L53A 1QTKA 3SP3A 1UBZA 4H1PA 1BGIA 2G4PA 3OK0A 1YAPA 1GFKA 1L05A 3W6BA 150LA 4HTNA 3WPJA 4M4OA 2Z37A 4WM2A 1LSPA 5FELA 189LA 5KXPA 5KXXA 3CDOA 5HQ1A 4MSTA 1UACY 1QUSA 1GFVA 1L36A 4W94A 1F0WA 1WQMA 1SX7A 1KIRC 1IOSA 1LSEA 3F9LA 2ZQ3A 169LA 1L59A 1GF8A 1OYUA 1L60A 1AT5A 1LHMA 3LZ2A 2CJLA 1L80A 255LA 2DQAA 3WUAA 1G06A 1C6GA 4DJHA 2B6ZA 5D5FA 215LA 3AW7A 4KPMA 3AZ5A 1BB4A 3A34A 1G7JC 3A92A 1LMCA 4PHIA 4OWHA 4WL7A 135LA 232LA 2O7AA 3CDQA 3HUQA 4XENA 2NTHA 3QNGA 3HH3A 2F32A 4B4IA 1L18A 4EKQA 3C8SA 1CVKA 1AKIA 1IO5A 1C62A 1ZMYL 3A6CY 2B5ZA 2XTHA 1C46A 2LYZA 3W6AA 1GB7A 230LA 5T3FA 1REXA 1OUJA 1L25A 184LA 1JPOA 5KJ9A 4ETCA 1DKJA 3GUNA 1HMKA 4NG1A 1UICA 1P37A 1IC5Y 1XGUC 1YL1X 2BLYA 2HUMA 3GXKA 191LA 1TEWA 3HBHA 2HEBA 4ARMA 4TX7A 3WXTA 4OWAA 4W57A 1CV0A 1L10A 164LA 1D9UA 5KXRA 128LA 2OE9X 2YBIA 1IR7A 9LYZA 3OE6A 1L72A 2I25L 3N9AA 1ZVHL 1C6HA 4YEMA 4YXCA 2D4JA 4NFVA 4PJZA 1EPYA 5DN4A 1YAMA 5M1YA 3J6KA 1FLUA 2G4QA 1LTMA 5F16A 1D2WA 1OV7A 4R0FA 4I7QA 2ZQ4A 1IIZA 4EJ4A 139LA 3SB9A 134LA 1LI3A 2FBDA 4H9IA 1FN5A 4DD2A 2FYCA 5L9JA 2PC2A 4LFPA 2F47A 4WM1A 3C80A 1ZVYB 208LA 4BADA 1DPWA 1LYEA 2DQJY 5KXTA 5DN5A 3LZMA 183LA 137LA 1BB6A 1IC4Y 3SN6R 1GEVA 188LA 1UIBA 3DMZA 157LA 176LA 1T97A 1AT6A 4DD7A 1B2KA 3LHMA 4H8ZA 5IHGA 1ZV5L 1HEWA 1PQJA 1HFXA 4ETBA 1L19A 1OWYA 2IFFY 4NGZA 1DI4A 2H9KA 1NDMC 2HUKA 3CB7A 1L75A 4NWHA 1LYFA 120LA 2HEEA 140LA 2XBRA 129LA 1GF7A 4EPIA 3C8RA 1B7QA 1QQYA 1A2YC 1YKXX 3C7ZA 3W6CA 1IWVA 2YSSC 2W1XA 1IORA 1HEQA 114LA 4LGKA 5LA8A 2D6BA 5I53A 5KKIA 1GFTA 104LA 1JHLA 4NGKA 2CDSA 1L08A 2RSCA 1T3PA 3TXEA 1WTHA 4NSGA 1QSAA 1T8GA 113LA 253LA 1J1PY 2ZYPA 1IWWA 1LJHA 1LZGA 1P2RA 1QTDA 220LA 4ZIXA 3SBBC 1YKYX 3V2WA 1T8AA 2YBHA 5F9UA 2Z18A 1L77A 1G07A 1L32A 3AGGG 1GAZA 3DN0A 1NBYC 165LA 1I20A 2HECA 1G7MC 1XEIA 1RCMA 5LYTA 174LA 4LT2A 5F14A 4LT3A 1LYOA 2FYDA 246LA 3LYTA 3NY8A 3K2RA 1LJKA 1QT6A 4HPEA 1GBWA 5B1GA 133LA 3HTGA 4ZEEA 1L51A 195LA 1BHZA 1C68A 1NHEA 4H91A 4C5FA 1JKBA 5LINA 1B7OA 1LLHA 3HTFA 161LA 1VDPA 3IJUA 4LDLA 2FBBA 3HT9A 4LT0A 1L15A 1L30A 3TXKA 1DYEA 1P2LA 5DLAA 2EQLA 224LA 3ULRA 1D3JA 1IWZA 1JUGA 5LVIA 5C6IA 5I4WA 1LJ4A 5LXWA 262LA 3W6FA 143LA 1T6VL 1L48A 3A90A 1O23A 2DQCY 4WLYA 2MEIA 1L24A 156LA 1KNIA 2O4WA 3D9AC 1GD6A 3D3DA 218LA 1P56A 196LA 4ARLA 1OP9B 1L22A 1RFPA 1HSWA 1JJ0A 1QT4A 1QTCA 1HELA 2DQHY 3N9EA 123LA 146LA 3B0OA 5HNLA 1J1OY 1LHHA 1B5VA 4NGOA 6LYZA 2F30A 1KY1A 1GF0A 1L45A 1YROA 2Z38A 2CGIA 1N4FA 2H5ZA 3EO5A 4EKSA 1DYCA 1PQKA 2HEFA 4EMNA 1NKHA 5KY1A 1L57A 1HC0A 5APDA 190LA 4GCFA 1L29A 1C6TA 4XN6A 1SX2A 2ANVA 3GUMA 1DYBA 1L34A 3SBAA 1RJCB 1OUBA 3CDRA 2Z19A 3C7YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H1P A;  1XEJ A;  4CJ2 A;  1BGI A;  3B72 A;  3TXH A;  1WQR A;  2W1M A;  4YF2 A;  2G4P A;  3B0I A;  2XBS A;  3OK0 A;  4QY9 A;  1NF5 A;  2C8P A;  1HER A;  1GFK A;  1YAP A;  2YDG A;  3W6B A;  4DWX A;  4HTN A;  3WPJ A;  1LMN A;  4M4O A;  2Z37 A;  4WM2 A;  1LSP A;  5FEL A;  2GV0 A;  5KXP A;  5KXX A;  4N0J A;  4NHP A;  4XAD A;  5HQ1 A;  4MST A;  4QEQ A;  5HMV A;  2YBN A;  4AXT A;  2DQE Y;  2A7F A;  5KKJ A;  1UAC Y;  5B07 A;  5I54 A;  1XFP L;  4N1E I;  1QUS A;  4H90 A;  1GFV A;  1YKZ X;  5LA5 A;  1B7M A;  4W94 A;  4NSH A;  1F0W A;  1WQM A;  3AB6 A;  4DD0 A;  4HPI A;  3ZVQ A;  1KIR C;  2YVB A;  1IOS A;  4J7V A;  4XJH A;  5KXW A;  1LSE A;  4M6D A;  2G4N A;  2ZQ3 A;  1UID A;  2D4K A;  1REZ A;  4DD3 A;  4WLD A;  1I1Z A;  4H9F A;  2Z2E A;  4R6C A;  5D5C A;  1IC7 Y;  1GF8 A;  1UA6 Y;  2EPE A;  4DD1 A;  1GB0 A;  4NG1 A;  1OUD A;  1SQ2 L;  1BVX A;  1JSF A;  1AT5 A;  1LHM A;  3LZ2 A;  2CJL A;  2D4I A;  3OJP A;  5E9R A;  1OQM A;  1WTM A;  5II3 A;  5HLL A;  1F6S A;  1QIO A;  4DC4 A;  2HEA A;  1XGP C;  2DQA A;  4YOP A;  3K3T A;  3WUA A;  1BB3 A;  5DL9 A;  1LMP A;  1OUG A;  1FDL Y;  4XJI A;  5D5F A;  4RLN A;  3AW7 A;  4KPM A;  1D6Q A;  1LZ1 A;  2LYO A;  3TXJ A;  1GFG A;  4NSJ A;  4YEN A;  3AZ5 A;  1BB4 A;  1DKK A;  3A34 A;  1HEP A;  1WQO A;  2H9J A;  4DDC A;  1G7J C;  3A92 A;  207L A;  3A67 Y;  3W6D A;  4IAS A;  1LMC A;  1AZF A;  5APC A;  2Y8P A;  4PHI A;  3P66 A;  4OWH A;  1LZA A;  4WL7 A;  1KIQ C;  4CFP A;  135L A;  2YBL A;  1YL0 X;  1GPQ C;  1LJJ A;  4XEN A;  3LN2 A;  3RZ4 A;  1TCY A;  1LCN A;  1DQJ C;  4C3W A;  3CSR A;  3QNG A;  1GDX A;  1GE3 A;  2DQD Y;  4B4I A;  4B49 A;  2MED A;  5LYZ A;  4NEB A;  1LMT A;  4GCC A;  4Z3M A;  3ZVQ B;  3WW5 A;  1GBO A;  3TMU A;  2VB1 A;  4Z46 A;  5ILC A;  2HED A;  1AKI A;  1IO5 A;  1ZMY L;  1OUF A;  3RNX A;  4HV2 A;  4LYB A;  1CKF A;  4G9S A;  3FE0 A;  3A6C Y;  2B5Z A;  4UWV A;  2XTH A;  3LYZ A;  1C46 A;  2LYZ A;  4H8X A;  1LSZ A;  2BQI A;  4G4H A;  3AZ7 A;  4HV1 A;  3B6L A;  4OW1 A;  2BLX A;  2BQA A;  3W6A A;  1GB7 A;  5T3F A;  1C10 A;  2HUB A;  2EKS C;  2ZNX Y;  5A3E A;  1IOT A;  1REX A;  1OUJ A;  1IP4 A;  4GN5 C;  4Z98 A;  1YQV Y;  3WPL A;  1EQ5 A;  4WLT A;  1LZ8 A;  1IP5 A;  1JPO A;  1LYY A;  2BQO A;  1DKJ A;  4ETC A;  1MEL L;  5KJ9 A;  1HMK A;  5E4P A;  1GF3 A;  1GBS A;  1JIT A;  1IC5 Y;  1UIC A;  1XGU C;  1UC0 A;  1YL1 X;  2BLY A;  2CWI A;  4TWS A;  4WM6 A;  3WVX A;  5KXO A;  3GXK A;  1G7I C;  1GBX A;  1IY3 A;  2BQH A;  1INU A;  2MEB A;  1TEW A;  3BKV A;  3HBH A;  3M3U A;  5C6L A;  5KXL A;  2HEB A;  1HEN A;  5AMY A;  4TX7 A;  1LHL A;  3WXT A;  4OWA A;  1LYZ A;  2BQK A;  3LYM A;  1KXW A;  4NHT A;  4ETA A;  2YBJ A;  4II8 A;  1NBZ C;  4H9B A;  1D9U A;  1LJE A;  4RW2 A;  1IOC A;  5B06 A;  1GFA A;  5KXR A;  1NWG A;  3WW6 A;  1FLY A;  2YBI A;  3CT0 A;  1IR7 A;  4BS7 A;  9LYZ A;  1AM7 A;  1KIP C;  1V7S A;  1TAY A;  1LSB A;  2BQL A;  1B7R A;  1LAA A;  5ILF A;  1IOQ A;  1HSX A;  1TDY A;  5IDD A;  5LVK A;  1D0L A;  4DYG A;  1REM A;  2DQI Y;  2I25 L;  3N9A A;  1ZVH L;  1OUE A;  4NG8 A;  4YEM A;  1MLC E;  2D4J A;  1IP2 A;  1LSD A;  4NFV A;  3WMK A;  1IX0 A;  4GLV A;  1LZB A;  1QUT A;  5DN4 A;  2LHM A;  2MEG A;  2HU1 A;  1YAM A;  2BQE A;  5M1Y A;  4RLM A;  4LYC A;  3J6K A;  1FLU A;  1XEK A;  1LJN A;  1LTM A;  2G4Q A;  5KXM A;  4H92 A;  4HSF A;  5F16 A;  1GFR A;  2LZ2 A;  5L3I A;  3TXD A;  4HTQ A;  2BQF A;  1EL1 A;  1IP3 A;  1JTO L;  1LSM A;  4R0F A;  4OWE A;  1JKC A;  2ZQ4 A;  3ZEK A;  4WL6 A;  2ZYC A;  1BB5 A;  3G3B B;  1BWJ A;  1LZN A;  1IIZ A;  4AGA A;  1W6Z A;  2EIZ C;  8LYZ A;  4NIJ A;  4X3B A;  1JKD A;  4J1B A;  134L A;  2FBD A;  2ZIK A;  5I4X A;  3J4G A;  4XJG A;  1LZ4 A;  3W3E A;  4WM5 A;  1JKA A;  1GHL A;  4H9I A;  1FN5 A;  1GE4 A;  1KXX A;  3TXG A;  5L3H A;  4DD2 A;  3WL2 A;  1LMA A;  2BQM A;  2FYC A;  4FJR A;  1D0M A;  4NGV A;  3VWO A;  1B7L A;  1BWH A;  5L9J A;  2PC2 A;  4LFP A;  1BWI A;  4OWB A;  1LSF A;  4WM1 A;  1GF6 A;  4BAP A;  4KXI A;  1ZVY B;  2A7D A;  5B05 A;  208L A;  3CSZ A;  3WU7 A;  4BAD A;  4XJB A;  1DPW A;  2C8O A;  2DQJ Y;  4ANR A;  1GFJ A;  5KXT A;  5DN5 A;  5F9X A;  1GDW A;  3TXF A;  3AGI A;  4FDY A;  3E3D A;  4WOA A;  1HFY A;  4H9A A;  1LHI A;  1ALC A;  1BB6 A;  1IC4 Y;  1A4V A;  1GEZ A;  4BAF A;  3TXB A;  1GEV A;  2IHL A;  1BB7 A;  1UIB A;  3WYH A;  4QDN A;  4O34 A;  4TTD A;  3A95 A;  1C43 A;  3P4Z A;  4WM3 A;  4H8Y A;  3KAM A;  1B0D A;  1W08 A;  2BQN A;  1AT6 A;  3IWR A;  4J0L A;  4DD7 A;  1LJ3 A;  1IWT A;  2F4G A;  1B2K A;  1LZY A;  3LHM A;  4H8Z A;  7LYZ A;  1B9O A;  1HNL A;  1LHJ A;  4B4J A;  5IHG A;  2D91 A;  3AZ6 A;  1GXV 2;  1F10 A;  5I5Q A;  1ZV5 L;  1GAY A;  1HEW A;  3A3R X;  4A7D A;  1HFX A;  4ETB A;  5LAG A;  1IY4 A;  3RT5 X;  1LSC A;  2YBM A;  2BQJ A;  2ZWB A;  2IFF Y;  4XYY A;  4UWU A;  4NGZ A;  1LJI A;  1DI4 A;  1LKS A;  4ET9 A;  1LZ9 A;  2H9K A;  3N9C A;  4NSI A;  1NDM C;  4N8Z A;  3CB7 A;  2W1Y A;  5LAF A;  3M18 B;  5KXY A;  1VED A;  1C45 A;  3WH1 A;  3QE8 A;  3G3A B;  4H9E A;  4OOT A;  1HFZ A;  1GE2 A;  4XJD A;  4NWH A;  2BQC A;  4HJZ A;  3TMW A;  1VAU A;  1LMQ A;  1Z55 A;  2HEE A;  2BQD A;  5FEK A;  2XBR A;  1GB2 A;  1GB9 A;  4RDS A;  1GF7 A;  4GCE A;  5LIO A;  5K7O A;  4CGE A;  4B1A A;  1G7H C;  3A93 A;  3AYQ A;  4OOO A;  4CHX A;  1UIH A;  1B7Q A;  1QQY A;  3WUN A;  1A2Y C;  1YKX X;  1G7L C;  6LYT A;  3W6C A;  1IWV A;  2YSS C;  4P2E A;  4ML7 A;  1REY A;  4ETE A;  1B5U A;  3P68 A;  2F4A A;  4D9Z A;  1P2C C;  1FKV A;  1H87 A;  1IOR A;  2W1X A;  1YAN A;  1HEQ A;  1CJ6 A;  1OUA A;  4RW1 A;  1WQQ A;  1GXX A;  1LPI A;  3A96 A;  1UIF A;  3HBE X;  1GF5 A;  1NDG C;  3HBD A;  1FKQ A;  4N9R A;  4LGK A;  5LA8 A;  4EOF A;  2MEF A;  1VDS A;  2F2N A;  1LZD A;  3AZ4 A;  2D6B A;  3LYO A;  4N5R A;  5I53 A;  5KKI A;  132L A;  1FBI X;  1JHL A;  1GFT A;  1TBY A;  1GF9 A;  3A3Q A;  3HFM Y;  4GCB A;  4NGK A;  3A8Z A;  3WUL A;  1LKR A;  2CDS A;  4J1A A;  1SLY A;  2RSC A;  2MEC A;  3MGW A;  1T3P A;  4L41 A;  3TXE A;  5DM9 A;  1GF4 A;  4HJV A;  5APF A;  3TXI A;  1YIK A;  1JIS A;  3RW8 A;  4NSG A;  1VFB C;  1QSA A;  4GN4 A;  4I8S A;  5I4Y A;  1LZS A;  4ET8 A;  1J1P Y;  2HU3 A;  3ATO A;  3A91 A;  1C7P A;  1LZG A;  1IWW A;  1LJH A;  1B7N A;  1JSE A;  2ZYP A;  1LZT A;  4WO6 A;  5KXN A;  4YM8 A;  2BQG A;  4ZIX A;  1IWX A;  3IJV A;  2BQB A;  1YKY X;  4DDA A;  2MEE A;  2MEH A;  1HF4 A;  4MCK A;  4U3X B;  1IR8 A;  1D6P A;  2YBH A;  5F9U A;  1CNS A;  2Z18 A;  1LJF A;  3EXD A;  4LYO A;  4NGY A;  1IR9 A;  3AGG G;  1GAZ A;  1JIY A;  3CQL A;  4GLA A;  4WO9 A;  1CKD A;  1GE0 A;  4NHI A;  3WUM A;  4NGJ A;  4G49 A;  2BPU A;  1NMM A;  1NBY C;  3AGH A;  1GFH A;  1GBY A;  2LYM A;  4NGL A;  1JJ3 A;  1JTP L;  1CJ7 A;  1I20 A;  2HEC A;  4MR1 A;  1DI3 A;  1G7M C;  1PZY A;  1IEE A;  1RCM A;  1XEI A;  4NHS A;  4QGZ A;  5IEL A;  1CJ9 A;  1VDQ A;  2NWD X;  5LYT A;  1IP1 A;  4NHQ A;  1YAO A;  1J1X Y;  3AJN A;  5HMJ A;  1GB5 A;  3CT1 A;  2DQF C;  4NGW A;  5FHW A;  2LZT A;  4LT2 A;  1UUZ C;  5F14 A;  4LT3 A;  1F6R A;  1LYO A;  1JEF A;  2FYD A;  1QDT A;  2DKV A;  3LYT A;  3LZT A;  4GN3 A;  4H93 A;  1DXJ A;  1LJK A;  1LZR A;  1XGQ C;  2N5Z A;  4NY5 A;  4LYZ A;  1WQP A;  1OUH A;  4W96 A;  1CKH A;  1CJ8 A;  4H94 A;  1GB3 A;  4ETD A;  4HPE A;  1GBW A;  1XSF A;  5KXK A;  5B59 A;  3A94 A;  1XGR C;  5B1G A;  5LVH A;  133L A;  4ZEE A;  4B0D A;  1RI8 B;  1BHZ A;  1QTE A;  5EBH A;  5KXS A;  1NHE A;  1V7T A;  4H91 A;  4C5F A;  4WG7 A;  1LZ5 A;  1CKC A;  1GWD A;  4DT3 A;  2ZNW Y;  1JKB A;  1JTT L;  5LIN A;  3T36 A;  4WM4 A;  1B7O A;  5JEN B;  4LFX A;  5APE A;  1JWR A;  1LOZ A;  1UCO A;  4I0C A;  3WXU A;  4KT3 A;  154L A;  1VDP A;  3IJU A;  1LZ6 A;  5LYM A;  2FBB A;  1HHL A;  2XJW A;  3F6Z A;  4LT0 A;  4LZT A;  1GE1 A;  3TXK A;  4PRU A;  1LHK A;  1WQN A;  4Z41 A;  153L A;  5DLA A;  4DD9 A;  3P64 A;  4TSB A;  5FCP A;  1EQE A;  2EQL A;  2Z2F A;  1IVM A;  3ULR A;  4NGI A;  1NQI A;  5LVG A;  1IWZ A;  1JUG A;  1I56 A;  1QSW A;  2AUB A;  5LVI A;  5C6I A;  1FLQ A;  2DQG Y;  2W1L A;  5HNC A;  4ZFP A;  4LYT A;  5I4W A;  1VDT A;  1LJ4 A;  1GB8 A;  5LXW A;  4IJ4 A;  1E8L A;  3W6F A;  1T6V L;  4N1C C;  4DDB A;  1LSA A;  193L A;  4NWE A;  1JJ1 A;  3A90 A;  1YIL A;  2WAR A;  2I6Z A;  3T6U A;  1KXY A;  1DZB X;  4CFO A;  1IP7 A;  1D0K A;  1O23 A;  1OUC A;  3BKH A;  1XGT C;  2DQC Y;  4UWN A;  4LT1 A;  1LZE A;  1UIA A;  1LJG A;  4WLY A;  2MEI A;  3WVY A;  1CKG A;  3CT5 A;  4H9H A;  3WU8 A;  2Z39 A;  4G4B A;  3D9A C;  1B5X A;  4E3U A;  1RE2 A;  1GD6 A;  3D3D A;  2Z12 A;  1PS5 A;  4KL7 A;  3RU5 A;  4WMG A;  4PJ2 C;  4OWC A;  4WLX A;  1B5W A;  4YEO A;  5FST A;  4IAT A;  1C08 C;  2BAA A;  3TMX A;  1OP9 B;  1BVK C;  2ZIJ A;  3GXR A;  1HML A;  1RFP A;  4TSC A;  1HSW A;  1DPX A;  4PPO A;  1JJ0 A;  1B7S A;  2DBT A;  5J7C A;  1IWU A;  1HEL A;  194L A;  2X0A A;  1QDR A;  4HP0 A;  2DQH Y;  3N9E A;  3QY4 A;  3B0K A;  1LSG A;  3B0O A;  4PRQ A;  5HNL A;  1LZC A;  1J1O Y;  1LHH A;  1WTN A;  1B5V A;  2Q0M X;  3CSQ A;  2F30 A;  3FI7 A;  4NGO A;  5FDJ A;  3WPK A;  1GF0 A;  6LYZ A;  1B5Y A;  3AW6 A;  1VAT A;  1YRO A;  1HEO A;  1GFU A;  2HTX A;  1IP6 A;  2Z38 A;  2CGI A;  4G4C A;  4HJY A;  3EMS A;  5F81 A;  1N4F A;  4PGJ B;  1UIG A;  1GFE A;  2H5Z A;  3EO5 A;  1H6M A;  3WU9 A;  1HEM A;  1EQ4 A;  2HEF A;  3W6E A;  4EMN A;  4HTK A;  4LYM A;  1NKH A;  1FLW A;  1WVU A;  4B4E A;  5KY1 A;  3EBA B;  1BQL Y;  1GBZ A;  1YAQ A;  1HC0 A;  5APD A;  1LMO A;  4GCD A;  1IWY A;  1WVV A;  4GCF A;  5LVJ A;  4XN6 A;  4WG1 A;  1LSN A;  4H9C A;  4XJF A;  5KXZ A;  1DI5 A;  1UIE A;  3TMV A;  5A3Z A;  1RJC B;  1OUB A;  1LSY A;  1B5Z A;  1OUI A;  2Z19 A;  5B1F A;  2ZIL A;  3P65 A;  4TUN A;  3A6B Y;  2I26 L;  5C6J A;  1B7P A;  2MEA A;  1QTK A;  3SP3 A;  3ATN A;  1UBZ A;  1GB6 A;  1LYS A; 
#chains in the Genus database with same CATH topology
 3TXH A;  3B0I A;  1C6I A;  1L09 A;  2GV0 A;  4NHP A;  4XAD A;  4QEQ A;  1L23 A;  1JTN A;  1KW5 A;  2YBN A;  1LWG A;  1LYJ A;  1OV5 A;  5KKJ A;  1B7M A;  2A4T A;  3AB6 A;  3ZVQ A;  2YVB A;  5KXW A;  2G4N A;  2D4K A;  4GRV A;  2Z2E A;  1IC7 Y;  3HDF A;  1OUD A;  3DNA A;  1JSF A;  3FA0 A;  2D4I A;  1PQD A;  1OQM A;  4EKP A;  1WTM A;  5HLL A;  1CX6 A;  1QIO A;  3PBL A;  4YOP A;  2LZM A;  5DL9 A;  1OUG A;  1DKK A;  1QT5 A;  2H9J A;  4DDC A;  1L16 A;  207L A;  3A67 Y;  2RB0 X;  1AZF A;  3G3V A;  1LZA A;  1CV4 A;  249L A;  1LYD A;  1GPQ C;  1LCN A;  1DQJ C;  4C3W A;  3CSR A;  2RB1 X;  1GDX A;  2MED A;  4NEB A;  4GCC A;  2VB1 A;  1L93 A;  1OUF A;  3RNX A;  1L26 A;  4LYB A;  1L35 A;  3LYZ A;  1CX7 A;  1L41 A;  4G4H A;  3AZ7 A;  4HV1 A;  1P6Y A;  4ARQ A;  2HUB A;  2EKS C;  3HU8 A;  3HUA A;  5A3E A;  4GN5 C;  4WLT A;  1LZ8 A;  238L A;  2BQO A;  5E4P A;  1CU3 A;  1GBS A;  1GF3 A;  2CWI A;  4WM6 A;  145L A;  1G7I C;  7LZM A;  1LYZ A;  3G3X A;  3LYM A;  2YBJ A;  1LJE A;  4RW2 A;  247L A;  1OVK A;  4BS7 A;  1AM7 A;  3QAK A;  3HTB A;  1TAY A;  2BQL A;  5IDD A;  1D0L A;  152L A;  1OUE A;  1L92 A;  1MLC E;  1L66 A;  1SSY A;  2MEG A;  2HU1 A;  4S0W A;  260L A;  2BQE A;  1L12 A;  4LYC A;  1XEK A;  5KXM A;  1CV1 A;  4H92 A;  2LZ2 A;  1EL1 A;  242L A;  159L A;  3C81 A;  4OWE A;  1PQM A;  210L A;  1P36 A;  8LYZ A;  4NIJ A;  3DMV A;  3J4G A;  4XJG A;  226L A;  2RBO A;  1L82 A;  212L A;  4WM5 A;  1CUP A;  5L3H A;  3WL2 A;  2BQM A;  1B7L A;  1G0G A;  1L31 A;  1BWH A;  1KY0 A;  1LSF A;  1GF6 A;  2RAZ X;  4KXI A;  4XJB A;  2C8O A;  4I7S A;  1L68 A;  3E3D A;  1L88 A;  1L95 A;  236L A;  3SB8 A;  3TXB A;  1QTZ A;  4W55 A;  3WYH A;  4EPF A;  1QTH A;  1CU5 A;  4H8Y A;  3KAM A;  107L A;  1B0D A;  2BQN A;  4W59 A;  3GUO A;  228L A;  1LJ3 A;  2RBN A;  1C61 A;  1B9O A;  1HNL A;  1LHJ A;  2D91 A;  1GAY A;  1C64 A;  245L A;  110L A;  5LAG A;  178L A;  6LZM A;  2W1Y A;  3VW7 A;  1C45 A;  1QSB A;  1L47 A;  1GE2 A;  4HJZ A;  1Z55 A;  5FEK A;  4GCE A;  5LIO A;  5K7O A;  1G7H C;  3AYQ A;  1G7L C;  1QUD A;  4P2E A;  4ML7 A;  4ETE A;  1B5U A;  1YAN A;  1CJ6 A;  1L55 A;  1C6B A;  3HBE X;  4N9R A;  1VDS A;  1LZD A;  155L A;  1C60 A;  1FBI X;  3WUL A;  3HFM Y;  1LKR A;  1L69 A;  1SLY A;  5DM9 A;  1GF4 A;  3TXI A;  1YIK A;  1L21 A;  205L A;  1LZS A;  3ATO A;  3FAD A;  1C7P A;  1CU6 A;  4YM8 A;  5KXN A;  237L A;  2BQG A;  261L A;  144L A;  1D6P A;  158L A;  1LJF A;  4LYO A;  4NGY A;  234L A;  1JIY A;  1L42 A;  4NGJ A;  3WUM A;  4G49 A;  4W56 A;  3AGH A;  2LYM A;  1CJ7 A;  4ARP A;  219L A;  4QGZ A;  3L64 A;  1CJ9 A;  1VDQ A;  1IP1 A;  1G0J A;  1YAO A;  1J1X Y;  5HMJ A;  3CT1 A;  5FHW A;  1G1W A;  1JQU A;  2LZT A;  4LYZ A;  1QTV A;  1CKH A;  1LYG A;  5KXK A;  1L96 A;  3A94 A;  1XGR C;  221L A;  1L74 A;  115L A;  5EBH A;  5KXS A;  1V7T A;  1LZ5 A;  1CKC A;  2ZNW Y;  1C63 A;  240L A;  4WM4 A;  4LFX A;  5APE A;  3WXU A;  1LGU A;  4KT3 A;  112L A;  1LZ6 A;  3HU9 A;  122L A;  1HHL A;  1JTM A;  4LZT A;  1LHK A;  3FI5 A;  4DD9 A;  2QB0 B;  3P64 A;  1EQE A;  166L A;  2Z2F A;  147L A;  2AUB A;  1FLQ A;  1OVH A;  4LYT A;  186L A;  4NWE A;  1DZB X;  1IP7 A;  5APF A;  3BKH A;  1XGT C;  4LT1 A;  1LZE A;  1LJG A;  3OE8 A;  3WVY A;  223L A;  1CKG A;  4H9H A;  2RB2 X;  1RE2 A;  148L E;  1PS5 A;  4PJ2 C;  1B5W A;  3TMX A;  4IAT A;  1C08 C;  4W52 A;  1BVK C;  1HML A;  142L A;  1L28 A;  3HT7 A;  4HP0 A;  3B0K A;  1LSG A;  4PRQ A;  2Q0M X;  3WPK A;  1WTN A;  3CSQ A;  1SWZ A;  1B5Y A;  118L A;  168L A;  1GFE A;  4DKL A;  3WU9 A;  1HEM A;  1C66 A;  3CDV A;  2OE7 X;  4I7R A;  1FLW A;  1WVU A;  3EBA B;  151L A;  1BQL Y;  1LMO A;  1L52 A;  4GCD A;  1L33 A;  5LVJ A;  214L A;  3NYA A;  4WG1 A;  200L A;  2QAR C;  1LSY A;  1OUI A;  4I7T A;  4TUN A;  3A6B Y;  1C6Q A;  3ATN A;  149L A;  1GB6 A;  4XJD A;  1LYS A;  4CJ2 A;  1WQR A;  2W1M A;  4QY9 A;  2XBS A;  1NF5 A;  1HER A;  2YDG A;  1LMN A;  4E97 A;  131L A;  3DKE X;  3HH6 A;  4AXT A;  2A7F A;  5B07 A;  1L65 A;  1YKZ X;  4NSH A;  1C6J A;  4DD0 A;  4J7V A;  4M6D A;  1UID A;  1REZ A;  4DD3 A;  1UA6 Y;  229L A;  1L87 A;  4DD1 A;  1GB0 A;  1SQ2 L;  181L A;  1BVX A;  4GBR B;  3GUI A;  3OJP A;  5E9R A;  1QSQ A;  1C67 A;  1L02 A;  4DC4 A;  2HEA A;  1XGP C;  4K5Y A;  1BB3 A;  4IAP A;  4ZPU A;  4RLN A;  1LZ1 A;  2LYO A;  3TXJ A;  4NSJ A;  1L83 A;  3DN4 A;  3OE0 A;  2Y8P A;  3P66 A;  1KIQ C;  2YBL A;  1YL0 X;  3LN2 A;  1TCY A;  4B49 A;  2HED A;  4HV2 A;  4G9S A;  3FE0 A;  1LSZ A;  3B6L A;  4OW1 A;  2BLX A;  2BQA A;  3HTD A;  2ZNX Y;  1IP4 A;  4Z98 A;  3WPL A;  1YQV Y;  1EQ5 A;  1D3F A;  1IP5 A;  1LYY A;  1MEL L;  3RUN A;  1IY3 A;  2NTG A;  5KXL A;  5C6L A;  3M3U A;  1G0M A;  1LHL A;  4ETA A;  4II8 A;  1NBZ C;  1IOC A;  1GFA A;  1L46 A;  1FLY A;  3HT8 A;  1V7S A;  1LSB A;  5ILF A;  1IOQ A;  1HSX A;  1TDY A;  2DQI Y;  4NG8 A;  1IP2 A;  4GLV A;  1LZB A;  1C6C A;  2LHM A;  235L A;  1C6N A;  1L38 A;  3SB7 A;  2RBS A;  1L13 A;  1LJN A;  1GFR A;  2LCB A;  1CU0 A;  1CUQ A;  4HTQ A;  1JTO L;  3EML A;  3ZEK A;  4WL6 A;  1LZN A;  1P5C A;  1W6Z A;  4AGA A;  4I7O A;  1PQI A;  4J1B A;  239L A;  5I4X A;  1LZ4 A;  3W3E A;  1JKA A;  1GE4 A;  1KXX A;  4I7P A;  1L58 A;  4FJR A;  4NGV A;  1L76 A;  3VWO A;  1L61 A;  1BWI A;  4ARM B;  4BAP A;  170L A;  2A7D A;  5B05 A;  3WU7 A;  4ANR A;  1GFJ A;  5F9X A;  4WOA A;  4ARJ A;  1HFY A;  1ALC A;  1A4V A;  1GEZ A;  4BAF A;  1P7S A;  4EXM A;  1G0L A;  2IHL A;  4LDE A;  216L A;  1L79 A;  1KW7 A;  1LPY A;  4O34 A;  3UON A;  1C43 A;  3P4Z A;  4WM3 A;  5I14 A;  177L A;  1W08 A;  211L A;  259L A;  1IWT A;  2F4G A;  1LZY A;  7LYZ A;  4B4J A;  1C6A A;  1GXV 2;  1F10 A;  3C83 A;  3A3R X;  1B6I A;  2BQJ A;  2B70 A;  1L86 A;  4ET9 A;  1LZ9 A;  3N9C A;  257L A;  4W51 A;  5LAF A;  5KXY A;  1VED A;  3WH1 A;  3QE8 A;  3G3A B;  4OOT A;  1HFZ A;  1L11 A;  2BQC A;  1VAU A;  1KS3 A;  1CV6 A;  1LMQ A;  1G0Q A;  2BQD A;  1GB2 A;  1GB9 A;  1P64 A;  4B1A A;  3A93 A;  1LWK A;  4OOO A;  3HH5 A;  4CHX A;  1UIH A;  3F8V A;  5LZM A;  1C6K A;  187L A;  231L A;  1REY A;  3P68 A;  1C65 A;  4D9Z A;  1P2C C;  1FKV A;  1L00 A;  1L90 A;  3A96 A;  1UIF A;  1GF5 A;  3HBD A;  1FKQ A;  4EOF A;  1D2Y A;  2MEF A;  3LYO A;  4N5R A;  3AZ4 A;  132L A;  2RBQ A;  1GF9 A;  3A3Q A;  3A8Z A;  1L0J A;  3CDT A;  4J1A A;  3MGW A;  201L A;  1P3N A;  1PQO A;  251L A;  4I7N A;  1SWY A;  5I4Y A;  4ET8 A;  2HU3 A;  4WO6 A;  1JSE A;  1LZT A;  3IJV A;  2B6T A;  4DDA A;  2MEH A;  1HF4 A;  4MCK A;  1IR8 A;  1CNS A;  1L03 A;  1IR9 A;  4DQ5 A;  138L A;  3HWL A;  1L81 A;  4WO9 A;  3C8Q A;  1L89 A;  1GE0 A;  2ANX A;  213L A;  1NHB A;  254L A;  1NMM A;  1JJ3 A;  4MR1 A;  250L A;  141L A;  4NHQ A;  1XEP A;  2CUU A;  1GB5 A;  1L91 A;  4NGW A;  2B6X A;  4I7M A;  1JEF A;  1QDT A;  3HT6 A;  3LZT A;  4GN3 A;  1LZR A;  2N5Z A;  1LGW A;  3RZE A;  3DN8 A;  4W53 A;  1QTE A;  1L71 A;  4WG7 A;  1QTB A;  1GWD A;  1JTT L;  2RBP A;  2B72 A;  5JEN B;  1LOZ A;  1G0P A;  1L94 A;  1L85 A;  5LYM A;  1C6M A;  1WQN A;  3C82 A;  153L A;  4TSB A;  5FCP A;  1IVM A;  4NGI A;  243L A;  1OWZ A;  1L63 A;  5HNC A;  2W1L A;  173L A;  4ZFP A;  1SSW A;  4DDB A;  1LSA A;  193L A;  1JJ1 A;  1YIL A;  2WAR A;  2I6Z A;  162L A;  3T6U A;  4DQJ A;  1KXY A;  1D0K A;  1OUC A;  1UIA A;  3WU8 A;  3CT5 A;  3GUP A;  2Z39 A;  1CV3 A;  4E3U A;  1B5X A;  3GUJ A;  2L78 A;  4WMG A;  4OWC A;  1D3M A;  4WLX A;  4YEO A;  2BAA A;  1QT7 A;  209L A;  1DPX A;  4PPO A;  1B7S A;  4OO9 A;  4W58 A;  2DBT A;  2HUL A;  1IWU A;  194L A;  1QDR A;  1LZC A;  5FDJ A;  1LGX A;  3FI7 A;  3DN3 A;  1LYI A;  3AW6 A;  1HEO A;  2HTX A;  1IP6 A;  4HJY A;  3EMS A;  5F81 A;  1H6M A;  1EQ4 A;  109L A;  1QUO A;  1GBZ A;  1ZYT A;  108L A;  1WVV A;  1QUH A;  1LSN A;  4H9C A;  1UIE A;  3TMV A;  5A3Z A;  1B5Z A;  3HDE A;  4DAJ A;  2MEA A;  1G0K A;  1XEJ A;  4YF2 A;  3B72 A;  2C8P A;  4DWX A;  4N0J A;  2Q9E A;  5HMV A;  3SB6 A;  2DQE Y;  1D9W A;  4I7K A;  1LYH A;  2RAY X;  5I54 A;  1XFP L;  4N1E I;  4H90 A;  1L37 A;  5LA5 A;  4HPI A;  1DYG A;  4XJH A;  1QS9 A;  1L44 A;  4WLD A;  1I1Z A;  4H9F A;  4R6C A;  2B75 A;  5D5C A;  2EPE A;  2OU0 X;  125L A;  4LDO A;  2B74 A;  1D3N A;  1I6S A;  5II3 A;  4EKR A;  1F6S A;  198L A;  3K3T A;  1OVJ A;  1LMP A;  225L A;  2XQO A;  1FDL Y;  4XJI A;  1D6Q A;  1XJU A;  1GFG A;  4YEN A;  1HEP A;  1QUG A;  1WQO A;  3W6D A;  4IAS A;  5APC A;  2LC9 A;  4CFP A;  222L A;  233L A;  1LJJ A;  227L A;  3RZ4 A;  3V2Y A;  1GE3 A;  2DQD Y;  2B7X A;  5LYZ A;  199L A;  1LMT A;  4Z3M A;  3ZVQ B;  3WW5 A;  1GBO A;  111L A;  3TMU A;  3DN6 A;  4Z46 A;  2OEA X;  5ILC A;  1CKF A;  4I7J A;  4UWV A;  172L A;  1LI6 A;  4H8X A;  2BQI A;  1C10 A;  1IOT A;  3G3W A;  119L A;  1JIT A;  6LYT A;  4TWS A;  1UC0 A;  3WVX A;  5KXO A;  1GBX A;  2BQH A;  1T8F A;  1INU A;  2MEB A;  3BKV A;  1HEN A;  5AMY A;  180L A;  1ZUR A;  2BQK A;  1KXW A;  4NHT A;  1L54 A;  4H9B A;  2OTZ X;  5B06 A;  175L A;  1L39 A;  1NWG A;  3WW6 A;  3CT0 A;  1KIP C;  1B7R A;  1LAA A;  2B6W A;  5LVK A;  4DYG A;  167L A;  1REM A;  3ODU A;  1LSD A;  3WMK A;  1IX0 A;  1QUT A;  241L A;  2O79 A;  1L98 A;  1CV5 A;  4RLM A;  1XJT A;  4I7L A;  4HSF A;  5L3I A;  3TXD A;  2BQF A;  2IGC A;  1IP3 A;  1LSM A;  1JKC A;  2ZYC A;  1BB5 A;  3G3B B;  1BWJ A;  2EIZ C;  4ARQ B;  1L17 A;  1JKD A;  3PDS A;  4X3B A;  2ZIK A;  1GHL A;  3TXG A;  1L07 A;  3C7W A;  1L0K A;  1LMA A;  1D0M A;  2B6Y A;  4OWB A;  1QT3 A;  3CSZ A;  244L A;  1G1V A;  1GDW A;  1QS5 A;  3TXF A;  3AGI A;  4FDY A;  4H9A A;  1LHI A;  1L06 A;  1BB7 A;  2OU8 A;  4QDN A;  1L43 A;  4TTD A;  3A95 A;  197L A;  4J0L A;  3IWR A;  1DYA A;  206L A;  2B73 A;  3AZ6 A;  5I5Q A;  4A7D A;  1C6E A;  160L A;  1IY4 A;  3OE9 A;  3RT5 X;  1LSC A;  2YBM A;  3JR6 A;  2ZWB A;  4XYY A;  4UWU A;  1LJI A;  1LKS A;  4NSI A;  4PK0 A;  4N8Z A;  1L70 A;  3M18 B;  4H9E A;  1C69 A;  3TMW A;  1L50 A;  4RDS A;  3DN1 A;  4CGE A;  3HUK A;  2Q9D A;  252L A;  2OTY X;  1L84 A;  3WUN A;  2F4A A;  1H87 A;  1L64 A;  1OUA A;  4RW1 A;  1WQQ A;  1GXX A;  1LPI A;  2F2Q A;  1NDG C;  2F2N A;  1TLA A;  1TBY A;  4GCB A;  1C6L A;  1L01 A;  1L20 A;  2MEC A;  4L41 A;  4HJV A;  1JIS A;  3RW8 A;  1VFB C;  4GN4 A;  4I8S A;  3SB5 A;  3A91 A;  1B7N A;  1IWX A;  2BQB A;  2MEE A;  4U3X B;  3GUK A;  258L A;  3EXD A;  4GLA A;  3CQL A;  1CKD A;  4NHI A;  1LI2 A;  2BPU A;  4DQ7 A;  1GFH A;  1GBY A;  1L14 A;  4NGL A;  1JTP L;  4YXA C;  1DI3 A;  1PZY A;  171L A;  1IEE A;  4NHS A;  5IEL A;  2NWD X;  3DMX A;  127L A;  1C6D A;  1L97 A;  3AJN A;  2DQF C;  1UUZ C;  1F6R A;  2DKV A;  4H93 A;  1DXJ A;  1XGQ C;  4NY5 A;  1WQP A;  1OUH A;  4W96 A;  4H94 A;  1CJ8 A;  1GB3 A;  4ETD A;  1XSF A;  4LZM A;  5B59 A;  5LVH A;  1C6F A;  4B0D A;  1RI8 B;  3DN2 A;  4DT3 A;  103L A;  1T6H A;  3T36 A;  154L A;  1JWR A;  1UCO A;  4I0C A;  1ZWN A;  126L A;  2XJW A;  3F6Z A;  1GE1 A;  1DYF A;  4PRU A;  4Z41 A;  1NQI A;  5LVG A;  1QSW A;  1I56 A;  2DQG Y;  130L A;  1VDT A;  1GB8 A;  4IJ4 A;  1E8L A;  4N1C C;  4YX7 C;  256L A;  1L73 A;  2RH1 A;  182L A;  4CFO A;  4UWN A;  3GUL A;  163L A;  4G4B A;  2Z12 A;  217L A;  4KL7 A;  3RU5 A;  1L49 A;  5FST A;  2ZIJ A;  3GXR A;  1LW9 A;  1C6P A;  2RBR A;  4TSC A;  1L99 A;  1L27 A;  5J7C A;  4AQN A;  2X0A A;  1CTW A;  3NY9 A;  3QY4 A;  2OU9 A;  1QT8 A;  1VAT A;  1GFU A;  2OE4 X;  192L A;  1L04 A;  185L A;  4G4C A;  1CU2 A;  1UIG A;  4PGJ B;  1L67 A;  102L A;  3W6E A;  4HTK A;  4LYM A;  1L62 A;  248L A;  4B4E A;  3L2X A;  1YAQ A;  3D4S A;  1IWY A;  3HH4 A;  1DYD A;  1P46 A;  1L40 A;  2Z6B A;  4XJF A;  1K28 A;  5KXZ A;  1DI5 A;  1L56 A;  4W54 A;  5B1F A;  2ZIL A;  3P65 A;  2I26 L;  5C6J A;  1B7P A;  1L53 A;  1QTK A;  3SP3 A;  1UBZ A;  4H1P A;  1BGI A;  2G4P A;  3OK0 A;  1YAP A;  1GFK A;  1L05 A;  3W6B A;  150L A;  4HTN A;  3WPJ A;  4M4O A;  2Z37 A;  4WM2 A;  1LSP A;  5FEL A;  189L A;  5KXP A;  5KXX A;  3CDO A;  5HQ1 A;  4MST A;  1UAC Y;  1QUS A;  1GFV A;  1L36 A;  4W94 A;  1F0W A;  1WQM A;  1SX7 A;  1KIR C;  1IOS A;  1LSE A;  3F9L A;  2ZQ3 A;  169L A;  1L59 A;  1GF8 A;  1OYU A;  1L60 A;  1AT5 A;  1LHM A;  3LZ2 A;  2CJL A;  1L80 A;  255L A;  2DQA A;  3WUA A;  1G06 A;  1C6G A;  4DJH A;  2B6Z A;  5D5F A;  215L A;  3AW7 A;  4KPM A;  3AZ5 A;  1BB4 A;  3A34 A;  1G7J C;  3A92 A;  1LMC A;  4PHI A;  4OWH A;  4WL7 A;  135L A;  232L A;  2O7A A;  3CDQ A;  3HUQ A;  4XEN A;  2NTH A;  3QNG A;  3HH3 A;  2F32 A;  4B4I A;  1L18 A;  4EKQ A;  3C8S A;  1CVK A;  1AKI A;  1IO5 A;  1C62 A;  1ZMY L;  3A6C Y;  2B5Z A;  2XTH A;  1C46 A;  2LYZ A;  3W6A A;  1GB7 A;  230L A;  5T3F A;  1REX A;  1OUJ A;  1L25 A;  184L A;  1JPO A;  5KJ9 A;  4ETC A;  1DKJ A;  3GUN A;  1HMK A;  4NG1 A;  1UIC A;  1P37 A;  1IC5 Y;  1XGU C;  1YL1 X;  2BLY A;  2HUM A;  3GXK A;  191L A;  1TEW A;  3HBH A;  2HEB A;  4ARM A;  4TX7 A;  3WXT A;  4OWA A;  4W57 A;  1CV0 A;  1L10 A;  164L A;  1D9U A;  5KXR A;  128L A;  2OE9 X;  2YBI A;  1IR7 A;  9LYZ A;  3OE6 A;  1L72 A;  2I25 L;  3N9A A;  1ZVH L;  1C6H A;  4YEM A;  4YXC A;  2D4J A;  4NFV A;  4PJZ A;  1EPY A;  5DN4 A;  1YAM A;  5M1Y A;  3J6K A;  1FLU A;  2G4Q A;  1LTM A;  5F16 A;  1D2W A;  1OV7 A;  4R0F A;  4I7Q A;  2ZQ4 A;  1IIZ A;  4EJ4 A;  139L A;  3SB9 A;  134L A;  1LI3 A;  2FBD A;  4H9I A;  1FN5 A;  4DD2 A;  2FYC A;  5L9J A;  2PC2 A;  4LFP A;  2F47 A;  4WM1 A;  3C80 A;  1ZVY B;  208L A;  4BAD A;  1DPW A;  1LYE A;  2DQJ Y;  5KXT A;  5DN5 A;  3LZM A;  183L A;  137L A;  1BB6 A;  1IC4 Y;  3SN6 R;  1GEV A;  188L A;  1UIB A;  3DMZ A;  157L A;  176L A;  1T97 A;  1AT6 A;  4DD7 A;  1B2K A;  3LHM A;  4H8Z A;  5IHG A;  1ZV5 L;  1HEW A;  1PQJ A;  1HFX A;  4ETB A;  1L19 A;  1OWY A;  2IFF Y;  4NGZ A;  1DI4 A;  2H9K A;  1NDM C;  2HUK A;  3CB7 A;  1L75 A;  4NWH A;  1LYF A;  120L A;  2HEE A;  140L A;  2XBR A;  129L A;  1GF7 A;  4EPI A;  3C8R A;  1B7Q A;  1QQY A;  1A2Y C;  1YKX X;  3C7Z A;  3W6C A;  1IWV A;  2YSS C;  2W1X A;  1IOR A;  1HEQ A;  114L A;  4LGK A;  5LA8 A;  2D6B A;  5I53 A;  5KKI A;  1GFT A;  104L A;  1JHL A;  4NGK A;  2CDS A;  1L08 A;  2RSC A;  1T3P A;  3TXE A;  1WTH A;  4NSG A;  1QSA A;  1T8G A;  113L A;  253L A;  1J1P Y;  2ZYP A;  1IWW A;  1LJH A;  1LZG A;  1P2R A;  1QTD A;  220L A;  4ZIX A;  3SBB C;  1YKY X;  3V2W A;  1T8A A;  2YBH A;  5F9U A;  2Z18 A;  1L77 A;  1G07 A;  1L32 A;  3AGG G;  1GAZ A;  3DN0 A;  1NBY C;  165L A;  1I20 A;  2HEC A;  1G7M C;  1XEI A;  1RCM A;  5LYT A;  174L A;  4LT2 A;  5F14 A;  4LT3 A;  1LYO A;  2FYD A;  246L A;  3LYT A;  3NY8 A;  3K2R A;  1LJK A;  1QT6 A;  4HPE A;  1GBW A;  5B1G A;  133L A;  3HTG A;  4ZEE A;  1L51 A;  195L A;  1BHZ A;  1C68 A;  1NHE A;  4H91 A;  4C5F A;  1JKB A;  5LIN A;  1B7O A;  1LLH A;  3HTF A;  161L A;  1VDP A;  3IJU A;  4LDL A;  2FBB A;  3HT9 A;  4LT0 A;  1L15 A;  1L30 A;  3TXK A;  1DYE A;  1P2L A;  5DLA A;  2EQL A;  224L A;  3ULR A;  1D3J A;  1IWZ A;  1JUG A;  5LVI A;  5C6I A;  5I4W A;  1LJ4 A;  5LXW A;  262L A;  3W6F A;  143L A;  1T6V L;  1L48 A;  3A90 A;  1O23 A;  2DQC Y;  4WLY A;  2MEI A;  1L24 A;  156L A;  1KNI A;  2O4W A;  3D9A C;  1GD6 A;  3D3D A;  218L A;  1P56 A;  196L A;  4ARL A;  1OP9 B;  1L22 A;  1RFP A;  1HSW A;  1JJ0 A;  1QT4 A;  1QTC A;  1HEL A;  2DQH Y;  3N9E A;  123L A;  146L A;  3B0O A;  5HNL A;  1J1O Y;  1LHH A;  1B5V A;  4NGO A;  6LYZ A;  2F30 A;  1KY1 A;  1GF0 A;  1L45 A;  1YRO A;  2Z38 A;  2CGI A;  1N4F A;  2H5Z A;  3EO5 A;  4EKS A;  1DYC A;  1PQK A;  2HEF A;  4EMN A;  1NKH A;  5KY1 A;  1L57 A;  1HC0 A;  5APD A;  190L A;  4GCF A;  1L29 A;  1C6T A;  4XN6 A;  1SX2 A;  2ANV A;  3GUM A;  1DYB A;  1L34 A;  3SBA A;  1RJC B;  1OUB A;  3CDR A;  2Z19 A;  3C7Y A; 
#chains in the Genus database with same CATH homology
 3TXH A;  3B0I A;  1C6I A;  1L09 A;  2GV0 A;  4NHP A;  4XAD A;  4QEQ A;  1L23 A;  1JTN A;  1KW5 A;  2YBN A;  1LWG A;  1LYJ A;  1OV5 A;  5KKJ A;  1B7M A;  2A4T A;  3AB6 A;  3ZVQ A;  2YVB A;  5KXW A;  2G4N A;  2D4K A;  4GRV A;  2Z2E A;  1IC7 Y;  3HDF A;  1OUD A;  3DNA A;  1JSF A;  3FA0 A;  2D4I A;  1PQD A;  1OQM A;  4EKP A;  1WTM A;  5HLL A;  1CX6 A;  1QIO A;  3PBL A;  4YOP A;  2LZM A;  5DL9 A;  1OUG A;  1DKK A;  1QT5 A;  2H9J A;  4DDC A;  1L16 A;  207L A;  3A67 Y;  2RB0 X;  1AZF A;  3G3V A;  1LZA A;  1CV4 A;  249L A;  1LYD A;  1GPQ C;  1LCN A;  1DQJ C;  4C3W A;  3CSR A;  2RB1 X;  1GDX A;  2MED A;  4NEB A;  4GCC A;  2VB1 A;  1L93 A;  1OUF A;  3RNX A;  1L26 A;  4LYB A;  1L35 A;  3LYZ A;  1CX7 A;  1L41 A;  4G4H A;  3AZ7 A;  4HV1 A;  1P6Y A;  4ARQ A;  2HUB A;  2EKS C;  3HU8 A;  3HUA A;  5A3E A;  4GN5 C;  4WLT A;  1LZ8 A;  238L A;  2BQO A;  5E4P A;  1CU3 A;  1GBS A;  1GF3 A;  2CWI A;  4WM6 A;  145L A;  1G7I C;  7LZM A;  1LYZ A;  3G3X A;  3LYM A;  2YBJ A;  1LJE A;  4RW2 A;  247L A;  1OVK A;  4BS7 A;  1AM7 A;  3QAK A;  3HTB A;  1TAY A;  2BQL A;  5IDD A;  1D0L A;  152L A;  1OUE A;  1L92 A;  1MLC E;  1L66 A;  1SSY A;  2MEG A;  2HU1 A;  4S0W A;  260L A;  2BQE A;  1L12 A;  4LYC A;  1XEK A;  5KXM A;  1CV1 A;  4H92 A;  2LZ2 A;  1EL1 A;  242L A;  159L A;  3C81 A;  4OWE A;  1PQM A;  210L A;  1P36 A;  8LYZ A;  4NIJ A;  3DMV A;  3J4G A;  4XJG A;  226L A;  2RBO A;  1L82 A;  212L A;  4WM5 A;  1CUP A;  5L3H A;  3WL2 A;  2BQM A;  1B7L A;  1G0G A;  1L31 A;  1BWH A;  1KY0 A;  1LSF A;  1GF6 A;  2RAZ X;  4KXI A;  4XJB A;  2C8O A;  4I7S A;  1L68 A;  3E3D A;  1L88 A;  1L95 A;  236L A;  3SB8 A;  3TXB A;  1QTZ A;  4W55 A;  3WYH A;  4EPF A;  1QTH A;  1CU5 A;  4H8Y A;  3KAM A;  107L A;  1B0D A;  2BQN A;  4W59 A;  3GUO A;  228L A;  1LJ3 A;  2RBN A;  1C61 A;  1B9O A;  1HNL A;  1LHJ A;  2D91 A;  1GAY A;  1C64 A;  245L A;  110L A;  5LAG A;  178L A;  6LZM A;  2W1Y A;  3VW7 A;  1C45 A;  1QSB A;  1L47 A;  1GE2 A;  4HJZ A;  1Z55 A;  5FEK A;  4GCE A;  5LIO A;  5K7O A;  1G7H C;  3AYQ A;  1G7L C;  1QUD A;  4P2E A;  4ML7 A;  4ETE A;  1B5U A;  1YAN A;  1CJ6 A;  1L55 A;  1C6B A;  3HBE X;  4N9R A;  1VDS A;  1LZD A;  155L A;  1C60 A;  1FBI X;  3WUL A;  3HFM Y;  1LKR A;  1L69 A;  1SLY A;  5DM9 A;  1GF4 A;  3TXI A;  1YIK A;  1L21 A;  205L A;  1LZS A;  3ATO A;  3FAD A;  1C7P A;  1CU6 A;  4YM8 A;  5KXN A;  237L A;  2BQG A;  261L A;  144L A;  1D6P A;  158L A;  1LJF A;  4LYO A;  4NGY A;  234L A;  1JIY A;  1L42 A;  4NGJ A;  3WUM A;  4G49 A;  4W56 A;  3AGH A;  2LYM A;  1CJ7 A;  4ARP A;  219L A;  4QGZ A;  3L64 A;  1CJ9 A;  1VDQ A;  1IP1 A;  1G0J A;  1YAO A;  1J1X Y;  5HMJ A;  3CT1 A;  5FHW A;  1G1W A;  1JQU A;  2LZT A;  4LYZ A;  1QTV A;  1CKH A;  1LYG A;  5KXK A;  1L96 A;  3A94 A;  1XGR C;  221L A;  1L74 A;  115L A;  5EBH A;  5KXS A;  1V7T A;  1LZ5 A;  1CKC A;  2ZNW Y;  1C63 A;  240L A;  4WM4 A;  4LFX A;  5APE A;  3WXU A;  1LGU A;  4KT3 A;  112L A;  1LZ6 A;  3HU9 A;  122L A;  1HHL A;  1JTM A;  4LZT A;  1LHK A;  3FI5 A;  4DD9 A;  2QB0 B;  3P64 A;  1EQE A;  166L A;  2Z2F A;  147L A;  2AUB A;  1FLQ A;  1OVH A;  4LYT A;  186L A;  4NWE A;  1DZB X;  1IP7 A;  5APF A;  3BKH A;  1XGT C;  4LT1 A;  1LZE A;  1LJG A;  3OE8 A;  3WVY A;  223L A;  1CKG A;  4H9H A;  2RB2 X;  1RE2 A;  148L E;  1PS5 A;  4PJ2 C;  1B5W A;  3TMX A;  4IAT A;  1C08 C;  4W52 A;  1BVK C;  1HML A;  142L A;  1L28 A;  3HT7 A;  4HP0 A;  3B0K A;  1LSG A;  4PRQ A;  2Q0M X;  3WPK A;  1WTN A;  3CSQ A;  1SWZ A;  1B5Y A;  118L A;  168L A;  1GFE A;  4DKL A;  3WU9 A;  1HEM A;  1C66 A;  3CDV A;  2OE7 X;  4I7R A;  1FLW A;  1WVU A;  3EBA B;  151L A;  1BQL Y;  1LMO A;  1L52 A;  4GCD A;  1L33 A;  5LVJ A;  214L A;  3NYA A;  4WG1 A;  200L A;  2QAR C;  1LSY A;  1OUI A;  4I7T A;  4TUN A;  3A6B Y;  1C6Q A;  3ATN A;  149L A;  1GB6 A;  4XJD A;  1LYS A;  4CJ2 A;  1WQR A;  2W1M A;  4QY9 A;  2XBS A;  1NF5 A;  1HER A;  2YDG A;  1LMN A;  4E97 A;  131L A;  3DKE X;  3HH6 A;  4AXT A;  2A7F A;  5B07 A;  1L65 A;  1YKZ X;  4NSH A;  1C6J A;  4DD0 A;  4J7V A;  4M6D A;  1UID A;  1REZ A;  4DD3 A;  1UA6 Y;  229L A;  1L87 A;  4DD1 A;  1GB0 A;  1SQ2 L;  181L A;  1BVX A;  4GBR B;  3GUI A;  3OJP A;  5E9R A;  1QSQ A;  1C67 A;  1L02 A;  4DC4 A;  2HEA A;  1XGP C;  4K5Y A;  1BB3 A;  4IAP A;  4ZPU A;  4RLN A;  1LZ1 A;  2LYO A;  3TXJ A;  4NSJ A;  1L83 A;  3DN4 A;  3OE0 A;  2Y8P A;  3P66 A;  1KIQ C;  2YBL A;  1YL0 X;  3LN2 A;  1TCY A;  4B49 A;  2HED A;  4HV2 A;  4G9S A;  3FE0 A;  1LSZ A;  3B6L A;  4OW1 A;  2BLX A;  2BQA A;  3HTD A;  2ZNX Y;  1IP4 A;  4Z98 A;  3WPL A;  1YQV Y;  1EQ5 A;  1D3F A;  1IP5 A;  1LYY A;  1MEL L;  3RUN A;  1IY3 A;  2NTG A;  5KXL A;  5C6L A;  3M3U A;  1G0M A;  1LHL A;  4ETA A;  4II8 A;  1NBZ C;  1IOC A;  1GFA A;  1L46 A;  1FLY A;  3HT8 A;  1V7S A;  1LSB A;  5ILF A;  1IOQ A;  1HSX A;  1TDY A;  2DQI Y;  4NG8 A;  1IP2 A;  4GLV A;  1LZB A;  1C6C A;  2LHM A;  235L A;  1C6N A;  1L38 A;  3SB7 A;  2RBS A;  1L13 A;  1LJN A;  1GFR A;  2LCB A;  1CU0 A;  1CUQ A;  4HTQ A;  1JTO L;  3EML A;  3ZEK A;  4WL6 A;  1LZN A;  1P5C A;  1W6Z A;  4AGA A;  4I7O A;  1PQI A;  4J1B A;  239L A;  5I4X A;  1LZ4 A;  3W3E A;  1JKA A;  1GE4 A;  1KXX A;  4I7P A;  1L58 A;  4FJR A;  4NGV A;  1L76 A;  3VWO A;  1L61 A;  1BWI A;  4ARM B;  4BAP A;  170L A;  2A7D A;  5B05 A;  3WU7 A;  4ANR A;  1GFJ A;  5F9X A;  4WOA A;  4ARJ A;  1HFY A;  1ALC A;  1A4V A;  1GEZ A;  4BAF A;  1P7S A;  4EXM A;  1G0L A;  2IHL A;  4LDE A;  216L A;  1L79 A;  1KW7 A;  1LPY A;  4O34 A;  3UON A;  1C43 A;  3P4Z A;  4WM3 A;  5I14 A;  177L A;  1W08 A;  211L A;  259L A;  1IWT A;  2F4G A;  1LZY A;  7LYZ A;  4B4J A;  1C6A A;  1GXV 2;  1F10 A;  3C83 A;  3A3R X;  1B6I A;  2BQJ A;  2B70 A;  1L86 A;  4ET9 A;  1LZ9 A;  3N9C A;  257L A;  4W51 A;  5LAF A;  5KXY A;  1VED A;  3WH1 A;  3QE8 A;  3G3A B;  4OOT A;  1HFZ A;  1L11 A;  2BQC A;  1VAU A;  1KS3 A;  1CV6 A;  1LMQ A;  1G0Q A;  2BQD A;  1GB2 A;  1GB9 A;  1P64 A;  4B1A A;  3A93 A;  1LWK A;  4OOO A;  3HH5 A;  4CHX A;  1UIH A;  3F8V A;  5LZM A;  1C6K A;  187L A;  231L A;  1REY A;  3P68 A;  1C65 A;  4D9Z A;  1P2C C;  1FKV A;  1L00 A;  1L90 A;  3A96 A;  1UIF A;  1GF5 A;  3HBD A;  1FKQ A;  4EOF A;  1D2Y A;  2MEF A;  3LYO A;  4N5R A;  3AZ4 A;  132L A;  2RBQ A;  1GF9 A;  3A3Q A;  3A8Z A;  1L0J A;  3CDT A;  4J1A A;  3MGW A;  201L A;  1P3N A;  1PQO A;  251L A;  4I7N A;  1SWY A;  5I4Y A;  4ET8 A;  2HU3 A;  4WO6 A;  1JSE A;  1LZT A;  3IJV A;  2B6T A;  4DDA A;  2MEH A;  1HF4 A;  4MCK A;  1IR8 A;  1CNS A;  1L03 A;  1IR9 A;  4DQ5 A;  138L A;  3HWL A;  1L81 A;  4WO9 A;  3C8Q A;  1L89 A;  1GE0 A;  2ANX A;  213L A;  1NHB A;  254L A;  1NMM A;  1JJ3 A;  4MR1 A;  250L A;  141L A;  4NHQ A;  1XEP A;  2CUU A;  1GB5 A;  1L91 A;  4NGW A;  2B6X A;  4I7M A;  1JEF A;  1QDT A;  3HT6 A;  3LZT A;  4GN3 A;  1LZR A;  2N5Z A;  1LGW A;  3RZE A;  3DN8 A;  4W53 A;  1QTE A;  1L71 A;  4WG7 A;  1QTB A;  1GWD A;  1JTT L;  2RBP A;  2B72 A;  5JEN B;  1LOZ A;  1G0P A;  1L94 A;  1L85 A;  5LYM A;  1C6M A;  1WQN A;  3C82 A;  153L A;  4TSB A;  5FCP A;  1IVM A;  4NGI A;  243L A;  1OWZ A;  1L63 A;  5HNC A;  2W1L A;  173L A;  4ZFP A;  1SSW A;  4DDB A;  1LSA A;  193L A;  1JJ1 A;  1YIL A;  2WAR A;  2I6Z A;  162L A;  3T6U A;  4DQJ A;  1KXY A;  1D0K A;  1OUC A;  1UIA A;  3WU8 A;  3CT5 A;  3GUP A;  2Z39 A;  1CV3 A;  4E3U A;  1B5X A;  3GUJ A;  2L78 A;  4WMG A;  4OWC A;  1D3M A;  4WLX A;  4YEO A;  2BAA A;  1QT7 A;  209L A;  1DPX A;  4PPO A;  1B7S A;  4OO9 A;  4W58 A;  2DBT A;  2HUL A;  1IWU A;  194L A;  1QDR A;  1LZC A;  5FDJ A;  1LGX A;  3FI7 A;  3DN3 A;  1LYI A;  3AW6 A;  1HEO A;  2HTX A;  1IP6 A;  4HJY A;  3EMS A;  5F81 A;  1H6M A;  1EQ4 A;  109L A;  1QUO A;  1GBZ A;  1ZYT A;  108L A;  1WVV A;  1QUH A;  1LSN A;  4H9C A;  1UIE A;  3TMV A;  5A3Z A;  1B5Z A;  3HDE A;  4DAJ A;  2MEA A;  1G0K A;  1XEJ A;  4YF2 A;  3B72 A;  2C8P A;  4DWX A;  4N0J A;  2Q9E A;  5HMV A;  3SB6 A;  2DQE Y;  1D9W A;  4I7K A;  1LYH A;  2RAY X;  5I54 A;  1XFP L;  4N1E I;  4H90 A;  1L37 A;  5LA5 A;  4HPI A;  1DYG A;  4XJH A;  1QS9 A;  1L44 A;  4WLD A;  1I1Z A;  4H9F A;  4R6C A;  2B75 A;  5D5C A;  2EPE A;  2OU0 X;  125L A;  4LDO A;  2B74 A;  1D3N A;  1I6S A;  5II3 A;  4EKR A;  1F6S A;  198L A;  3K3T A;  1OVJ A;  1LMP A;  225L A;  2XQO A;  1FDL Y;  4XJI A;  1D6Q A;  1XJU A;  1GFG A;  4YEN A;  1HEP A;  1QUG A;  1WQO A;  3W6D A;  4IAS A;  5APC A;  2LC9 A;  4CFP A;  222L A;  233L A;  1LJJ A;  227L A;  3RZ4 A;  3V2Y A;  1GE3 A;  2DQD Y;  2B7X A;  5LYZ A;  199L A;  1LMT A;  4Z3M A;  3ZVQ B;  3WW5 A;  1GBO A;  111L A;  3TMU A;  3DN6 A;  4Z46 A;  2OEA X;  5ILC A;  1CKF A;  4I7J A;  4UWV A;  172L A;  1LI6 A;  4H8X A;  2BQI A;  1C10 A;  1IOT A;  3G3W A;  119L A;  1JIT A;  6LYT A;  4TWS A;  1UC0 A;  3WVX A;  5KXO A;  1GBX A;  2BQH A;  1T8F A;  1INU A;  2MEB A;  3BKV A;  1HEN A;  5AMY A;  180L A;  1ZUR A;  2BQK A;  1KXW A;  4NHT A;  1L54 A;  4H9B A;  2OTZ X;  5B06 A;  175L A;  1L39 A;  1NWG A;  3WW6 A;  3CT0 A;  1KIP C;  1B7R A;  1LAA A;  2B6W A;  5LVK A;  4DYG A;  167L A;  1REM A;  3ODU A;  1LSD A;  3WMK A;  1IX0 A;  1QUT A;  241L A;  2O79 A;  1L98 A;  1CV5 A;  4RLM A;  1XJT A;  4I7L A;  4HSF A;  5L3I A;  3TXD A;  2BQF A;  2IGC A;  1IP3 A;  1LSM A;  1JKC A;  2ZYC A;  1BB5 A;  3G3B B;  1BWJ A;  2EIZ C;  4ARQ B;  1L17 A;  1JKD A;  3PDS A;  4X3B A;  2ZIK A;  1GHL A;  3TXG A;  1L07 A;  3C7W A;  1L0K A;  1LMA A;  1D0M A;  2B6Y A;  4OWB A;  1QT3 A;  3CSZ A;  244L A;  1G1V A;  1GDW A;  1QS5 A;  3TXF A;  3AGI A;  4FDY A;  4H9A A;  1LHI A;  1L06 A;  1BB7 A;  2OU8 A;  4QDN A;  1L43 A;  4TTD A;  3A95 A;  197L A;  4J0L A;  3IWR A;  1DYA A;  206L A;  2B73 A;  3AZ6 A;  5I5Q A;  4A7D A;  1C6E A;  160L A;  1IY4 A;  3OE9 A;  3RT5 X;  1LSC A;  2YBM A;  3JR6 A;  2ZWB A;  4XYY A;  4UWU A;  1LJI A;  1LKS A;  4NSI A;  4PK0 A;  4N8Z A;  1L70 A;  3M18 B;  4H9E A;  1C69 A;  3TMW A;  1L50 A;  4RDS A;  3DN1 A;  4CGE A;  3HUK A;  2Q9D A;  252L A;  2OTY X;  1L84 A;  3WUN A;  2F4A A;  1H87 A;  1L64 A;  1OUA A;  4RW1 A;  1WQQ A;  1GXX A;  1LPI A;  2F2Q A;  1NDG C;  2F2N A;  1TLA A;  1TBY A;  4GCB A;  1C6L A;  1L01 A;  1L20 A;  2MEC A;  4L41 A;  4HJV A;  1JIS A;  3RW8 A;  1VFB C;  4GN4 A;  4I8S A;  3SB5 A;  3A91 A;  1B7N A;  1IWX A;  2BQB A;  2MEE A;  4U3X B;  3GUK A;  258L A;  3EXD A;  4GLA A;  3CQL A;  1CKD A;  4NHI A;  1LI2 A;  2BPU A;  4DQ7 A;  1GFH A;  1GBY A;  1L14 A;  4NGL A;  1JTP L;  4YXA C;  1DI3 A;  1PZY A;  171L A;  1IEE A;  4NHS A;  5IEL A;  2NWD X;  3DMX A;  127L A;  1C6D A;  1L97 A;  3AJN A;  2DQF C;  1UUZ C;  1F6R A;  2DKV A;  4H93 A;  1DXJ A;  1XGQ C;  4NY5 A;  1WQP A;  1OUH A;  4W96 A;  4H94 A;  1CJ8 A;  1GB3 A;  4ETD A;  1XSF A;  4LZM A;  5B59 A;  5LVH A;  1C6F A;  4B0D A;  1RI8 B;  3DN2 A;  4DT3 A;  103L A;  1T6H A;  3T36 A;  154L A;  1JWR A;  1UCO A;  4I0C A;  1ZWN A;  126L A;  2XJW A;  3F6Z A;  1GE1 A;  1DYF A;  4PRU A;  4Z41 A;  1NQI A;  5LVG A;  1QSW A;  1I56 A;  2DQG Y;  130L A;  1VDT A;  1GB8 A;  4IJ4 A;  1E8L A;  4N1C C;  4YX7 C;  256L A;  1L73 A;  2RH1 A;  182L A;  4CFO A;  4UWN A;  3GUL A;  163L A;  4G4B A;  2Z12 A;  217L A;  4KL7 A;  3RU5 A;  1L49 A;  5FST A;  2ZIJ A;  3GXR A;  1LW9 A;  1C6P A;  2RBR A;  4TSC A;  1L99 A;  1L27 A;  5J7C A;  4AQN A;  2X0A A;  1CTW A;  3NY9 A;  3QY4 A;  2OU9 A;  1QT8 A;  1VAT A;  1GFU A;  2OE4 X;  192L A;  1L04 A;  185L A;  4G4C A;  1CU2 A;  1UIG A;  4PGJ B;  1L67 A;  102L A;  3W6E A;  4HTK A;  4LYM A;  1L62 A;  248L A;  4B4E A;  3L2X A;  1YAQ A;  3D4S A;  1IWY A;  3HH4 A;  1DYD A;  1P46 A;  1L40 A;  2Z6B A;  4XJF A;  1K28 A;  5KXZ A;  1DI5 A;  1L56 A;  4W54 A;  5B1F A;  2ZIL A;  3P65 A;  2I26 L;  5C6J A;  1B7P A;  1L53 A;  1QTK A;  3SP3 A;  1UBZ A;  4H1P A;  1BGI A;  2G4P A;  3OK0 A;  1YAP A;  1GFK A;  1L05 A;  3W6B A;  150L A;  4HTN A;  3WPJ A;  4M4O A;  2Z37 A;  4WM2 A;  1LSP A;  5FEL A;  189L A;  5KXP A;  5KXX A;  3CDO A;  5HQ1 A;  4MST A;  1UAC Y;  1QUS A;  1GFV A;  1L36 A;  4W94 A;  1F0W A;  1WQM A;  1SX7 A;  1KIR C;  1IOS A;  1LSE A;  3F9L A;  2ZQ3 A;  169L A;  1L59 A;  1GF8 A;  1OYU A;  1L60 A;  1AT5 A;  1LHM A;  3LZ2 A;  2CJL A;  1L80 A;  255L A;  2DQA A;  3WUA A;  1G06 A;  1C6G A;  4DJH A;  2B6Z A;  5D5F A;  215L A;  3AW7 A;  4KPM A;  3AZ5 A;  1BB4 A;  3A34 A;  1G7J C;  3A92 A;  1LMC A;  4PHI A;  4OWH A;  4WL7 A;  135L A;  232L A;  2O7A A;  3CDQ A;  3HUQ A;  4XEN A;  2NTH A;  3QNG A;  3HH3 A;  2F32 A;  4B4I A;  1L18 A;  4EKQ A;  3C8S A;  1CVK A;  1AKI A;  1IO5 A;  1C62 A;  1ZMY L;  3A6C Y;  2B5Z A;  2XTH A;  1C46 A;  2LYZ A;  3W6A A;  1GB7 A;  230L A;  5T3F A;  1REX A;  1OUJ A;  1L25 A;  184L A;  1JPO A;  5KJ9 A;  4ETC A;  1DKJ A;  3GUN A;  1HMK A;  4NG1 A;  1UIC A;  1P37 A;  1IC5 Y;  1XGU C;  1YL1 X;  2BLY A;  2HUM A;  3GXK A;  191L A;  1TEW A;  3HBH A;  2HEB A;  4ARM A;  4TX7 A;  3WXT A;  4OWA A;  4W57 A;  1CV0 A;  1L10 A;  164L A;  1D9U A;  5KXR A;  128L A;  2OE9 X;  2YBI A;  1IR7 A;  9LYZ A;  3OE6 A;  1L72 A;  2I25 L;  3N9A A;  1ZVH L;  1C6H A;  4YEM A;  4YXC A;  2D4J A;  4NFV A;  4PJZ A;  1EPY A;  5DN4 A;  1YAM A;  5M1Y A;  3J6K A;  1FLU A;  2G4Q A;  1LTM A;  5F16 A;  1D2W A;  1OV7 A;  4R0F A;  4I7Q A;  2ZQ4 A;  1IIZ A;  4EJ4 A;  139L A;  3SB9 A;  134L A;  1LI3 A;  2FBD A;  4H9I A;  1FN5 A;  4DD2 A;  2FYC A;  5L9J A;  2PC2 A;  4LFP A;  2F47 A;  4WM1 A;  3C80 A;  1ZVY B;  208L A;  4BAD A;  1DPW A;  1LYE A;  2DQJ Y;  5KXT A;  5DN5 A;  3LZM A;  183L A;  137L A;  1BB6 A;  1IC4 Y;  3SN6 R;  1GEV A;  188L A;  1UIB A;  3DMZ A;  157L A;  176L A;  1T97 A;  1AT6 A;  4DD7 A;  1B2K A;  3LHM A;  4H8Z A;  5IHG A;  1ZV5 L;  1HEW A;  1PQJ A;  1HFX A;  4ETB A;  1L19 A;  1OWY A;  2IFF Y;  4NGZ A;  1DI4 A;  2H9K A;  1NDM C;  2HUK A;  3CB7 A;  1L75 A;  4NWH A;  1LYF A;  120L A;  2HEE A;  140L A;  2XBR A;  129L A;  1GF7 A;  4EPI A;  3C8R A;  1B7Q A;  1QQY A;  1A2Y C;  1YKX X;  3C7Z A;  3W6C A;  1IWV A;  2YSS C;  2W1X A;  1IOR A;  1HEQ A;  114L A;  4LGK A;  5LA8 A;  2D6B A;  5I53 A;  5KKI A;  1GFT A;  104L A;  1JHL A;  4NGK A;  2CDS A;  1L08 A;  2RSC A;  1T3P A;  3TXE A;  1WTH A;  4NSG A;  1QSA A;  1T8G A;  113L A;  253L A;  1J1P Y;  2ZYP A;  1IWW A;  1LJH A;  1LZG A;  1P2R A;  1QTD A;  220L A;  4ZIX A;  3SBB C;  1YKY X;  3V2W A;  1T8A A;  2YBH A;  5F9U A;  2Z18 A;  1L77 A;  1G07 A;  1L32 A;  3AGG G;  1GAZ A;  3DN0 A;  1NBY C;  165L A;  1I20 A;  2HEC A;  1G7M C;  1XEI A;  1RCM A;  5LYT A;  174L A;  4LT2 A;  5F14 A;  4LT3 A;  1LYO A;  2FYD A;  246L A;  3LYT A;  3NY8 A;  3K2R A;  1LJK A;  1QT6 A;  4HPE A;  1GBW A;  5B1G A;  133L A;  3HTG A;  4ZEE A;  1L51 A;  195L A;  1BHZ A;  1C68 A;  1NHE A;  4H91 A;  4C5F A;  1JKB A;  5LIN A;  1B7O A;  1LLH A;  3HTF A;  161L A;  1VDP A;  3IJU A;  4LDL A;  2FBB A;  3HT9 A;  4LT0 A;  1L15 A;  1L30 A;  3TXK A;  1DYE A;  1P2L A;  5DLA A;  2EQL A;  224L A;  3ULR A;  1D3J A;  1IWZ A;  1JUG A;  5LVI A;  5C6I A;  5I4W A;  1LJ4 A;  5LXW A;  262L A;  3W6F A;  143L A;  1T6V L;  1L48 A;  3A90 A;  1O23 A;  2DQC Y;  4WLY A;  2MEI A;  1L24 A;  156L A;  1KNI A;  2O4W A;  3D9A C;  1GD6 A;  3D3D A;  218L A;  1P56 A;  196L A;  4ARL A;  1OP9 B;  1L22 A;  1RFP A;  1HSW A;  1JJ0 A;  1QT4 A;  1QTC A;  1HEL A;  2DQH Y;  3N9E A;  123L A;  146L A;  3B0O A;  5HNL A;  1J1O Y;  1LHH A;  1B5V A;  4NGO A;  6LYZ A;  2F30 A;  1KY1 A;  1GF0 A;  1L45 A;  1YRO A;  2Z38 A;  2CGI A;  1N4F A;  2H5Z A;  3EO5 A;  4EKS A;  1DYC A;  1PQK A;  2HEF A;  4EMN A;  1NKH A;  5KY1 A;  1L57 A;  1HC0 A;  5APD A;  190L A;  4GCF A;  1L29 A;  1C6T A;  4XN6 A;  1SX2 A;  2ANV A;  3GUM A;  1DYB A;  1L34 A;  3SBA A;  1RJC B;  1OUB A;  3CDR A;  2Z19 A;  3C7Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...