1LYFA

Dissection of helix capping in t4 lysozyme by structural and thermodynamic analysis of six amino acid substitutions at thr 59
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
162
structure length
162
Chain Sequence
MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVISKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(o-glycosyl)
molecule keywords T4 LYSOZYME
publication title Dissection of helix capping in T4 lysozyme by structural and thermodynamic analysis of six amino acid substitutions at Thr 59.
pubmed doi rcsb
source organism Enterobacteria phage t4
total genus 61
structure length 162
sequence length 162
ec nomenclature ec 3.2.1.17: Lysozyme.
pdb deposition date 1992-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00959 Phage_lysozyme Phage lysozyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.530.40 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 1lyfA00
3CDOA 3DNAA 1C64A 211LA 2NTHA 4EJ4A 3DN3A 2A4TA 1DYAA 2OU0X 3GUNA 1K28A 1QUGA 1B6IA 221LA 4I7TA 1CX7A 142LA 3HTDA 2B6ZA 1G0JA 189LA 2RB0X 1L98A 1C6JA 1C69A 1L63A 3FA0A 4ARQA 1L57A 1L41A 4I7NA 3HH3A 155LA 1CU6A 1L16A 2OE9X 4ARMA 2HULA 1L39A 1P6YA 4I7OA 3SBBC 138LA 3OE6A 158LA 3V2WA 1L0JA 160LA 1L13A 1L38A 1L51A 4OO9A 1C63A 249LA 1LPYA 3DN2A 1T8GA 1PQJA 4W57A 227LA 232LA 2O7AA 1CVKA 238LA 1CTWA 1L93A 2HUKA 1L81A 1QT7A 165LA 1SSWA 1QSQA 1L15A 1L72A 151LA 4EKRA 2OTZX 3HH4A 3GUKA 161LA 1L22A 1L37A 1C66A 1L68A 1L02A 1CV6A 1L21A 1ZURA 123LA 1L17A 143LA 252LA 2OTYX 1LYIA 1L61A 260LA 145LA 1OWZA 169LA 1L94A 1QT6A 1CU3A 3OE0A 3GUJA 1PQKA 3G3VA 1OV5A 1ZYTA 4I7SA 3PDSA 1P37A 1PQMA 4DJHA 1T8FA 1L86A 1L26A 2QB0B 2B6TA 1JTNA 3HUQA 1C60A 1C68A 3C80A 1P2RA 1L31A 4LDEA 1OV7A 220LA 130LA 1L34A 183LA 206LA 262LA 4YXAC 3HT9A 4DKLA 199LA 3V2YA 245LA 2ANXA 216LA 2Z6BA 1L0KA 171LA 1L36A 222LA 224LA 4W51A 3C81A 1L35A 234LA 166LA 2RBQA 131LA 1LI3A 159LA 1I6SA 4W52A 122LA 1P56A 168LA 1QT3A 149LA 1L76A 1L18A 4PK0A 2RAZX 1QTHA 261LA 253LA 1CX6A 3HTBA 3HT8A 2B75A 170LA 3HDFA 251LA 1G1WA 1CUQA 214LA 1QS5A 4ZPUA 3DN4A 1L70A 1D3JA 1L09A 3DMZA 5LZMA 156LA 4ARLA 4DAJA 4LZMA 3OE8A 1L62A 1L12A 228LA 1KW7A 4W56A 3HT6A 102LA 1L11A 3HWLA 1L92A 3C8RA 3L2XA 188LA 1CV1A 1L58A 1L50A 1L67A 1D9WA 146LA 140LA 3G3WA 1L24A 1G0KA 1QUDA 3VW7A 1SWYA 1L97A 1L28A 1QT5A 2Q9EA 112LA 1XJUA 4W53A 172LA 4I7LA 175LA 182LA 1SX7A 3DN6A 3GUMA 2HUMA 128LA 1L87A 2RBPA 3DMVA 3OE9A 1LGXA 1CV3A 176LA 1L83A 5I14A 3CDTA 1L82A 125LA 225LA 1CU5A 1P5CA 167LA 1SSYA 197LA 2F47A 1L69A 1L66A 4GRVA 2OE4X 254LA 1CV4A 104LA 3FADA 1C6MA 1L32A 1G1VA 1CU0A 3C8SA 3HTFA 2OEAX 1DYFA 1L40A 4EKSA 237LA 2B6YA 3HT7A 4I7PA 3SB8A 213LA 3RZEA 242LA 186LA 3SB7A 1L14A 137LA 1L96A 2F2QA 1C65A 2OE7X 109LA 1C6IA 215LA 1C6TA 1KNIA 3CDQA 6LZMA 1QUHA 3DN0A 1L19A 3GUPA 4I7MA 2L78A 200LA 217LA 1D2YA 1L08A 1CUPA 2OU9A 209LA 115LA 164LA 230LA 127LA 1SWZA 4EKQA 110LA 2RB1X 2F32A 1L75A 2RBOA 184LA 1L55A 1QUOA 178LA 255LA 1LWKA 1L30A 1T8AA 3RUNA 1D3MA 2RBRA 3NY8A 4E97A 1LW9A 144LA 1L01A 2RB2X 1LWGA 1QTZA 129LA 174LA 108LA 3DMXA 2NTGA 1L27A 1L64A 218LA 1LYHA 1NHBA 119LA 1G07A 1QTDA 1L29A 1T6HA 103LA 1LLHA 1L00A 1L05A 259LA 196LA 2B72A 1C6KA 3DN8A 3HU9A 163LA 1DYGA 1EPYA 1P64A 236LA 198LA 1C6FA 1C67A 173LA 243LA 1L89A 3L64A 1OVJA 1LI2A 1L52A 1C6QA 1LI6A 233LA 4W55A 1L56A 1LYJA 148LE 1L44A 4YX7C 1L71A 3C7YA 3NY9A 4W59A 248LA 3HU8A 4ARJA 4I7KA 1CV5A 1L80A 235LA 1G06A 1OVKA 1L07A 4YXCA 3UONA 111LA 1L65A 1KW5A 1L04A 3HDEA 219LA 4ARPA 3HUAA 1L99A 4S0WA 114LA 226LA 2IGCA 1LGWA 3K2RA 1OVHA 1L77A 229LA 2ANVA 1C6LA 1KS3A 1C6PA 1L90A 190LA 4PJZA 3QAKA 3SB5A 1L60A 1L53A 3FI5A 2RH1A 185LA 1PQDA 1C6AA 1QTBA 1L48A 1JQUA 4AQNA 1C6DA 1LYEA 3JR6A 3HTGA 244LA 3DKEX 231LA 3GUIA 4K5YA 1L10A 4EPIA 4ARQB 1QSBA 1DYDA 1G0PA 1L03A 139LA 4ARMB 1QS9A 2LCBA 1OWYA 1CV0A 180LA 3F9LA 1C61A 1LGUA 1P2LA 3SBAA 3LZMA 118LA 2B6WA 4IAPA 2CUUA 1L43A 3HH5A 1C6NA 1P7SA 4I7JA 1D2WA 1L84A 4EXMA 1DYBA 2O79A 201LA 3ODUA 2Q9DA 1P36A 1L85A 3D4SA 223LA 1DYCA 1C6EA 240LA 1L47A 2O4WA 3GULA 4W58A 256LA 3CDVA 1QT8A 147LA 3C7WA 3C83A 3C7ZA 3GUOA 2B74A 3HUKA 7LZMA 1C6GA 2B7XA 1LYDA 1C62A 2B6XA 2RBNA 2LZMA 1TLAA 141LA 1L88A 3EMLA 4LDLA 1L45A 1XJTA 205LA 1PQOA 3DN1A 241LA 1L59A 1XEPA 1KY1A 1L95A 1L46A 187LA 2RAYX 3SN6R 1L54A 1G0LA 246LA 2B70A 1D3FA 1KY0A 195LA 1WTHA 1G0MA 4GBRB 1CU2A 1L73A 113LA 1C6BA 3F8VA 2B73A 3SB6A 2LC9A 1L20A 1G0GA 3CDRA 1C6HA 150LA 107LA 3SB9A 1L74A 4W54A 120LA 157LA 1OYUA 4LDOA 4EPFA 2RBSA 3HH6A 258LA 177LA 191LA 4I7RA 1QTVA 1PQIA 1ZWNA 212LA 1L91A 1C6CA 1LYGA 250LA 152LA 181LA 3G3XA 1L06A 1QTCA 1L23A 257LA 1QT4A 3PBLA 1T97A 1DYEA 162LA 1JTMA 1P3NA 1L25A 3NYAA 2QARC 210LA 1SX2A 192LA 126LA 1L49A 4I7QA 1G0QA 1L79A 2OU8A 1P46A 3C8QA 1L42A 239LA 1L33A 3C82A 1LYFA 4EKPA 247LA 1D3NA
chains in the Genus database with same CATH superfamily
2XJWA 1OUJA 3DNAA 3AW6A 4GLVA 2EIZC 2A4TA 3N9CA 1DYAA 4O34A 1QUGA 1B6IA 1XGQC 5D5CA 1LCNA 4NGKA 2RB0X 4NHSA 1L57A 1NBZC 3HH3A 155LA 207LA 2OE9X 1UIBA 2ZILA 3TXHA 4I7OA 4XJFA 1L0JA 6LYZA 1L38A 1E8LA 1QDRA 1LPYA 3DN2A 5LA5A 4W57A 3WVXA 1UA6Y 3TXDA 3B0KA 4GN4A 1GE0A 1B5UA 2YBMA 3BKHA 5II3A 1LYZA 1QSQA 1BVXA 1L72A 4EKRA 3HH4A 1BB7A 2MEIA 1L22A 1L37A 1JTOL 4ZEEA 4NSHA 5F81A 4HJVA 3TXEA 4XJDA 1QT6A 1VATA 1LJ3A 3W6DA 4WM1A 1LTMA 1PQMA 4DJHA 1T8FA 4TSBA 1VFBC 1RJCB 4H9AA 2QB0B 1P2RA 4NY5A 1L31A 3QE8A 1OV7A 1GB7A 3WVYA 4TSCA 1I56A 4HP0A 5B06A 1LZ8A 1REMA 2H5ZA 3M18B 199LA 3A34A 4RW1A 1KIRC 2Z6BA 1JEFA 171LA 2Z2EA 1SQ2L 234LA 2RBQA 3N9EA 1OUDA 5B05A 1XFPL 159LA 1BHZA 5E9RA 122LA 3HFMY 134LA 1L76A 1IC5Y 4H8YA 261LA 1OQMA 4DD1A 1GF9A 4GCDA 4J1AA 1NF5A 214LA 1JUGA 1L70A 1D3JA 1WQNA 3HBDA 1L09A 4XYYA 4GLAA 156LA 4M6DA 4LFPA 4DDBA 4CJ2A 1CKHA 3AZ4A 5KXPA 5DM9A 3EBAB 1LHLA 1YKXX 5DN5A 1KW7A 3FI7A 102LA 1HMLA 1L11A 4ET8A 4CHXA 1DQJC 1CJ7A 4OWAA 188LA 5B1FA 3CB7A 1AT6A 2CDSA 3G3WA 1GB3A 4YEOA 5B1GA 3VW7A 1MELL 3EO5A 4NGJA 1L97A 5LAFA 1BB5A 1O23A 1XJUA 175LA 1HMKA 3GUMA 1LAAA 4ETCA 1L87A 2RBPA 5LAGA 4KL7A 3MGWA 5I54A 4C5FA 1SSYA 197LA 5C6LA 4GRVA 104LA 1B2KA 1GB2A 3FADA 1LYOA 1JSEA 2YVBA 154LA 2B6YA 4I7PA 1UC0A 3RZEA 5A3EA 1FKQA 1LHJA 1EQ4A 1GBOA 1JISA 4IJ4A 1WVUA 1XSFA 2W1MA 1L19A 1I20A 2ZQ4A 1JTPL 1LMNA 217LA 4KPMA 5C6JA 209LA 164LA 127LA 1F6RA 5IELA 4LYOA 1YQVY 1G7LC 2BPUA 4PRQA 4BS7A 153LA 1GFEA 4H91A 1KXWA 1L30A 1T8AA 1IC7Y 1YKZX 2D4KA 3NY8A 4E97A 4J7VA 144LA 4R6CA 4H9BA 1LMCA 4NEBA 1XGRC 1NHBA 119LA 3RT5X 1G07A 1L29A 1GE1A 2CWIA 1LLHA 1L00A 5F14A 1LJKA 3HU9A 2I25L 1DYGA 3A67Y 3A6BY 1NQIA 236LA 1JJ1A 4WOAA 1L89A 1B5ZA 1OVJA 1GB0A 4WLXA 1C6QA 1LZ6A 2Z18A 4WO9A 5L9JA 1L71A 4Z98A 4LYTA 3B0IA 3C7YA 3A3RX 1D9UA 248LA 3HU8A 2ZQ3A 1OVKA 4WL6A 1G7MC 9LYZA 3UONA 5KXWA 1LHMA 4B1AA 1FLQA 1JPOA 4NGZA 1JJ3A 2IGCA 1LPIA 1OVHA 1L77A 4LYCA 1VDQA 3B72A 1LZNA 190LA 4PJZA 1L60A 2I26L 1UCOA 1GFTA 1L48A 1IWXA 3LN2A 4AQNA 1JJ0A 4YEMA 1RCMA 244LA 3DKEX 1LKRA 3GUIA 4B0DA 1B7SA 4EPIA 1L03A 4B4EA 3HBHA 2YBHA 1DI3A 1OWYA 1GFJA 4OWCA 1P2LA 3LZMA 1GXV2 1D2WA 4EXMA 1TBYA 1HC0A 1XEKA 2Q9DA 1P36A 1TCYA 2Z12A 2Z2FA 1LZEA 2A7DA 240LA 1HEWA 4OWBA 1H6MA 4N1EI 1TEWA 1IO5A 7LZMA 1C6GA 2CJLA 2B6XA 3P65A 1IR8A 1GB6A 1IORA 1KY1A 1L95A 2EPEA 4W96A 3T36A 1OUFA 1LZ5A 1C6BA 132LA 1WTNA 3F8VA 1G7JC 2B73A 4WM4A 4UWNA 5APCA 2DQEY 1G0GA 3CDRA 150LA 2Z38A 3N9AA 1DKKA 2MEGA 1B5VA 1LMQA 4PRUA 191LA 1BVKC 1GB5A 3WPLA 5JENB 1JKBA 4OOTA 1IWZA 5KXOA 1QSAA 1L06A 1QTCA 257LA 1GFKA 208LA 1D0MA 162LA 1L25A 210LA 3IJVA 1L49A 4I7QA 2FBBA 1L79A 2OU8A 1P46A 4OWHA 5LXWA 3C82A 4EKPA 2X0AA 2Z19A 3DN3A 1GAZA 2DQAA 2OU0X 221LA 1CX7A 1HEPA 1G0JA 4H93A 1UIDA 1C69A 3FA0A 3CT5A 3AGGG 4QEQA 1QTKA 5LVGA 1CU6A 4R0FA 1IOSA 5KXMA 1WQRA 1P6YA 3SBBC 1LZAA 5J7CA 158LA 3AZ6A 2Z37A 5KXKA 3IWRA 5E4PA 1HNLA 2F2NA 1XEIA 249LA 2H9KA 5HMJA 4XN6A 5KXZA 232LA 1CTWA 1L93A 1HELA 2BAAA 2HUKA 5I4XA 4NWEA 5DL9A 1QT7A 2YDGA 1BB4A 4HPEA 2LZ2A 2OTZX 1IOQA 1LMOA 161LA 2BLXA 1CV6A 1L21A 3WYHA 4EMNA 4B4IA 143LA 1F0WA 1IR9A 3KAMA 1ZMYL 1LYIA 1L61A 1UBZA 1AKIA 1L94A 1YAOA 193LA 1CU3A 4NG1A 3G3VA 1HEOA 1L86A 1GDXA 3HUQA 3C80A 1NDGC 220LA 130LA 183LA 1IWVA 1GBXA 2W1LA 262LA 1V7SA 4YXAC 4DKLA 3RU5A 245LA 1QUTA 3A95A 5FEKA 3WW5A 2ANXA 216LA 4WM2A 2Z39A 2W1YA 4QY9A 224LA 4W51A 2IHLA 1QTEA 2C8OA 5I4YA 1C45A 3P4ZA 1T3PA 131LA 1LZ1A 4G4CA 1LMAA 1B0DA 3E3DA 4W52A 1P56A 2BQKA 1IVMA 1L18A 2RAZX 253LA 1REZA 4RLNA 3HTBA 5HMVA 2B75A 3HDFA 1G1WA 2BQHA 4NHTA 3D9AC 4B4JA 1P2CC 4PGJB 1CKCA 4DAJA 5FDJA 1L12A 228LA 4WLTA 5APFA 4G49A 4W56A 2HEEA 2ZYCA 3RW8A 4I8SA 3C8RA 3L2XA 1L58A 1L50A 1B5WA 1L67A 4GN3A 1D9WA 1D6QA 140LA 1IP6A 1LOZA 1BQLY 1CJ9A 4WL7A 1QT5A 112LA 1DXJA 3A93A 3HBEX 3B6LA 182LA 1CJ6A 3WUNA 8LYZA 2DQIY 2HUMA 3DMVA 3FE0A 1L83A 2DBTA 3CDTA 1L82A 3TMUA 225LA 1P5CA 3ATNA 2F47A 1L66A 1F10A 1KXYA 3TMVA 1G1VA 3C8SA 1INUA 2BQDA 4IATA 4PJ2C 5M1YA 2D91A 1A4VA 1DZBX 3HT7A 4G4BA 4H90A 3SB8A 186LA 1EQEA 2F2QA 1JHLA 2D4IA 215LA 1C6TA 4B49A 4NGLA 1QUHA 3DN0A 2BQJA 200LA 4XADA 1OUGA 1CUPA 4DYGA 3LYOA 2RB1X 2RBOA 178LA 3F6ZA 1BWIA 4DD2A 3OJPA 1LWKA 2RBRA 1VAUA 3ZEKA 1LW9A 4NHPA 2RB2X 1LJNA 4LT3A 1LZCA 1L27A 1FDLY 5LVIA 2IFFY 1T6HA 2BQNA 1C6KA 1W6ZA 1C67A 243LA 1GFUA 4WLDA 1BWJA 4NG8A 1LHIA 1WVVA 5ILCA 1LYJA 4NGVA 5A3ZA 2BQOA 4W59A 5KXXA 4ET9A 1FKVA 1LMPA 235LA 1G06A 1L07A 4YF2A 3WXTA 1LSZA 4YXCA 1LSAA 2H9JA 1AM7A 5LVHA 1KW5A 1LSNA 4HTNA 4XJHA 1C10A 3HUAA 1BGIA 1KIQC 3K2RA 2FBDA 4ZFPA 1C6PA 2B5ZA 4DD7A 3QAKA 2BQCA 1PQDA 4DDCA 1C6AA 1IP5A 1QTBA 1JQUA 3JR6A 3HTGA 1GFAA 231LA 1REXA 1HEQA 3WH1A 139LA 1LSCA 3LZ2A 3WL2A 3A92A 1NKHA 1LMTA 1C61A 3SBAA 1IP7A 1OP9B 1J1OY 3WUAA 118LA 1GF0A 2B6WA 4IAPA 4QDNA 4I7JA 4C3WA 5LYZA 1DPXA 201LA 1LJFA 4NSJA 2F30A 2HEAA 1DYCA 5LIOA 1VDPA 1J1XY 1L47A 3WU8A 1QT8A 2HEFA 147LA 3C7WA 3C83A 3GUOA 2B7XA 2DQCY 7LYZA 1JKDA 141LA 4LDLA 4CFOA 1PQOA 1KXXA 1B7OA 1L46A 187LA 4OW1A 5B59A 1L54A 1G0LA 246LA 2B70A 1D3FA 1B7MA 1ZVYB 3OK0A 2MEHA 1L73A 113LA 1IC4Y 1GFGA 1SLYA 1C6HA 1D0LA 3A3QA 5KXRA 157LA 5KY1A 258LA 4I7RA 1LZDA 1QTVA 1LZ9A 5HNCA 1LYGA 4BADA 4H9EA 3G3XA 2YSSC 4GCBA 4HJZA 1JTMA 1P3NA 3NYAA 2QARC 5APEA 192LA 2G4PA 1G0QA 1HFXA 1GDWA 1L33A 2EQLA 3A8ZA 5KXTA 3CDOA 2LYZA 1C64A 211LA 1K28A 4NFVA 4I7TA 3HTDA 5LYMA 1IWTA 189LA 1L98A 2ZNWY 1C6JA 1L63A 1L41A 1LJJA 1GWDA 4H9IA 1L16A 4AXTA 3LZTA 2HULA 2DQHY 1L39A 3OE6A 3EMSA 5LVKA 160LA 1L51A 4I0CA 1C63A 4XJIA 1PQJA 227LA 2HEBA 2O7AA 5APDA 5FSTA 1CVKA 1IP1A 2ZYPA 1LHHA 1L81A 3D3DA 1C7PA 1IP2A 1VDSA 4ETBA 5IDDA 1BB3A 1DKJA 1MLCE 1DPWA 1JSFA 151LA 1YL1X 4BAFA 2YBJA 2DKVA 1ZURA 5I4WA 5FCPA 4RDSA 1QQYA 5C6IA 3T6UA 5LA8A 145LA 1OWZA 1GFVA 3OE0A 3AYQA 4H9HA 3PDSA 2BQGA 2B6TA 5L3IA 1B7PA 4UWUA 206LA 4LZTA 4OWEA 3HT9A 1GFRA 3J6KA 1JKCA 2AUBA 1IX0A 1L0KA 222LA 4NGOA 3C81A 4II8A 4X3BA 1IOCA 5L3HA 1LKSA 1C08C 3TMWA 4NWHA 1AT5A 4DC4A 2ZIKA 1I6SA 4N5RA 4N1CC 4PK0A 1IWUA 1QTHA 1CKDA 4WO6A 251LA 1UIEA 1QS5A 3AGIA 2BQIA 2Y8PA 3DN4A 4DWXA 3DMZA 5LZMA 3OE8A 1L62A 1FN5A 3TMXA 4YENA 1DI5A 2XBRA 3HT6A 5I53A 5T3FA 3P64A 3G3AB 1FLUA 2BQBA 5DN4A 5KXSA 1L24A 1G0KA 1LJ4A 1YILA 1IIZA 172LA 4I7LA 1SX7A 1GB8A 3OE9A 1CV3A 176LA 4WM3A 4D9ZA 1LSBA 1CU5A 167LA 1L69A 4DDAA 2OE4X 254LA 1C6MA 1XGTC 1L32A 2FYCA 3CSQA 4IASA 4EKSA 2NWDX 213LA 242LA 1OUIA 4GCCA 1GF7A 5D5FA 3W6FA 3WPKA 4U3XB 3SB7A 3WPJA 137LA 4LT0A 109LA 1C6IA 1G7HC 3RZ4A 3CDQA 1HFYA 4TUNA 4EOFA 1LZGA 4I7MA 2L78A 2MEEA 3AB6A 4NGYA 5LINA 1JIYA 2HEDA 2OU9A 3A91A 115LA 1VDTA 230LA 1LZ4A 1SWZA 1LYYA 4N0JA 4EKQA 2DQDY 4RLMA 2HUBA 1L55A 1LZYA 1GBSA 3RUNA 1D3MA 3WUMA 3G3BB 1L01A 1NWGA 1LWGA 1QTZA 129LA 4NHIA 1OUAA 3DMXA 2NTGA 3AZ7A 4G9SA 1YANA 4GCEA 1LYHA 1FLYA 1QTDA 1QIOA 1L05A 2B72A 1GEZA 4H8XA 5I5QA 1RE2A 1JTTL 1EPYA 3CSRA 4Z3MA 198LA 4L41A 1C6FA 1PZYA 3TXKA 1L52A 4W55A 1L56A 3BKVA 1L44A 4YX7C 4BAPA 2F4AA 1ZV5L 3NY9A 1LJIA 1OUEA 2DQJY 1B5XA 4ARJA 1CV5A 4DQ5A 1IR7A 4H9CA 2GV0A 4DQ7A 2XQOA 3CT0A 1JWRA 3CSZA 111LA 1L65A 2BQAA 3LHMA 1FLWA 3HDEA 3WXUA 3AW7A 3GXRA 1YAPA 1HFZA 219LA 4ARPA 1L99A 2BQEA 4S0WA 1F6SA 4CFPA 1B7QA 1AZFA 1B7RA 2ANVA 1C6LA 1KS3A 2I6ZA 1LSGA 1L90A 4DQJA 3SB5A 3FI5A 1LJHA 4DD9A 1IOTA 3A90A 185LA 1ZVHL 3TXIA 1C6DA 3ATOA 2ZIJA 4K5YA 1L10A 4UWVA 1DYDA 1CKGA 2LYOA 1QS9A 4GCFA 3F9LA 1HERA 4HV1A 5LYTA 1L43A 1C6NA 1WQOA 1DYBA 1GAYA 2DQFC 4WG1A 4TX7A 3ODUA 1B9OA 1YL0X 1GB9A 3D4SA 3W6EA 223LA 1YKYX 3K3TA 4YM8A 3SP3A 1HSWA 3GULA 3WMKA 1LSMA 3QNGA 256LA 3CDVA 3VWOA 3C7ZA 3HUKA 1LYDA 1C62A 1YAQA 2LZMA 1TLAA 1L88A 3EMLA 1XJTA 4LYMA 3DN1A 2BQMA 1V7TA 3P68A 1XEPA 1LZBA 3SN6R 1HHLA 1VEDA 2XTHA 195LA 1WTHA 1J1PY 4NGIA 1B7LA 1C46A 2MEFA 2LC9A 1BWHA 3ZVQA 1QDTA 1XGPC 2G4NA 4WM5A 1D0KA 2A7FA 3TXGA 3SB9A 1GF6A 1L74A 5DLAA 4LDOA 3CQLA 4EPFA 2RBSA 1EQ5A 177LA 1ZWNA 3AZ5A 181LA 1WQPA 4N8ZA 4ANRA 5KXNA 1L23A 1LJGA 4DT3A 1T97A 1LJEA 1GE4A 1OUHA 126LA 4XENA 4RW2A 1REYA 3C8QA 2D6BA 1D6PA 239LA 4E3UA 1LYFA 1D3NA 4P2EA 4NGWA 1JITA 1UIFA 2NTHA 3WU9A 4EJ4A 4LT2A 4Z41A 5HQ1A 3GUNA 4LYBA 3TXFA 2BQFA 1PS5A 142LA 4YOPA 2B6ZA 4ARQA 4Z46A 4I7NA 1DI4A 1XGUC 4ARMA 2LHMA 4LT1A 4XJGA 138LA 1B7NA 3V2WA 1GFHA 1L13A 4OO9A 5FELA 1T8GA 3W6AA 238LA 5K7OA 4CGEA 1LHKA 3CT1A 165LA 1SSWA 4MSTA 1L15A 1JKAA 1OUCA 5F9XA 3GUKA 1C66A 1L68A 5KXLA 1L02A 4WM6A 3A94A 123LA 1L17A 252LA 2OTYX 4ZIXA 4WG7A 1GF3A 260LA 1G7IC 133LA 1B5YA 169LA 3GUJA 4KT3A 1PQKA 3WW6A 1OV5A 1Z55A 1ZYTA 4I7SA 1P37A 1YAMA 6LYTA 1HF4A 1L26A 1GF8A 1JTNA 1C60A 1C68A 1GF4A 2HU3A 2CGIA 4J1BA 4LDEA 1L34A 5KXYA 194LA 3V2YA 5KKJA 3LYZA 1NMMA 3RNXA 4KXIA 1L36A 1WTMA 1GBWA 4LFXA 1L35A 2HU1A 166LA 1LI3A 4NSGA 1LSDA 1UUZC 168LA 1QT3A 149LA 4G4HA 1GF5A 2MEAA 1GBYA 1CX6A 3HT8A 2G4QA 170LA 1CUQA 4HSFA 4ZPUA 4HJYA 3LYMA 4ARLA 4LZMA 3W6BA 3B0OA 1IEEA 3TXJA 4W94A 1LYSA 3HWLA 1L92A 1BB6A 1CV1A 4OOOA 1QUSA 4ML7A 3A6CY 4GN5C 146LA 3WULA 5AMYA 1QUDA 1SWYA 1GPQC 5KJ9A 1L28A 4FJRA 2Q9EA 5KKIA 4W53A 5B07A 3DN6A 2LYMA 1TAYA 128LA 1UICA 4HTQA 1WQQA 3TXBA 2BLYA 1LGXA 5I14A 125LA 3IJUA 4ETAA 1CV4A 4DD3A 2XBSA 3P66A 1CU0A 3HTFA 2OEAX 1DYFA 1L40A 237LA 2D4JA 4H94A 4A7DA 1UIAA 1L14A 1W08A 1L96A 1HSXA 1OUBA 1RFPA 3ULRA 1C65A 2ZNXY 2OE7X 4LYZA 1KNIA 1RI8B 2EKSC 4QGZA 6LZMA 1YIKA 2HTXA 1FBIX 3GUPA 1D2YA 1CNSA 1L08A 1KIPC 5EBHA 110LA 2F32A 1L75A 184LA 1LZRA 1GEVA 1QUOA 2WARA 3J4GA 1GBZA 255LA 1YROA 2DQGY 1GD6A 2ZWBA 1GE3A 4MR1A 1GE2A 5F9UA 174LA 4J0LA 108LA 1L64A 218LA 5IHGA 1LZSA 1XEJA 1H87A 103LA 4LGKA 4H9FA 135LA 259LA 2MECA 196LA 3DN8A 1QSWA 1TDYA 3M3UA 163LA 1P64A 173LA 2W1XA 3L64A 1LI2A 1IY3A 3ZVQB 1LI6A 233LA 148LE 1GXXA 4WMGA 5FHWA 3W6CA 4I7KA 1L80A 3WU7A 4XJBA 4TWSA 4HPIA 3AGHA 1L04A 1T6VL 1C43A 4PHIA 1CJ8A 1HEMA 2YBNA 114LA 226LA 1LGWA 1UIHA 229LA 1EL1A 4NHQA 1NHEA 4NIJA 2C8PA 2LZTA 1L53A 2RH1A 1UACY 1LYEA 4ARQB 5ILFA 1QSBA 1G0PA 4AGAA 4ARMB 5F16A 2Q0MX 3A96A 2LCBA 1CV0A 180LA 4NSIA 1LGUA 2F4GA 1IY4A 1LSPA 2YBIA 2CUUA 3HH5A 1P7SA 1L84A 2O79A 2HECA 4HTKA 2PC2A 2YBLA 4MCKA 1L85A 1IP4A 4ETEA 1LZTA 1IP3A 2N5ZA 4N9RA 1HENA 4ETDA 1C6EA 2O4WA 1NBYC 3W3EA 4W58A 1IWWA 2FYDA 1IWYA 1LSFA 2B74A 1LSEA 2RBNA 5LVJA 2MEBA 4TTDA 1L45A 205LA 1I1ZA 4H1PA 241LA 1ALCA 1L59A 2MEDA 2RAYX 1KY0A 1G0MA 1UIGA 5HLLA 4GBRB 1CU2A 1A2YC 4PPOA 1N4FA 4H92A 3SB6A 1L20A 3GXKA 3QY4A 3EXDA 1LSYA 107LA 4W54A 120LA 3AJNA 1OYUA 4WLYA 3HH6A 4FDYA 2VB1A 1PQIA 3LYTA 212LA 1L91A 1WQMA 1C6CA 250LA 4M4OA 152LA 4DD0A 4HV2A 2RSCA 1QT4A 3PBLA 1DYEA 1GHLA 1CKFA 1SX2A 2BQLA 4H8ZA 1NDMC 5HNLA 1L42A 247LA
chains in the Genus database with same CATH topology
2XJWA 1OUJA 3DNAA 3AW6A 4GLVA 2EIZC 2A4TA 3N9CA 1DYAA 4O34A 1QUGA 1B6IA 1XGQC 5D5CA 1LCNA 4NGKA 2RB0X 4NHSA 1L57A 1NBZC 3HH3A 155LA 207LA 2OE9X 1UIBA 2ZILA 3TXHA 4I7OA 4XJFA 1L0JA 6LYZA 1L38A 1E8LA 1QDRA 1LPYA 3DN2A 5LA5A 4W57A 3WVXA 1UA6Y 3TXDA 3B0KA 4GN4A 1GE0A 1B5UA 2YBMA 3BKHA 5II3A 1LYZA 1QSQA 1BVXA 1L72A 4EKRA 3HH4A 1BB7A 2MEIA 1L22A 1L37A 1JTOL 4ZEEA 4NSHA 5F81A 4HJVA 3TXEA 4XJDA 1QT6A 1VATA 1LJ3A 3W6DA 4WM1A 1LTMA 1PQMA 4DJHA 1T8FA 4TSBA 1VFBC 1RJCB 4H9AA 2QB0B 1P2RA 4NY5A 1L31A 3QE8A 1OV7A 1GB7A 3WVYA 4TSCA 1I56A 4HP0A 5B06A 1LZ8A 1REMA 2H5ZA 3M18B 199LA 3A34A 4RW1A 1KIRC 2Z6BA 1JEFA 171LA 2Z2EA 1SQ2L 234LA 2RBQA 3N9EA 1OUDA 5B05A 1XFPL 159LA 1BHZA 5E9RA 122LA 3HFMY 134LA 1L76A 1IC5Y 4H8YA 261LA 1OQMA 4DD1A 1GF9A 4GCDA 4J1AA 1NF5A 214LA 1JUGA 1L70A 1D3JA 1WQNA 3HBDA 1L09A 4XYYA 4GLAA 156LA 4M6DA 4LFPA 4DDBA 4CJ2A 1CKHA 3AZ4A 5KXPA 5DM9A 3EBAB 1LHLA 1YKXX 5DN5A 1KW7A 3FI7A 102LA 1HMLA 1L11A 4ET8A 4CHXA 1DQJC 1CJ7A 4OWAA 188LA 5B1FA 3CB7A 1AT6A 2CDSA 3G3WA 1GB3A 4YEOA 5B1GA 3VW7A 1MELL 3EO5A 4NGJA 1L97A 5LAFA 1BB5A 1O23A 1XJUA 175LA 1HMKA 3GUMA 1LAAA 4ETCA 1L87A 2RBPA 5LAGA 4KL7A 3MGWA 5I54A 4C5FA 1SSYA 197LA 5C6LA 4GRVA 104LA 1B2KA 1GB2A 3FADA 1LYOA 1JSEA 2YVBA 154LA 2B6YA 4I7PA 1UC0A 3RZEA 5A3EA 1FKQA 1LHJA 1EQ4A 1GBOA 1JISA 4IJ4A 1WVUA 1XSFA 2W1MA 1L19A 1I20A 2ZQ4A 1JTPL 1LMNA 217LA 4KPMA 5C6JA 209LA 164LA 127LA 1F6RA 5IELA 4LYOA 1YQVY 1G7LC 2BPUA 4PRQA 4BS7A 153LA 1GFEA 4H91A 1KXWA 1L30A 1T8AA 1IC7Y 1YKZX 2D4KA 3NY8A 4E97A 4J7VA 144LA 4R6CA 4H9BA 1LMCA 4NEBA 1XGRC 1NHBA 119LA 3RT5X 1G07A 1L29A 1GE1A 2CWIA 1LLHA 1L00A 5F14A 1LJKA 3HU9A 2I25L 1DYGA 3A67Y 3A6BY 1NQIA 236LA 1JJ1A 4WOAA 1L89A 1B5ZA 1OVJA 1GB0A 4WLXA 1C6QA 1LZ6A 2Z18A 4WO9A 5L9JA 1L71A 4Z98A 4LYTA 3B0IA 3C7YA 3A3RX 1D9UA 248LA 3HU8A 2ZQ3A 1OVKA 4WL6A 1G7MC 9LYZA 3UONA 5KXWA 1LHMA 4B1AA 1FLQA 1JPOA 4NGZA 1JJ3A 2IGCA 1LPIA 1OVHA 1L77A 4LYCA 1VDQA 3B72A 1LZNA 190LA 4PJZA 1L60A 2I26L 1UCOA 1GFTA 1L48A 1IWXA 3LN2A 4AQNA 1JJ0A 4YEMA 1RCMA 244LA 3DKEX 1LKRA 3GUIA 4B0DA 1B7SA 4EPIA 1L03A 4B4EA 3HBHA 2YBHA 1DI3A 1OWYA 1GFJA 4OWCA 1P2LA 3LZMA 1GXV2 1D2WA 4EXMA 1TBYA 1HC0A 1XEKA 2Q9DA 1P36A 1TCYA 2Z12A 2Z2FA 1LZEA 2A7DA 240LA 1HEWA 4OWBA 1H6MA 4N1EI 1TEWA 1IO5A 7LZMA 1C6GA 2CJLA 2B6XA 3P65A 1IR8A 1GB6A 1IORA 1KY1A 1L95A 2EPEA 4W96A 3T36A 1OUFA 1LZ5A 1C6BA 132LA 1WTNA 3F8VA 1G7JC 2B73A 4WM4A 4UWNA 5APCA 2DQEY 1G0GA 3CDRA 150LA 2Z38A 3N9AA 1DKKA 2MEGA 1B5VA 1LMQA 4PRUA 191LA 1BVKC 1GB5A 3WPLA 5JENB 1JKBA 4OOTA 1IWZA 5KXOA 1QSAA 1L06A 1QTCA 257LA 1GFKA 208LA 1D0MA 162LA 1L25A 210LA 3IJVA 1L49A 4I7QA 2FBBA 1L79A 2OU8A 1P46A 4OWHA 5LXWA 3C82A 4EKPA 2X0AA 2Z19A 3DN3A 1GAZA 2DQAA 2OU0X 221LA 1CX7A 1HEPA 1G0JA 4H93A 1UIDA 1C69A 3FA0A 3CT5A 3AGGG 4QEQA 1QTKA 5LVGA 1CU6A 4R0FA 1IOSA 5KXMA 1WQRA 1P6YA 3SBBC 1LZAA 5J7CA 158LA 3AZ6A 2Z37A 5KXKA 3IWRA 5E4PA 1HNLA 2F2NA 1XEIA 249LA 2H9KA 5HMJA 4XN6A 5KXZA 232LA 1CTWA 1L93A 1HELA 2BAAA 2HUKA 5I4XA 4NWEA 5DL9A 1QT7A 2YDGA 1BB4A 4HPEA 2LZ2A 2OTZX 1IOQA 1LMOA 161LA 2BLXA 1CV6A 1L21A 3WYHA 4EMNA 4B4IA 143LA 1F0WA 1IR9A 3KAMA 1ZMYL 1LYIA 1L61A 1UBZA 1AKIA 1L94A 1YAOA 193LA 1CU3A 4NG1A 3G3VA 1HEOA 1L86A 1GDXA 3HUQA 3C80A 1NDGC 220LA 130LA 183LA 1IWVA 1GBXA 2W1LA 262LA 1V7SA 4YXAC 4DKLA 3RU5A 245LA 1QUTA 3A95A 5FEKA 3WW5A 2ANXA 216LA 4WM2A 2Z39A 2W1YA 4QY9A 224LA 4W51A 2IHLA 1QTEA 2C8OA 5I4YA 1C45A 3P4ZA 1T3PA 131LA 1LZ1A 4G4CA 1LMAA 1B0DA 3E3DA 4W52A 1P56A 2BQKA 1IVMA 1L18A 2RAZX 253LA 1REZA 4RLNA 3HTBA 5HMVA 2B75A 3HDFA 1G1WA 2BQHA 4NHTA 3D9AC 4B4JA 1P2CC 4PGJB 1CKCA 4DAJA 5FDJA 1L12A 228LA 4WLTA 5APFA 4G49A 4W56A 2HEEA 2ZYCA 3RW8A 4I8SA 3C8RA 3L2XA 1L58A 1L50A 1B5WA 1L67A 4GN3A 1D9WA 1D6QA 140LA 1IP6A 1LOZA 1BQLY 1CJ9A 4WL7A 1QT5A 112LA 1DXJA 3A93A 3HBEX 3B6LA 182LA 1CJ6A 3WUNA 8LYZA 2DQIY 2HUMA 3DMVA 3FE0A 1L83A 2DBTA 3CDTA 1L82A 3TMUA 225LA 1P5CA 3ATNA 2F47A 1L66A 1F10A 1KXYA 3TMVA 1G1VA 3C8SA 1INUA 2BQDA 4IATA 4PJ2C 5M1YA 2D91A 1A4VA 1DZBX 3HT7A 4G4BA 4H90A 3SB8A 186LA 1EQEA 2F2QA 1JHLA 2D4IA 215LA 1C6TA 4B49A 4NGLA 1QUHA 3DN0A 2BQJA 200LA 4XADA 1OUGA 1CUPA 4DYGA 3LYOA 2RB1X 2RBOA 178LA 3F6ZA 1BWIA 4DD2A 3OJPA 1LWKA 2RBRA 1VAUA 3ZEKA 1LW9A 4NHPA 2RB2X 1LJNA 4LT3A 1LZCA 1L27A 1FDLY 5LVIA 2IFFY 1T6HA 2BQNA 1C6KA 1W6ZA 1C67A 243LA 1GFUA 4WLDA 1BWJA 4NG8A 1LHIA 1WVVA 5ILCA 1LYJA 4NGVA 5A3ZA 2BQOA 4W59A 5KXXA 4ET9A 1FKVA 1LMPA 235LA 1G06A 1L07A 4YF2A 3WXTA 1LSZA 4YXCA 1LSAA 2H9JA 1AM7A 5LVHA 1KW5A 1LSNA 4HTNA 4XJHA 1C10A 3HUAA 1BGIA 1KIQC 3K2RA 2FBDA 4ZFPA 1C6PA 2B5ZA 4DD7A 3QAKA 2BQCA 1PQDA 4DDCA 1C6AA 1IP5A 1QTBA 1JQUA 3JR6A 3HTGA 1GFAA 231LA 1REXA 1HEQA 3WH1A 139LA 1LSCA 3LZ2A 3WL2A 3A92A 1NKHA 1LMTA 1C61A 3SBAA 1IP7A 1OP9B 1J1OY 3WUAA 118LA 1GF0A 2B6WA 4IAPA 4QDNA 4I7JA 4C3WA 5LYZA 1DPXA 201LA 1LJFA 4NSJA 2F30A 2HEAA 1DYCA 5LIOA 1VDPA 1J1XY 1L47A 3WU8A 1QT8A 2HEFA 147LA 3C7WA 3C83A 3GUOA 2B7XA 2DQCY 7LYZA 1JKDA 141LA 4LDLA 4CFOA 1PQOA 1KXXA 1B7OA 1L46A 187LA 4OW1A 5B59A 1L54A 1G0LA 246LA 2B70A 1D3FA 1B7MA 1ZVYB 3OK0A 2MEHA 1L73A 113LA 1IC4Y 1GFGA 1SLYA 1C6HA 1D0LA 3A3QA 5KXRA 157LA 5KY1A 258LA 4I7RA 1LZDA 1QTVA 1LZ9A 5HNCA 1LYGA 4BADA 4H9EA 3G3XA 2YSSC 4GCBA 4HJZA 1JTMA 1P3NA 3NYAA 2QARC 5APEA 192LA 2G4PA 1G0QA 1HFXA 1GDWA 1L33A 2EQLA 3A8ZA 5KXTA 3CDOA 2LYZA 1C64A 211LA 1K28A 4NFVA 4I7TA 3HTDA 5LYMA 1IWTA 189LA 1L98A 2ZNWY 1C6JA 1L63A 1L41A 1LJJA 1GWDA 4H9IA 1L16A 4AXTA 3LZTA 2HULA 2DQHY 1L39A 3OE6A 3EMSA 5LVKA 160LA 1L51A 4I0CA 1C63A 4XJIA 1PQJA 227LA 2HEBA 2O7AA 5APDA 5FSTA 1CVKA 1IP1A 2ZYPA 1LHHA 1L81A 3D3DA 1C7PA 1IP2A 1VDSA 4ETBA 5IDDA 1BB3A 1DKJA 1MLCE 1DPWA 1JSFA 151LA 1YL1X 4BAFA 2YBJA 2DKVA 1ZURA 5I4WA 5FCPA 4RDSA 1QQYA 5C6IA 3T6UA 5LA8A 145LA 1OWZA 1GFVA 3OE0A 3AYQA 4H9HA 3PDSA 2BQGA 2B6TA 5L3IA 1B7PA 4UWUA 206LA 4LZTA 4OWEA 3HT9A 1GFRA 3J6KA 1JKCA 2AUBA 1IX0A 1L0KA 222LA 4NGOA 3C81A 4II8A 4X3BA 1IOCA 5L3HA 1LKSA 1C08C 3TMWA 4NWHA 1AT5A 4DC4A 2ZIKA 1I6SA 4N5RA 4N1CC 4PK0A 1IWUA 1QTHA 1CKDA 4WO6A 251LA 1UIEA 1QS5A 3AGIA 2BQIA 2Y8PA 3DN4A 4DWXA 3DMZA 5LZMA 3OE8A 1L62A 1FN5A 3TMXA 4YENA 1DI5A 2XBRA 3HT6A 5I53A 5T3FA 3P64A 3G3AB 1FLUA 2BQBA 5DN4A 5KXSA 1L24A 1G0KA 1LJ4A 1YILA 1IIZA 172LA 4I7LA 1SX7A 1GB8A 3OE9A 1CV3A 176LA 4WM3A 4D9ZA 1LSBA 1CU5A 167LA 1L69A 4DDAA 2OE4X 254LA 1C6MA 1XGTC 1L32A 2FYCA 3CSQA 4IASA 4EKSA 2NWDX 213LA 242LA 1OUIA 4GCCA 1GF7A 5D5FA 3W6FA 3WPKA 4U3XB 3SB7A 3WPJA 137LA 4LT0A 109LA 1C6IA 1G7HC 3RZ4A 3CDQA 1HFYA 4TUNA 4EOFA 1LZGA 4I7MA 2L78A 2MEEA 3AB6A 4NGYA 5LINA 1JIYA 2HEDA 2OU9A 3A91A 115LA 1VDTA 230LA 1LZ4A 1SWZA 1LYYA 4N0JA 4EKQA 2DQDY 4RLMA 2HUBA 1L55A 1LZYA 1GBSA 3RUNA 1D3MA 3WUMA 3G3BB 1L01A 1NWGA 1LWGA 1QTZA 129LA 4NHIA 1OUAA 3DMXA 2NTGA 3AZ7A 4G9SA 1YANA 4GCEA 1LYHA 1FLYA 1QTDA 1QIOA 1L05A 2B72A 1GEZA 4H8XA 5I5QA 1RE2A 1JTTL 1EPYA 3CSRA 4Z3MA 198LA 4L41A 1C6FA 1PZYA 3TXKA 1L52A 4W55A 1L56A 3BKVA 1L44A 4YX7C 4BAPA 2F4AA 1ZV5L 3NY9A 1LJIA 1OUEA 2DQJY 1B5XA 4ARJA 1CV5A 4DQ5A 1IR7A 4H9CA 2GV0A 4DQ7A 2XQOA 3CT0A 1JWRA 3CSZA 111LA 1L65A 2BQAA 3LHMA 1FLWA 3HDEA 3WXUA 3AW7A 3GXRA 1YAPA 1HFZA 219LA 4ARPA 1L99A 2BQEA 4S0WA 1F6SA 4CFPA 1B7QA 1AZFA 1B7RA 2ANVA 1C6LA 1KS3A 2I6ZA 1LSGA 1L90A 4DQJA 3SB5A 3FI5A 1LJHA 4DD9A 1IOTA 3A90A 185LA 1ZVHL 3TXIA 1C6DA 3ATOA 2ZIJA 4K5YA 1L10A 4UWVA 1DYDA 1CKGA 2LYOA 1QS9A 4GCFA 3F9LA 1HERA 4HV1A 5LYTA 1L43A 1C6NA 1WQOA 1DYBA 1GAYA 2DQFC 4WG1A 4TX7A 3ODUA 1B9OA 1YL0X 1GB9A 3D4SA 3W6EA 223LA 1YKYX 3K3TA 4YM8A 3SP3A 1HSWA 3GULA 3WMKA 1LSMA 3QNGA 256LA 3CDVA 3VWOA 3C7ZA 3HUKA 1LYDA 1C62A 1YAQA 2LZMA 1TLAA 1L88A 3EMLA 1XJTA 4LYMA 3DN1A 2BQMA 1V7TA 3P68A 1XEPA 1LZBA 3SN6R 1HHLA 1VEDA 2XTHA 195LA 1WTHA 1J1PY 4NGIA 1B7LA 1C46A 2MEFA 2LC9A 1BWHA 3ZVQA 1QDTA 1XGPC 2G4NA 4WM5A 1D0KA 2A7FA 3TXGA 3SB9A 1GF6A 1L74A 5DLAA 4LDOA 3CQLA 4EPFA 2RBSA 1EQ5A 177LA 1ZWNA 3AZ5A 181LA 1WQPA 4N8ZA 4ANRA 5KXNA 1L23A 1LJGA 4DT3A 1T97A 1LJEA 1GE4A 1OUHA 126LA 4XENA 4RW2A 1REYA 3C8QA 2D6BA 1D6PA 239LA 4E3UA 1LYFA 1D3NA 4P2EA 4NGWA 1JITA 1UIFA 2NTHA 3WU9A 4EJ4A 4LT2A 4Z41A 5HQ1A 3GUNA 4LYBA 3TXFA 2BQFA 1PS5A 142LA 4YOPA 2B6ZA 4ARQA 4Z46A 4I7NA 1DI4A 1XGUC 4ARMA 2LHMA 4LT1A 4XJGA 138LA 1B7NA 3V2WA 1GFHA 1L13A 4OO9A 5FELA 1T8GA 3W6AA 238LA 5K7OA 4CGEA 1LHKA 3CT1A 165LA 1SSWA 4MSTA 1L15A 1JKAA 1OUCA 5F9XA 3GUKA 1C66A 1L68A 5KXLA 1L02A 4WM6A 3A94A 123LA 1L17A 252LA 2OTYX 4ZIXA 4WG7A 1GF3A 260LA 1G7IC 133LA 1B5YA 169LA 3GUJA 4KT3A 1PQKA 3WW6A 1OV5A 1Z55A 1ZYTA 4I7SA 1P37A 1YAMA 6LYTA 1HF4A 1L26A 1GF8A 1JTNA 1C60A 1C68A 1GF4A 2HU3A 2CGIA 4J1BA 4LDEA 1L34A 5KXYA 194LA 3V2YA 5KKJA 3LYZA 1NMMA 3RNXA 4KXIA 1L36A 1WTMA 1GBWA 4LFXA 1L35A 2HU1A 166LA 1LI3A 4NSGA 1LSDA 1UUZC 168LA 1QT3A 149LA 4G4HA 1GF5A 2MEAA 1GBYA 1CX6A 3HT8A 2G4QA 170LA 1CUQA 4HSFA 4ZPUA 4HJYA 3LYMA 4ARLA 4LZMA 3W6BA 3B0OA 1IEEA 3TXJA 4W94A 1LYSA 3HWLA 1L92A 1BB6A 1CV1A 4OOOA 1QUSA 4ML7A 3A6CY 4GN5C 146LA 3WULA 5AMYA 1QUDA 1SWYA 1GPQC 5KJ9A 1L28A 4FJRA 2Q9EA 5KKIA 4W53A 5B07A 3DN6A 2LYMA 1TAYA 128LA 1UICA 4HTQA 1WQQA 3TXBA 2BLYA 1LGXA 5I14A 125LA 3IJUA 4ETAA 1CV4A 4DD3A 2XBSA 3P66A 1CU0A 3HTFA 2OEAX 1DYFA 1L40A 237LA 2D4JA 4H94A 4A7DA 1UIAA 1L14A 1W08A 1L96A 1HSXA 1OUBA 1RFPA 3ULRA 1C65A 2ZNXY 2OE7X 4LYZA 1KNIA 1RI8B 2EKSC 4QGZA 6LZMA 1YIKA 2HTXA 1FBIX 3GUPA 1D2YA 1CNSA 1L08A 1KIPC 5EBHA 110LA 2F32A 1L75A 184LA 1LZRA 1GEVA 1QUOA 2WARA 3J4GA 1GBZA 255LA 1YROA 2DQGY 1GD6A 2ZWBA 1GE3A 4MR1A 1GE2A 5F9UA 174LA 4J0LA 108LA 1L64A 218LA 5IHGA 1LZSA 1XEJA 1H87A 103LA 4LGKA 4H9FA 135LA 259LA 2MECA 196LA 3DN8A 1QSWA 1TDYA 3M3UA 163LA 1P64A 173LA 2W1XA 3L64A 1LI2A 1IY3A 3ZVQB 1LI6A 233LA 148LE 1GXXA 4WMGA 5FHWA 3W6CA 4I7KA 1L80A 3WU7A 4XJBA 4TWSA 4HPIA 3AGHA 1L04A 1T6VL 1C43A 4PHIA 1CJ8A 1HEMA 2YBNA 114LA 226LA 1LGWA 1UIHA 229LA 1EL1A 4NHQA 1NHEA 4NIJA 2C8PA 2LZTA 1L53A 2RH1A 1UACY 1LYEA 4ARQB 5ILFA 1QSBA 1G0PA 4AGAA 4ARMB 5F16A 2Q0MX 3A96A 2LCBA 1CV0A 180LA 4NSIA 1LGUA 2F4GA 1IY4A 1LSPA 2YBIA 2CUUA 3HH5A 1P7SA 1L84A 2O79A 2HECA 4HTKA 2PC2A 2YBLA 4MCKA 1L85A 1IP4A 4ETEA 1LZTA 1IP3A 2N5ZA 4N9RA 1HENA 4ETDA 1C6EA 2O4WA 1NBYC 3W3EA 4W58A 1IWWA 2FYDA 1IWYA 1LSFA 2B74A 1LSEA 2RBNA 5LVJA 2MEBA 4TTDA 1L45A 205LA 1I1ZA 4H1PA 241LA 1ALCA 1L59A 2MEDA 2RAYX 1KY0A 1G0MA 1UIGA 5HLLA 4GBRB 1CU2A 1A2YC 4PPOA 1N4FA 4H92A 3SB6A 1L20A 3GXKA 3QY4A 3EXDA 1LSYA 107LA 4W54A 120LA 3AJNA 1OYUA 4WLYA 3HH6A 4FDYA 2VB1A 1PQIA 3LYTA 212LA 1L91A 1WQMA 1C6CA 250LA 4M4OA 152LA 4DD0A 4HV2A 2RSCA 1QT4A 3PBLA 1DYEA 1GHLA 1CKFA 1SX2A 2BQLA 4H8ZA 1NDMC 5HNLA 1L42A 247LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CDO A;  3DNA A;  1C64 A;  211L A;  2NTH A;  4EJ4 A;  3DN3 A;  2A4T A;  1DYA A;  2OU0 X;  3GUN A;  1K28 A;  1QUG A;  1B6I A;  221L A;  4I7T A;  1CX7 A;  142L A;  3HTD A;  2B6Z A;  1G0J A;  189L A;  2RB0 X;  1L98 A;  1C6J A;  1C69 A;  1L63 A;  3FA0 A;  4ARQ A;  1L57 A;  1L41 A;  4I7N A;  3HH3 A;  155L A;  1CU6 A;  1L16 A;  2OE9 X;  4ARM A;  2HUL A;  1L39 A;  1P6Y A;  4I7O A;  3SBB C;  138L A;  3OE6 A;  158L A;  3V2W A;  1L0J A;  160L A;  1L13 A;  1L38 A;  1L51 A;  4OO9 A;  1C63 A;  249L A;  1LPY A;  3DN2 A;  1T8G A;  1PQJ A;  4W57 A;  227L A;  232L A;  2O7A A;  1CVK A;  238L A;  1CTW A;  1L93 A;  2HUK A;  1L81 A;  1QT7 A;  165L A;  1SSW A;  1QSQ A;  1L15 A;  1L72 A;  151L A;  4EKR A;  2OTZ X;  3HH4 A;  3GUK A;  161L A;  1L22 A;  1L37 A;  1C66 A;  1L68 A;  1L02 A;  1CV6 A;  1L21 A;  1ZUR A;  123L A;  1L17 A;  143L A;  252L A;  2OTY X;  1LYI A;  1L61 A;  260L A;  145L A;  1OWZ A;  169L A;  1L94 A;  1QT6 A;  1CU3 A;  3OE0 A;  3GUJ A;  1PQK A;  3G3V A;  1OV5 A;  1ZYT A;  4I7S A;  3PDS A;  1P37 A;  1PQM A;  4DJH A;  1T8F A;  1L86 A;  1L26 A;  2QB0 B;  2B6T A;  1JTN A;  3HUQ A;  1C60 A;  1C68 A;  3C80 A;  1P2R A;  1L31 A;  4LDE A;  1OV7 A;  220L A;  130L A;  1L34 A;  183L A;  206L A;  262L A;  4YXA C;  3HT9 A;  4DKL A;  199L A;  3V2Y A;  245L A;  2ANX A;  216L A;  2Z6B A;  1L0K A;  171L A;  1L36 A;  222L A;  224L A;  4W51 A;  3C81 A;  1L35 A;  234L A;  166L A;  2RBQ A;  131L A;  1LI3 A;  159L A;  1I6S A;  4W52 A;  122L A;  1P56 A;  168L A;  1QT3 A;  149L A;  1L76 A;  1L18 A;  4PK0 A;  2RAZ X;  1QTH A;  261L A;  253L A;  1CX6 A;  3HTB A;  3HT8 A;  2B75 A;  170L A;  3HDF A;  251L A;  1G1W A;  1CUQ A;  214L A;  1QS5 A;  4ZPU A;  3DN4 A;  1L70 A;  1D3J A;  1L09 A;  3DMZ A;  5LZM A;  156L A;  4ARL A;  4DAJ A;  4LZM A;  3OE8 A;  1L62 A;  1L12 A;  228L A;  1KW7 A;  4W56 A;  3HT6 A;  102L A;  1L11 A;  3HWL A;  1L92 A;  3C8R A;  3L2X A;  188L A;  1CV1 A;  1L58 A;  1L50 A;  1L67 A;  1D9W A;  146L A;  140L A;  3G3W A;  1L24 A;  1G0K A;  1QUD A;  3VW7 A;  1SWY A;  1L97 A;  1L28 A;  1QT5 A;  2Q9E A;  112L A;  1XJU A;  4W53 A;  172L A;  4I7L A;  175L A;  182L A;  1SX7 A;  3DN6 A;  3GUM A;  2HUM A;  128L A;  1L87 A;  2RBP A;  3DMV A;  3OE9 A;  1LGX A;  1CV3 A;  176L A;  1L83 A;  5I14 A;  3CDT A;  1L82 A;  125L A;  225L A;  1CU5 A;  1P5C A;  167L A;  1SSY A;  197L A;  2F47 A;  1L69 A;  1L66 A;  4GRV A;  2OE4 X;  254L A;  1CV4 A;  104L A;  3FAD A;  1C6M A;  1L32 A;  1G1V A;  1CU0 A;  3C8S A;  3HTF A;  2OEA X;  1DYF A;  1L40 A;  4EKS A;  237L A;  2B6Y A;  3HT7 A;  4I7P A;  3SB8 A;  213L A;  3RZE A;  242L A;  186L A;  3SB7 A;  1L14 A;  137L A;  1L96 A;  2F2Q A;  1C65 A;  2OE7 X;  109L A;  1C6I A;  215L A;  1C6T A;  1KNI A;  3CDQ A;  6LZM A;  1QUH A;  3DN0 A;  1L19 A;  3GUP A;  4I7M A;  2L78 A;  200L A;  217L A;  1D2Y A;  1L08 A;  1CUP A;  2OU9 A;  209L A;  115L A;  164L A;  230L A;  127L A;  1SWZ A;  4EKQ A;  110L A;  2RB1 X;  2F32 A;  1L75 A;  2RBO A;  184L A;  1L55 A;  1QUO A;  178L A;  255L A;  1LWK A;  1L30 A;  1T8A A;  3RUN A;  1D3M A;  2RBR A;  3NY8 A;  4E97 A;  1LW9 A;  144L A;  1L01 A;  2RB2 X;  1LWG A;  1QTZ A;  129L A;  174L A;  108L A;  3DMX A;  2NTG A;  1L27 A;  1L64 A;  218L A;  1LYH A;  1NHB A;  119L A;  1G07 A;  1QTD A;  1L29 A;  1T6H A;  103L A;  1LLH A;  1L00 A;  1L05 A;  259L A;  196L A;  2B72 A;  1C6K A;  3DN8 A;  3HU9 A;  163L A;  1DYG A;  1EPY A;  1P64 A;  236L A;  198L A;  1C6F A;  1C67 A;  173L A;  243L A;  1L89 A;  3L64 A;  1OVJ A;  1LI2 A;  1L52 A;  1C6Q A;  1LI6 A;  233L A;  4W55 A;  1L56 A;  1LYJ A;  148L E;  1L44 A;  4YX7 C;  1L71 A;  3C7Y A;  3NY9 A;  4W59 A;  248L A;  3HU8 A;  4ARJ A;  4I7K A;  1CV5 A;  1L80 A;  235L A;  1G06 A;  1OVK A;  1L07 A;  4YXC A;  3UON A;  111L A;  1L65 A;  1KW5 A;  1L04 A;  3HDE A;  219L A;  4ARP A;  3HUA A;  1L99 A;  4S0W A;  114L A;  226L A;  2IGC A;  1LGW A;  3K2R A;  1OVH A;  1L77 A;  229L A;  2ANV A;  1C6L A;  1KS3 A;  1C6P A;  1L90 A;  190L A;  4PJZ A;  3QAK A;  3SB5 A;  1L60 A;  1L53 A;  3FI5 A;  2RH1 A;  185L A;  1PQD A;  1C6A A;  1QTB A;  1L48 A;  1JQU A;  4AQN A;  1C6D A;  1LYE A;  3JR6 A;  3HTG A;  244L A;  3DKE X;  231L A;  3GUI A;  4K5Y A;  1L10 A;  4EPI A;  4ARQ B;  1QSB A;  1DYD A;  1G0P A;  1L03 A;  139L A;  4ARM B;  1QS9 A;  2LCB A;  1OWY A;  1CV0 A;  180L A;  3F9L A;  1C61 A;  1LGU A;  1P2L A;  3SBA A;  3LZM A;  118L A;  2B6W A;  4IAP A;  2CUU A;  1L43 A;  3HH5 A;  1C6N A;  1P7S A;  4I7J A;  1D2W A;  1L84 A;  4EXM A;  1DYB A;  2O79 A;  201L A;  3ODU A;  2Q9D A;  1P36 A;  1L85 A;  3D4S A;  223L A;  1DYC A;  1C6E A;  240L A;  1L47 A;  2O4W A;  3GUL A;  4W58 A;  256L A;  3CDV A;  1QT8 A;  147L A;  3C7W A;  3C83 A;  3C7Z A;  3GUO A;  2B74 A;  3HUK A;  7LZM A;  1C6G A;  2B7X A;  1LYD A;  1C62 A;  2B6X A;  2RBN A;  2LZM A;  1TLA A;  141L A;  1L88 A;  3EML A;  4LDL A;  1L45 A;  1XJT A;  205L A;  1PQO A;  3DN1 A;  241L A;  1L59 A;  1XEP A;  1KY1 A;  1L95 A;  1L46 A;  187L A;  2RAY X;  3SN6 R;  1L54 A;  1G0L A;  246L A;  2B70 A;  1D3F A;  1KY0 A;  195L A;  1WTH A;  1G0M A;  4GBR B;  1CU2 A;  1L73 A;  113L A;  1C6B A;  3F8V A;  2B73 A;  3SB6 A;  2LC9 A;  1L20 A;  1G0G A;  3CDR A;  1C6H A;  150L A;  107L A;  3SB9 A;  1L74 A;  4W54 A;  120L A;  157L A;  1OYU A;  4LDO A;  4EPF A;  2RBS A;  3HH6 A;  258L A;  177L A;  191L A;  4I7R A;  1QTV A;  1PQI A;  1ZWN A;  212L A;  1L91 A;  1C6C A;  1LYG A;  250L A;  152L A;  181L A;  3G3X A;  1L06 A;  1QTC A;  1L23 A;  257L A;  1QT4 A;  3PBL A;  1T97 A;  1DYE A;  162L A;  1JTM A;  1P3N A;  1L25 A;  3NYA A;  2QAR C;  210L A;  1SX2 A;  192L A;  126L A;  1L49 A;  4I7Q A;  1G0Q A;  1L79 A;  2OU8 A;  1P46 A;  3C8Q A;  1L42 A;  239L A;  1L33 A;  3C82 A;  1LYF A;  4EKP A;  247L A;  1D3N A; 
#chains in the Genus database with same CATH topology
 2XJW A;  1OUJ A;  3DNA A;  3AW6 A;  4GLV A;  2EIZ C;  2A4T A;  3N9C A;  1DYA A;  4O34 A;  1QUG A;  1B6I A;  1XGQ C;  5D5C A;  1LCN A;  4NGK A;  2RB0 X;  4NHS A;  1L57 A;  1NBZ C;  3HH3 A;  155L A;  207L A;  2OE9 X;  1UIB A;  2ZIL A;  3TXH A;  4I7O A;  4XJF A;  1L0J A;  6LYZ A;  1L38 A;  1E8L A;  1QDR A;  1LPY A;  3DN2 A;  5LA5 A;  4W57 A;  3WVX A;  1UA6 Y;  3TXD A;  3B0K A;  4GN4 A;  1GE0 A;  1B5U A;  2YBM A;  3BKH A;  5II3 A;  1LYZ A;  1QSQ A;  1BVX A;  1L72 A;  4EKR A;  3HH4 A;  1BB7 A;  2MEI A;  1L22 A;  1L37 A;  1JTO L;  4ZEE A;  4NSH A;  5F81 A;  4HJV A;  3TXE A;  4XJD A;  1QT6 A;  1VAT A;  1LJ3 A;  3W6D A;  4WM1 A;  1LTM A;  1PQM A;  4DJH A;  1T8F A;  4TSB A;  1VFB C;  1RJC B;  4H9A A;  2QB0 B;  1P2R A;  4NY5 A;  1L31 A;  3QE8 A;  1OV7 A;  1GB7 A;  3WVY A;  4TSC A;  1I56 A;  4HP0 A;  5B06 A;  1LZ8 A;  1REM A;  2H5Z A;  3M18 B;  199L A;  3A34 A;  4RW1 A;  1KIR C;  2Z6B A;  1JEF A;  171L A;  2Z2E A;  1SQ2 L;  234L A;  2RBQ A;  3N9E A;  1OUD A;  5B05 A;  1XFP L;  159L A;  1BHZ A;  5E9R A;  122L A;  3HFM Y;  134L A;  1L76 A;  1IC5 Y;  4H8Y A;  261L A;  1OQM A;  4DD1 A;  1GF9 A;  4GCD A;  4J1A A;  1NF5 A;  214L A;  1JUG A;  1L70 A;  1D3J A;  1WQN A;  3HBD A;  1L09 A;  4XYY A;  4GLA A;  156L A;  4M6D A;  4LFP A;  4DDB A;  4CJ2 A;  1CKH A;  3AZ4 A;  5KXP A;  5DM9 A;  3EBA B;  1LHL A;  1YKX X;  5DN5 A;  1KW7 A;  3FI7 A;  102L A;  1HML A;  1L11 A;  4ET8 A;  4CHX A;  1DQJ C;  1CJ7 A;  4OWA A;  188L A;  5B1F A;  3CB7 A;  1AT6 A;  2CDS A;  3G3W A;  1GB3 A;  4YEO A;  5B1G A;  3VW7 A;  1MEL L;  3EO5 A;  4NGJ A;  1L97 A;  5LAF A;  1BB5 A;  1O23 A;  1XJU A;  175L A;  1HMK A;  3GUM A;  1LAA A;  4ETC A;  1L87 A;  2RBP A;  5LAG A;  4KL7 A;  3MGW A;  5I54 A;  4C5F A;  1SSY A;  197L A;  5C6L A;  4GRV A;  104L A;  1B2K A;  1GB2 A;  3FAD A;  1LYO A;  1JSE A;  2YVB A;  154L A;  2B6Y A;  4I7P A;  1UC0 A;  3RZE A;  5A3E A;  1FKQ A;  1LHJ A;  1EQ4 A;  1GBO A;  1JIS A;  4IJ4 A;  1WVU A;  1XSF A;  2W1M A;  1L19 A;  1I20 A;  2ZQ4 A;  1JTP L;  1LMN A;  217L A;  4KPM A;  5C6J A;  209L A;  164L A;  127L A;  1F6R A;  5IEL A;  4LYO A;  1YQV Y;  1G7L C;  2BPU A;  4PRQ A;  4BS7 A;  153L A;  1GFE A;  4H91 A;  1KXW A;  1L30 A;  1T8A A;  1IC7 Y;  1YKZ X;  2D4K A;  3NY8 A;  4E97 A;  4J7V A;  144L A;  4R6C A;  4H9B A;  1LMC A;  4NEB A;  1XGR C;  1NHB A;  119L A;  3RT5 X;  1G07 A;  1L29 A;  1GE1 A;  2CWI A;  1LLH A;  1L00 A;  5F14 A;  1LJK A;  3HU9 A;  2I25 L;  1DYG A;  3A67 Y;  3A6B Y;  1NQI A;  236L A;  1JJ1 A;  4WOA A;  1L89 A;  1B5Z A;  1OVJ A;  1GB0 A;  4WLX A;  1C6Q A;  1LZ6 A;  2Z18 A;  4WO9 A;  5L9J A;  1L71 A;  4Z98 A;  4LYT A;  3B0I A;  3C7Y A;  3A3R X;  1D9U A;  248L A;  3HU8 A;  2ZQ3 A;  1OVK A;  4WL6 A;  1G7M C;  9LYZ A;  3UON A;  5KXW A;  1LHM A;  4B1A A;  1FLQ A;  1JPO A;  4NGZ A;  1JJ3 A;  2IGC A;  1LPI A;  1OVH A;  1L77 A;  4LYC A;  1VDQ A;  3B72 A;  1LZN A;  190L A;  4PJZ A;  1L60 A;  2I26 L;  1UCO A;  1GFT A;  1L48 A;  1IWX A;  3LN2 A;  4AQN A;  1JJ0 A;  4YEM A;  1RCM A;  244L A;  3DKE X;  1LKR A;  3GUI A;  4B0D A;  1B7S A;  4EPI A;  1L03 A;  4B4E A;  3HBH A;  2YBH A;  1DI3 A;  1OWY A;  1GFJ A;  4OWC A;  1P2L A;  3LZM A;  1GXV 2;  1D2W A;  4EXM A;  1TBY A;  1HC0 A;  1XEK A;  2Q9D A;  1P36 A;  1TCY A;  2Z12 A;  2Z2F A;  1LZE A;  2A7D A;  240L A;  1HEW A;  4OWB A;  1H6M A;  4N1E I;  1TEW A;  1IO5 A;  7LZM A;  1C6G A;  2CJL A;  2B6X A;  3P65 A;  1IR8 A;  1GB6 A;  1IOR A;  1KY1 A;  1L95 A;  2EPE A;  4W96 A;  3T36 A;  1OUF A;  1LZ5 A;  1C6B A;  132L A;  1WTN A;  3F8V A;  1G7J C;  2B73 A;  4WM4 A;  4UWN A;  5APC A;  2DQE Y;  1G0G A;  3CDR A;  150L A;  2Z38 A;  3N9A A;  1DKK A;  2MEG A;  1B5V A;  1LMQ A;  4PRU A;  191L A;  1BVK C;  1GB5 A;  3WPL A;  5JEN B;  1JKB A;  4OOT A;  1IWZ A;  5KXO A;  1QSA A;  1L06 A;  1QTC A;  257L A;  1GFK A;  208L A;  1D0M A;  162L A;  1L25 A;  210L A;  3IJV A;  1L49 A;  4I7Q A;  2FBB A;  1L79 A;  2OU8 A;  1P46 A;  4OWH A;  5LXW A;  3C82 A;  4EKP A;  2X0A A;  2Z19 A;  3DN3 A;  1GAZ A;  2DQA A;  2OU0 X;  221L A;  1CX7 A;  1HEP A;  1G0J A;  4H93 A;  1UID A;  1C69 A;  3FA0 A;  3CT5 A;  3AGG G;  4QEQ A;  1QTK A;  5LVG A;  1CU6 A;  4R0F A;  1IOS A;  5KXM A;  1WQR A;  1P6Y A;  3SBB C;  1LZA A;  5J7C A;  158L A;  3AZ6 A;  2Z37 A;  5KXK A;  3IWR A;  5E4P A;  1HNL A;  2F2N A;  1XEI A;  249L A;  2H9K A;  5HMJ A;  4XN6 A;  5KXZ A;  232L A;  1CTW A;  1L93 A;  1HEL A;  2BAA A;  2HUK A;  5I4X A;  4NWE A;  5DL9 A;  1QT7 A;  2YDG A;  1BB4 A;  4HPE A;  2LZ2 A;  2OTZ X;  1IOQ A;  1LMO A;  161L A;  2BLX A;  1CV6 A;  1L21 A;  3WYH A;  4EMN A;  4B4I A;  143L A;  1F0W A;  1IR9 A;  3KAM A;  1ZMY L;  1LYI A;  1L61 A;  1UBZ A;  1AKI A;  1L94 A;  1YAO A;  193L A;  1CU3 A;  4NG1 A;  3G3V A;  1HEO A;  1L86 A;  1GDX A;  3HUQ A;  3C80 A;  1NDG C;  220L A;  130L A;  183L A;  1IWV A;  1GBX A;  2W1L A;  262L A;  1V7S A;  4YXA C;  4DKL A;  3RU5 A;  245L A;  1QUT A;  3A95 A;  5FEK A;  3WW5 A;  2ANX A;  216L A;  4WM2 A;  2Z39 A;  2W1Y A;  4QY9 A;  224L A;  4W51 A;  2IHL A;  1QTE A;  2C8O A;  5I4Y A;  1C45 A;  3P4Z A;  1T3P A;  131L A;  1LZ1 A;  4G4C A;  1LMA A;  1B0D A;  3E3D A;  4W52 A;  1P56 A;  2BQK A;  1IVM A;  1L18 A;  2RAZ X;  253L A;  1REZ A;  4RLN A;  3HTB A;  5HMV A;  2B75 A;  3HDF A;  1G1W A;  2BQH A;  4NHT A;  3D9A C;  4B4J A;  1P2C C;  4PGJ B;  1CKC A;  4DAJ A;  5FDJ A;  1L12 A;  228L A;  4WLT A;  5APF A;  4G49 A;  4W56 A;  2HEE A;  2ZYC A;  3RW8 A;  4I8S A;  3C8R A;  3L2X A;  1L58 A;  1L50 A;  1B5W A;  1L67 A;  4GN3 A;  1D9W A;  1D6Q A;  140L A;  1IP6 A;  1LOZ A;  1BQL Y;  1CJ9 A;  4WL7 A;  1QT5 A;  112L A;  1DXJ A;  3A93 A;  3HBE X;  3B6L A;  182L A;  1CJ6 A;  3WUN A;  8LYZ A;  2DQI Y;  2HUM A;  3DMV A;  3FE0 A;  1L83 A;  2DBT A;  3CDT A;  1L82 A;  3TMU A;  225L A;  1P5C A;  3ATN A;  2F47 A;  1L66 A;  1F10 A;  1KXY A;  3TMV A;  1G1V A;  3C8S A;  1INU A;  2BQD A;  4IAT A;  4PJ2 C;  5M1Y A;  2D91 A;  1A4V A;  1DZB X;  3HT7 A;  4G4B A;  4H90 A;  3SB8 A;  186L A;  1EQE A;  2F2Q A;  1JHL A;  2D4I A;  215L A;  1C6T A;  4B49 A;  4NGL A;  1QUH A;  3DN0 A;  2BQJ A;  200L A;  4XAD A;  1OUG A;  1CUP A;  4DYG A;  3LYO A;  2RB1 X;  2RBO A;  178L A;  3F6Z A;  1BWI A;  4DD2 A;  3OJP A;  1LWK A;  2RBR A;  1VAU A;  3ZEK A;  1LW9 A;  4NHP A;  2RB2 X;  1LJN A;  4LT3 A;  1LZC A;  1L27 A;  1FDL Y;  5LVI A;  2IFF Y;  1T6H A;  2BQN A;  1C6K A;  1W6Z A;  1C67 A;  243L A;  1GFU A;  4WLD A;  1BWJ A;  4NG8 A;  1LHI A;  1WVV A;  5ILC A;  1LYJ A;  4NGV A;  5A3Z A;  2BQO A;  4W59 A;  5KXX A;  4ET9 A;  1FKV A;  1LMP A;  235L A;  1G06 A;  1L07 A;  4YF2 A;  3WXT A;  1LSZ A;  4YXC A;  1LSA A;  2H9J A;  1AM7 A;  5LVH A;  1KW5 A;  1LSN A;  4HTN A;  4XJH A;  1C10 A;  3HUA A;  1BGI A;  1KIQ C;  3K2R A;  2FBD A;  4ZFP A;  1C6P A;  2B5Z A;  4DD7 A;  3QAK A;  2BQC A;  1PQD A;  4DDC A;  1C6A A;  1IP5 A;  1QTB A;  1JQU A;  3JR6 A;  3HTG A;  1GFA A;  231L A;  1REX A;  1HEQ A;  3WH1 A;  139L A;  1LSC A;  3LZ2 A;  3WL2 A;  3A92 A;  1NKH A;  1LMT A;  1C61 A;  3SBA A;  1IP7 A;  1OP9 B;  1J1O Y;  3WUA A;  118L A;  1GF0 A;  2B6W A;  4IAP A;  4QDN A;  4I7J A;  4C3W A;  5LYZ A;  1DPX A;  201L A;  1LJF A;  4NSJ A;  2F30 A;  2HEA A;  1DYC A;  5LIO A;  1VDP A;  1J1X Y;  1L47 A;  3WU8 A;  1QT8 A;  2HEF A;  147L A;  3C7W A;  3C83 A;  3GUO A;  2B7X A;  2DQC Y;  7LYZ A;  1JKD A;  141L A;  4LDL A;  4CFO A;  1PQO A;  1KXX A;  1B7O A;  1L46 A;  187L A;  4OW1 A;  5B59 A;  1L54 A;  1G0L A;  246L A;  2B70 A;  1D3F A;  1B7M A;  1ZVY B;  3OK0 A;  2MEH A;  1L73 A;  113L A;  1IC4 Y;  1GFG A;  1SLY A;  1C6H A;  1D0L A;  3A3Q A;  5KXR A;  157L A;  5KY1 A;  258L A;  4I7R A;  1LZD A;  1QTV A;  1LZ9 A;  5HNC A;  1LYG A;  4BAD A;  4H9E A;  3G3X A;  2YSS C;  4GCB A;  4HJZ A;  1JTM A;  1P3N A;  3NYA A;  2QAR C;  5APE A;  192L A;  2G4P A;  1G0Q A;  1HFX A;  1GDW A;  1L33 A;  2EQL A;  3A8Z A;  5KXT A;  3CDO A;  2LYZ A;  1C64 A;  211L A;  1K28 A;  4NFV A;  4I7T A;  3HTD A;  5LYM A;  1IWT A;  189L A;  1L98 A;  2ZNW Y;  1C6J A;  1L63 A;  1L41 A;  1LJJ A;  1GWD A;  4H9I A;  1L16 A;  4AXT A;  3LZT A;  2HUL A;  2DQH Y;  1L39 A;  3OE6 A;  3EMS A;  5LVK A;  160L A;  1L51 A;  4I0C A;  1C63 A;  4XJI A;  1PQJ A;  227L A;  2HEB A;  2O7A A;  5APD A;  5FST A;  1CVK A;  1IP1 A;  2ZYP A;  1LHH A;  1L81 A;  3D3D A;  1C7P A;  1IP2 A;  1VDS A;  4ETB A;  5IDD A;  1BB3 A;  1DKJ A;  1MLC E;  1DPW A;  1JSF A;  151L A;  1YL1 X;  4BAF A;  2YBJ A;  2DKV A;  1ZUR A;  5I4W A;  5FCP A;  4RDS A;  1QQY A;  5C6I A;  3T6U A;  5LA8 A;  145L A;  1OWZ A;  1GFV A;  3OE0 A;  3AYQ A;  4H9H A;  3PDS A;  2BQG A;  2B6T A;  5L3I A;  1B7P A;  4UWU A;  206L A;  4LZT A;  4OWE A;  3HT9 A;  1GFR A;  3J6K A;  1JKC A;  2AUB A;  1IX0 A;  1L0K A;  222L A;  4NGO A;  3C81 A;  4II8 A;  4X3B A;  1IOC A;  5L3H A;  1LKS A;  1C08 C;  3TMW A;  4NWH A;  1AT5 A;  4DC4 A;  2ZIK A;  1I6S A;  4N5R A;  4N1C C;  4PK0 A;  1IWU A;  1QTH A;  1CKD A;  4WO6 A;  251L A;  1UIE A;  1QS5 A;  3AGI A;  2BQI A;  2Y8P A;  3DN4 A;  4DWX A;  3DMZ A;  5LZM A;  3OE8 A;  1L62 A;  1FN5 A;  3TMX A;  4YEN A;  1DI5 A;  2XBR A;  3HT6 A;  5I53 A;  5T3F A;  3P64 A;  3G3A B;  1FLU A;  2BQB A;  5DN4 A;  5KXS A;  1L24 A;  1G0K A;  1LJ4 A;  1YIL A;  1IIZ A;  172L A;  4I7L A;  1SX7 A;  1GB8 A;  3OE9 A;  1CV3 A;  176L A;  4WM3 A;  4D9Z A;  1LSB A;  1CU5 A;  167L A;  1L69 A;  4DDA A;  2OE4 X;  254L A;  1C6M A;  1XGT C;  1L32 A;  2FYC A;  3CSQ A;  4IAS A;  4EKS A;  2NWD X;  213L A;  242L A;  1OUI A;  4GCC A;  1GF7 A;  5D5F A;  3W6F A;  3WPK A;  4U3X B;  3SB7 A;  3WPJ A;  137L A;  4LT0 A;  109L A;  1C6I A;  1G7H C;  3RZ4 A;  3CDQ A;  1HFY A;  4TUN A;  4EOF A;  1LZG A;  4I7M A;  2L78 A;  2MEE A;  3AB6 A;  4NGY A;  5LIN A;  1JIY A;  2HED A;  2OU9 A;  3A91 A;  115L A;  1VDT A;  230L A;  1LZ4 A;  1SWZ A;  1LYY A;  4N0J A;  4EKQ A;  2DQD Y;  4RLM A;  2HUB A;  1L55 A;  1LZY A;  1GBS A;  3RUN A;  1D3M A;  3WUM A;  3G3B B;  1L01 A;  1NWG A;  1LWG A;  1QTZ A;  129L A;  4NHI A;  1OUA A;  3DMX A;  2NTG A;  3AZ7 A;  4G9S A;  1YAN A;  4GCE A;  1LYH A;  1FLY A;  1QTD A;  1QIO A;  1L05 A;  2B72 A;  1GEZ A;  4H8X A;  5I5Q A;  1RE2 A;  1JTT L;  1EPY A;  3CSR A;  4Z3M A;  198L A;  4L41 A;  1C6F A;  1PZY A;  3TXK A;  1L52 A;  4W55 A;  1L56 A;  3BKV A;  1L44 A;  4YX7 C;  4BAP A;  2F4A A;  1ZV5 L;  3NY9 A;  1LJI A;  1OUE A;  2DQJ Y;  1B5X A;  4ARJ A;  1CV5 A;  4DQ5 A;  1IR7 A;  4H9C A;  2GV0 A;  4DQ7 A;  2XQO A;  3CT0 A;  1JWR A;  3CSZ A;  111L A;  1L65 A;  2BQA A;  3LHM A;  1FLW A;  3HDE A;  3WXU A;  3AW7 A;  3GXR A;  1YAP A;  1HFZ A;  219L A;  4ARP A;  1L99 A;  2BQE A;  4S0W A;  1F6S A;  4CFP A;  1B7Q A;  1AZF A;  1B7R A;  2ANV A;  1C6L A;  1KS3 A;  2I6Z A;  1LSG A;  1L90 A;  4DQJ A;  3SB5 A;  3FI5 A;  1LJH A;  4DD9 A;  1IOT A;  3A90 A;  185L A;  1ZVH L;  3TXI A;  1C6D A;  3ATO A;  2ZIJ A;  4K5Y A;  1L10 A;  4UWV A;  1DYD A;  1CKG A;  2LYO A;  1QS9 A;  4GCF A;  3F9L A;  1HER A;  4HV1 A;  5LYT A;  1L43 A;  1C6N A;  1WQO A;  1DYB A;  1GAY A;  2DQF C;  4WG1 A;  4TX7 A;  3ODU A;  1B9O A;  1YL0 X;  1GB9 A;  3D4S A;  3W6E A;  223L A;  1YKY X;  3K3T A;  4YM8 A;  3SP3 A;  1HSW A;  3GUL A;  3WMK A;  1LSM A;  3QNG A;  256L A;  3CDV A;  3VWO A;  3C7Z A;  3HUK A;  1LYD A;  1C62 A;  1YAQ A;  2LZM A;  1TLA A;  1L88 A;  3EML A;  1XJT A;  4LYM A;  3DN1 A;  2BQM A;  1V7T A;  3P68 A;  1XEP A;  1LZB A;  3SN6 R;  1HHL A;  1VED A;  2XTH A;  195L A;  1WTH A;  1J1P Y;  4NGI A;  1B7L A;  1C46 A;  2MEF A;  2LC9 A;  1BWH A;  3ZVQ A;  1QDT A;  1XGP C;  2G4N A;  4WM5 A;  1D0K A;  2A7F A;  3TXG A;  3SB9 A;  1GF6 A;  1L74 A;  5DLA A;  4LDO A;  3CQL A;  4EPF A;  2RBS A;  1EQ5 A;  177L A;  1ZWN A;  3AZ5 A;  181L A;  1WQP A;  4N8Z A;  4ANR A;  5KXN A;  1L23 A;  1LJG A;  4DT3 A;  1T97 A;  1LJE A;  1GE4 A;  1OUH A;  126L A;  4XEN A;  4RW2 A;  1REY A;  3C8Q A;  2D6B A;  1D6P A;  239L A;  4E3U A;  1LYF A;  1D3N A;  4P2E A;  4NGW A;  1JIT A;  1UIF A;  2NTH A;  3WU9 A;  4EJ4 A;  4LT2 A;  4Z41 A;  5HQ1 A;  3GUN A;  4LYB A;  3TXF A;  2BQF A;  1PS5 A;  142L A;  4YOP A;  2B6Z A;  4ARQ A;  4Z46 A;  4I7N A;  1DI4 A;  1XGU C;  4ARM A;  2LHM A;  4LT1 A;  4XJG A;  138L A;  1B7N A;  3V2W A;  1GFH A;  1L13 A;  4OO9 A;  5FEL A;  1T8G A;  3W6A A;  238L A;  5K7O A;  4CGE A;  1LHK A;  3CT1 A;  165L A;  1SSW A;  4MST A;  1L15 A;  1JKA A;  1OUC A;  5F9X A;  3GUK A;  1C66 A;  1L68 A;  5KXL A;  1L02 A;  4WM6 A;  3A94 A;  123L A;  1L17 A;  252L A;  2OTY X;  4ZIX A;  4WG7 A;  1GF3 A;  260L A;  1G7I C;  133L A;  1B5Y A;  169L A;  3GUJ A;  4KT3 A;  1PQK A;  3WW6 A;  1OV5 A;  1Z55 A;  1ZYT A;  4I7S A;  1P37 A;  1YAM A;  6LYT A;  1HF4 A;  1L26 A;  1GF8 A;  1JTN A;  1C60 A;  1C68 A;  1GF4 A;  2HU3 A;  2CGI A;  4J1B A;  4LDE A;  1L34 A;  5KXY A;  194L A;  3V2Y A;  5KKJ A;  3LYZ A;  1NMM A;  3RNX A;  4KXI A;  1L36 A;  1WTM A;  1GBW A;  4LFX A;  1L35 A;  2HU1 A;  166L A;  1LI3 A;  4NSG A;  1LSD A;  1UUZ C;  168L A;  1QT3 A;  149L A;  4G4H A;  1GF5 A;  2MEA A;  1GBY A;  1CX6 A;  3HT8 A;  2G4Q A;  170L A;  1CUQ A;  4HSF A;  4ZPU A;  4HJY A;  3LYM A;  4ARL A;  4LZM A;  3W6B A;  3B0O A;  1IEE A;  3TXJ A;  4W94 A;  1LYS A;  3HWL A;  1L92 A;  1BB6 A;  1CV1 A;  4OOO A;  1QUS A;  4ML7 A;  3A6C Y;  4GN5 C;  146L A;  3WUL A;  5AMY A;  1QUD A;  1SWY A;  1GPQ C;  5KJ9 A;  1L28 A;  4FJR A;  2Q9E A;  5KKI A;  4W53 A;  5B07 A;  3DN6 A;  2LYM A;  1TAY A;  128L A;  1UIC A;  4HTQ A;  1WQQ A;  3TXB A;  2BLY A;  1LGX A;  5I14 A;  125L A;  3IJU A;  4ETA A;  1CV4 A;  4DD3 A;  2XBS A;  3P66 A;  1CU0 A;  3HTF A;  2OEA X;  1DYF A;  1L40 A;  237L A;  2D4J A;  4H94 A;  4A7D A;  1UIA A;  1L14 A;  1W08 A;  1L96 A;  1HSX A;  1OUB A;  1RFP A;  3ULR A;  1C65 A;  2ZNX Y;  2OE7 X;  4LYZ A;  1KNI A;  1RI8 B;  2EKS C;  4QGZ A;  6LZM A;  1YIK A;  2HTX A;  1FBI X;  3GUP A;  1D2Y A;  1CNS A;  1L08 A;  1KIP C;  5EBH A;  110L A;  2F32 A;  1L75 A;  184L A;  1LZR A;  1GEV A;  1QUO A;  2WAR A;  3J4G A;  1GBZ A;  255L A;  1YRO A;  2DQG Y;  1GD6 A;  2ZWB A;  1GE3 A;  4MR1 A;  1GE2 A;  5F9U A;  174L A;  4J0L A;  108L A;  1L64 A;  218L A;  5IHG A;  1LZS A;  1XEJ A;  1H87 A;  103L A;  4LGK A;  4H9F A;  135L A;  259L A;  2MEC A;  196L A;  3DN8 A;  1QSW A;  1TDY A;  3M3U A;  163L A;  1P64 A;  173L A;  2W1X A;  3L64 A;  1LI2 A;  1IY3 A;  3ZVQ B;  1LI6 A;  233L A;  148L E;  1GXX A;  4WMG A;  5FHW A;  3W6C A;  4I7K A;  1L80 A;  3WU7 A;  4XJB A;  4TWS A;  4HPI A;  3AGH A;  1L04 A;  1T6V L;  1C43 A;  4PHI A;  1CJ8 A;  1HEM A;  2YBN A;  114L A;  226L A;  1LGW A;  1UIH A;  229L A;  1EL1 A;  4NHQ A;  1NHE A;  4NIJ A;  2C8P A;  2LZT A;  1L53 A;  2RH1 A;  1UAC Y;  1LYE A;  4ARQ B;  5ILF A;  1QSB A;  1G0P A;  4AGA A;  4ARM B;  5F16 A;  2Q0M X;  3A96 A;  2LCB A;  1CV0 A;  180L A;  4NSI A;  1LGU A;  2F4G A;  1IY4 A;  1LSP A;  2YBI A;  2CUU A;  3HH5 A;  1P7S A;  1L84 A;  2O79 A;  2HEC A;  4HTK A;  2PC2 A;  2YBL A;  4MCK A;  1L85 A;  1IP4 A;  4ETE A;  1LZT A;  1IP3 A;  2N5Z A;  4N9R A;  1HEN A;  4ETD A;  1C6E A;  2O4W A;  1NBY C;  3W3E A;  4W58 A;  1IWW A;  2FYD A;  1IWY A;  1LSF A;  2B74 A;  1LSE A;  2RBN A;  5LVJ A;  2MEB A;  4TTD A;  1L45 A;  205L A;  1I1Z A;  4H1P A;  241L A;  1ALC A;  1L59 A;  2MED A;  2RAY X;  1KY0 A;  1G0M A;  1UIG A;  5HLL A;  4GBR B;  1CU2 A;  1A2Y C;  4PPO A;  1N4F A;  4H92 A;  3SB6 A;  1L20 A;  3GXK A;  3QY4 A;  3EXD A;  1LSY A;  107L A;  4W54 A;  120L A;  3AJN A;  1OYU A;  4WLY A;  3HH6 A;  4FDY A;  2VB1 A;  1PQI A;  3LYT A;  212L A;  1L91 A;  1WQM A;  1C6C A;  250L A;  4M4O A;  152L A;  4DD0 A;  4HV2 A;  2RSC A;  1QT4 A;  3PBL A;  1DYE A;  1GHL A;  1CKF A;  1SX2 A;  2BQL A;  4H8Z A;  1NDM C;  5HNL A;  1L42 A;  247L A; 
#chains in the Genus database with same CATH homology
 2XJW A;  1OUJ A;  3DNA A;  3AW6 A;  4GLV A;  2EIZ C;  2A4T A;  3N9C A;  1DYA A;  4O34 A;  1QUG A;  1B6I A;  1XGQ C;  5D5C A;  1LCN A;  4NGK A;  2RB0 X;  4NHS A;  1L57 A;  1NBZ C;  3HH3 A;  155L A;  207L A;  2OE9 X;  1UIB A;  2ZIL A;  3TXH A;  4I7O A;  4XJF A;  1L0J A;  6LYZ A;  1L38 A;  1E8L A;  1QDR A;  1LPY A;  3DN2 A;  5LA5 A;  4W57 A;  3WVX A;  1UA6 Y;  3TXD A;  3B0K A;  4GN4 A;  1GE0 A;  1B5U A;  2YBM A;  3BKH A;  5II3 A;  1LYZ A;  1QSQ A;  1BVX A;  1L72 A;  4EKR A;  3HH4 A;  1BB7 A;  2MEI A;  1L22 A;  1L37 A;  1JTO L;  4ZEE A;  4NSH A;  5F81 A;  4HJV A;  3TXE A;  4XJD A;  1QT6 A;  1VAT A;  1LJ3 A;  3W6D A;  4WM1 A;  1LTM A;  1PQM A;  4DJH A;  1T8F A;  4TSB A;  1VFB C;  1RJC B;  4H9A A;  2QB0 B;  1P2R A;  4NY5 A;  1L31 A;  3QE8 A;  1OV7 A;  1GB7 A;  3WVY A;  4TSC A;  1I56 A;  4HP0 A;  5B06 A;  1LZ8 A;  1REM A;  2H5Z A;  3M18 B;  199L A;  3A34 A;  4RW1 A;  1KIR C;  2Z6B A;  1JEF A;  171L A;  2Z2E A;  1SQ2 L;  234L A;  2RBQ A;  3N9E A;  1OUD A;  5B05 A;  1XFP L;  159L A;  1BHZ A;  5E9R A;  122L A;  3HFM Y;  134L A;  1L76 A;  1IC5 Y;  4H8Y A;  261L A;  1OQM A;  4DD1 A;  1GF9 A;  4GCD A;  4J1A A;  1NF5 A;  214L A;  1JUG A;  1L70 A;  1D3J A;  1WQN A;  3HBD A;  1L09 A;  4XYY A;  4GLA A;  156L A;  4M6D A;  4LFP A;  4DDB A;  4CJ2 A;  1CKH A;  3AZ4 A;  5KXP A;  5DM9 A;  3EBA B;  1LHL A;  1YKX X;  5DN5 A;  1KW7 A;  3FI7 A;  102L A;  1HML A;  1L11 A;  4ET8 A;  4CHX A;  1DQJ C;  1CJ7 A;  4OWA A;  188L A;  5B1F A;  3CB7 A;  1AT6 A;  2CDS A;  3G3W A;  1GB3 A;  4YEO A;  5B1G A;  3VW7 A;  1MEL L;  3EO5 A;  4NGJ A;  1L97 A;  5LAF A;  1BB5 A;  1O23 A;  1XJU A;  175L A;  1HMK A;  3GUM A;  1LAA A;  4ETC A;  1L87 A;  2RBP A;  5LAG A;  4KL7 A;  3MGW A;  5I54 A;  4C5F A;  1SSY A;  197L A;  5C6L A;  4GRV A;  104L A;  1B2K A;  1GB2 A;  3FAD A;  1LYO A;  1JSE A;  2YVB A;  154L A;  2B6Y A;  4I7P A;  1UC0 A;  3RZE A;  5A3E A;  1FKQ A;  1LHJ A;  1EQ4 A;  1GBO A;  1JIS A;  4IJ4 A;  1WVU A;  1XSF A;  2W1M A;  1L19 A;  1I20 A;  2ZQ4 A;  1JTP L;  1LMN A;  217L A;  4KPM A;  5C6J A;  209L A;  164L A;  127L A;  1F6R A;  5IEL A;  4LYO A;  1YQV Y;  1G7L C;  2BPU A;  4PRQ A;  4BS7 A;  153L A;  1GFE A;  4H91 A;  1KXW A;  1L30 A;  1T8A A;  1IC7 Y;  1YKZ X;  2D4K A;  3NY8 A;  4E97 A;  4J7V A;  144L A;  4R6C A;  4H9B A;  1LMC A;  4NEB A;  1XGR C;  1NHB A;  119L A;  3RT5 X;  1G07 A;  1L29 A;  1GE1 A;  2CWI A;  1LLH A;  1L00 A;  5F14 A;  1LJK A;  3HU9 A;  2I25 L;  1DYG A;  3A67 Y;  3A6B Y;  1NQI A;  236L A;  1JJ1 A;  4WOA A;  1L89 A;  1B5Z A;  1OVJ A;  1GB0 A;  4WLX A;  1C6Q A;  1LZ6 A;  2Z18 A;  4WO9 A;  5L9J A;  1L71 A;  4Z98 A;  4LYT A;  3B0I A;  3C7Y A;  3A3R X;  1D9U A;  248L A;  3HU8 A;  2ZQ3 A;  1OVK A;  4WL6 A;  1G7M C;  9LYZ A;  3UON A;  5KXW A;  1LHM A;  4B1A A;  1FLQ A;  1JPO A;  4NGZ A;  1JJ3 A;  2IGC A;  1LPI A;  1OVH A;  1L77 A;  4LYC A;  1VDQ A;  3B72 A;  1LZN A;  190L A;  4PJZ A;  1L60 A;  2I26 L;  1UCO A;  1GFT A;  1L48 A;  1IWX A;  3LN2 A;  4AQN A;  1JJ0 A;  4YEM A;  1RCM A;  244L A;  3DKE X;  1LKR A;  3GUI A;  4B0D A;  1B7S A;  4EPI A;  1L03 A;  4B4E A;  3HBH A;  2YBH A;  1DI3 A;  1OWY A;  1GFJ A;  4OWC A;  1P2L A;  3LZM A;  1GXV 2;  1D2W A;  4EXM A;  1TBY A;  1HC0 A;  1XEK A;  2Q9D A;  1P36 A;  1TCY A;  2Z12 A;  2Z2F A;  1LZE A;  2A7D A;  240L A;  1HEW A;  4OWB A;  1H6M A;  4N1E I;  1TEW A;  1IO5 A;  7LZM A;  1C6G A;  2CJL A;  2B6X A;  3P65 A;  1IR8 A;  1GB6 A;  1IOR A;  1KY1 A;  1L95 A;  2EPE A;  4W96 A;  3T36 A;  1OUF A;  1LZ5 A;  1C6B A;  132L A;  1WTN A;  3F8V A;  1G7J C;  2B73 A;  4WM4 A;  4UWN A;  5APC A;  2DQE Y;  1G0G A;  3CDR A;  150L A;  2Z38 A;  3N9A A;  1DKK A;  2MEG A;  1B5V A;  1LMQ A;  4PRU A;  191L A;  1BVK C;  1GB5 A;  3WPL A;  5JEN B;  1JKB A;  4OOT A;  1IWZ A;  5KXO A;  1QSA A;  1L06 A;  1QTC A;  257L A;  1GFK A;  208L A;  1D0M A;  162L A;  1L25 A;  210L A;  3IJV A;  1L49 A;  4I7Q A;  2FBB A;  1L79 A;  2OU8 A;  1P46 A;  4OWH A;  5LXW A;  3C82 A;  4EKP A;  2X0A A;  2Z19 A;  3DN3 A;  1GAZ A;  2DQA A;  2OU0 X;  221L A;  1CX7 A;  1HEP A;  1G0J A;  4H93 A;  1UID A;  1C69 A;  3FA0 A;  3CT5 A;  3AGG G;  4QEQ A;  1QTK A;  5LVG A;  1CU6 A;  4R0F A;  1IOS A;  5KXM A;  1WQR A;  1P6Y A;  3SBB C;  1LZA A;  5J7C A;  158L A;  3AZ6 A;  2Z37 A;  5KXK A;  3IWR A;  5E4P A;  1HNL A;  2F2N A;  1XEI A;  249L A;  2H9K A;  5HMJ A;  4XN6 A;  5KXZ A;  232L A;  1CTW A;  1L93 A;  1HEL A;  2BAA A;  2HUK A;  5I4X A;  4NWE A;  5DL9 A;  1QT7 A;  2YDG A;  1BB4 A;  4HPE A;  2LZ2 A;  2OTZ X;  1IOQ A;  1LMO A;  161L A;  2BLX A;  1CV6 A;  1L21 A;  3WYH A;  4EMN A;  4B4I A;  143L A;  1F0W A;  1IR9 A;  3KAM A;  1ZMY L;  1LYI A;  1L61 A;  1UBZ A;  1AKI A;  1L94 A;  1YAO A;  193L A;  1CU3 A;  4NG1 A;  3G3V A;  1HEO A;  1L86 A;  1GDX A;  3HUQ A;  3C80 A;  1NDG C;  220L A;  130L A;  183L A;  1IWV A;  1GBX A;  2W1L A;  262L A;  1V7S A;  4YXA C;  4DKL A;  3RU5 A;  245L A;  1QUT A;  3A95 A;  5FEK A;  3WW5 A;  2ANX A;  216L A;  4WM2 A;  2Z39 A;  2W1Y A;  4QY9 A;  224L A;  4W51 A;  2IHL A;  1QTE A;  2C8O A;  5I4Y A;  1C45 A;  3P4Z A;  1T3P A;  131L A;  1LZ1 A;  4G4C A;  1LMA A;  1B0D A;  3E3D A;  4W52 A;  1P56 A;  2BQK A;  1IVM A;  1L18 A;  2RAZ X;  253L A;  1REZ A;  4RLN A;  3HTB A;  5HMV A;  2B75 A;  3HDF A;  1G1W A;  2BQH A;  4NHT A;  3D9A C;  4B4J A;  1P2C C;  4PGJ B;  1CKC A;  4DAJ A;  5FDJ A;  1L12 A;  228L A;  4WLT A;  5APF A;  4G49 A;  4W56 A;  2HEE A;  2ZYC A;  3RW8 A;  4I8S A;  3C8R A;  3L2X A;  1L58 A;  1L50 A;  1B5W A;  1L67 A;  4GN3 A;  1D9W A;  1D6Q A;  140L A;  1IP6 A;  1LOZ A;  1BQL Y;  1CJ9 A;  4WL7 A;  1QT5 A;  112L A;  1DXJ A;  3A93 A;  3HBE X;  3B6L A;  182L A;  1CJ6 A;  3WUN A;  8LYZ A;  2DQI Y;  2HUM A;  3DMV A;  3FE0 A;  1L83 A;  2DBT A;  3CDT A;  1L82 A;  3TMU A;  225L A;  1P5C A;  3ATN A;  2F47 A;  1L66 A;  1F10 A;  1KXY A;  3TMV A;  1G1V A;  3C8S A;  1INU A;  2BQD A;  4IAT A;  4PJ2 C;  5M1Y A;  2D91 A;  1A4V A;  1DZB X;  3HT7 A;  4G4B A;  4H90 A;  3SB8 A;  186L A;  1EQE A;  2F2Q A;  1JHL A;  2D4I A;  215L A;  1C6T A;  4B49 A;  4NGL A;  1QUH A;  3DN0 A;  2BQJ A;  200L A;  4XAD A;  1OUG A;  1CUP A;  4DYG A;  3LYO A;  2RB1 X;  2RBO A;  178L A;  3F6Z A;  1BWI A;  4DD2 A;  3OJP A;  1LWK A;  2RBR A;  1VAU A;  3ZEK A;  1LW9 A;  4NHP A;  2RB2 X;  1LJN A;  4LT3 A;  1LZC A;  1L27 A;  1FDL Y;  5LVI A;  2IFF Y;  1T6H A;  2BQN A;  1C6K A;  1W6Z A;  1C67 A;  243L A;  1GFU A;  4WLD A;  1BWJ A;  4NG8 A;  1LHI A;  1WVV A;  5ILC A;  1LYJ A;  4NGV A;  5A3Z A;  2BQO A;  4W59 A;  5KXX A;  4ET9 A;  1FKV A;  1LMP A;  235L A;  1G06 A;  1L07 A;  4YF2 A;  3WXT A;  1LSZ A;  4YXC A;  1LSA A;  2H9J A;  1AM7 A;  5LVH A;  1KW5 A;  1LSN A;  4HTN A;  4XJH A;  1C10 A;  3HUA A;  1BGI A;  1KIQ C;  3K2R A;  2FBD A;  4ZFP A;  1C6P A;  2B5Z A;  4DD7 A;  3QAK A;  2BQC A;  1PQD A;  4DDC A;  1C6A A;  1IP5 A;  1QTB A;  1JQU A;  3JR6 A;  3HTG A;  1GFA A;  231L A;  1REX A;  1HEQ A;  3WH1 A;  139L A;  1LSC A;  3LZ2 A;  3WL2 A;  3A92 A;  1NKH A;  1LMT A;  1C61 A;  3SBA A;  1IP7 A;  1OP9 B;  1J1O Y;  3WUA A;  118L A;  1GF0 A;  2B6W A;  4IAP A;  4QDN A;  4I7J A;  4C3W A;  5LYZ A;  1DPX A;  201L A;  1LJF A;  4NSJ A;  2F30 A;  2HEA A;  1DYC A;  5LIO A;  1VDP A;  1J1X Y;  1L47 A;  3WU8 A;  1QT8 A;  2HEF A;  147L A;  3C7W A;  3C83 A;  3GUO A;  2B7X A;  2DQC Y;  7LYZ A;  1JKD A;  141L A;  4LDL A;  4CFO A;  1PQO A;  1KXX A;  1B7O A;  1L46 A;  187L A;  4OW1 A;  5B59 A;  1L54 A;  1G0L A;  246L A;  2B70 A;  1D3F A;  1B7M A;  1ZVY B;  3OK0 A;  2MEH A;  1L73 A;  113L A;  1IC4 Y;  1GFG A;  1SLY A;  1C6H A;  1D0L A;  3A3Q A;  5KXR A;  157L A;  5KY1 A;  258L A;  4I7R A;  1LZD A;  1QTV A;  1LZ9 A;  5HNC A;  1LYG A;  4BAD A;  4H9E A;  3G3X A;  2YSS C;  4GCB A;  4HJZ A;  1JTM A;  1P3N A;  3NYA A;  2QAR C;  5APE A;  192L A;  2G4P A;  1G0Q A;  1HFX A;  1GDW A;  1L33 A;  2EQL A;  3A8Z A;  5KXT A;  3CDO A;  2LYZ A;  1C64 A;  211L A;  1K28 A;  4NFV A;  4I7T A;  3HTD A;  5LYM A;  1IWT A;  189L A;  1L98 A;  2ZNW Y;  1C6J A;  1L63 A;  1L41 A;  1LJJ A;  1GWD A;  4H9I A;  1L16 A;  4AXT A;  3LZT A;  2HUL A;  2DQH Y;  1L39 A;  3OE6 A;  3EMS A;  5LVK A;  160L A;  1L51 A;  4I0C A;  1C63 A;  4XJI A;  1PQJ A;  227L A;  2HEB A;  2O7A A;  5APD A;  5FST A;  1CVK A;  1IP1 A;  2ZYP A;  1LHH A;  1L81 A;  3D3D A;  1C7P A;  1IP2 A;  1VDS A;  4ETB A;  5IDD A;  1BB3 A;  1DKJ A;  1MLC E;  1DPW A;  1JSF A;  151L A;  1YL1 X;  4BAF A;  2YBJ A;  2DKV A;  1ZUR A;  5I4W A;  5FCP A;  4RDS A;  1QQY A;  5C6I A;  3T6U A;  5LA8 A;  145L A;  1OWZ A;  1GFV A;  3OE0 A;  3AYQ A;  4H9H A;  3PDS A;  2BQG A;  2B6T A;  5L3I A;  1B7P A;  4UWU A;  206L A;  4LZT A;  4OWE A;  3HT9 A;  1GFR A;  3J6K A;  1JKC A;  2AUB A;  1IX0 A;  1L0K A;  222L A;  4NGO A;  3C81 A;  4II8 A;  4X3B A;  1IOC A;  5L3H A;  1LKS A;  1C08 C;  3TMW A;  4NWH A;  1AT5 A;  4DC4 A;  2ZIK A;  1I6S A;  4N5R A;  4N1C C;  4PK0 A;  1IWU A;  1QTH A;  1CKD A;  4WO6 A;  251L A;  1UIE A;  1QS5 A;  3AGI A;  2BQI A;  2Y8P A;  3DN4 A;  4DWX A;  3DMZ A;  5LZM A;  3OE8 A;  1L62 A;  1FN5 A;  3TMX A;  4YEN A;  1DI5 A;  2XBR A;  3HT6 A;  5I53 A;  5T3F A;  3P64 A;  3G3A B;  1FLU A;  2BQB A;  5DN4 A;  5KXS A;  1L24 A;  1G0K A;  1LJ4 A;  1YIL A;  1IIZ A;  172L A;  4I7L A;  1SX7 A;  1GB8 A;  3OE9 A;  1CV3 A;  176L A;  4WM3 A;  4D9Z A;  1LSB A;  1CU5 A;  167L A;  1L69 A;  4DDA A;  2OE4 X;  254L A;  1C6M A;  1XGT C;  1L32 A;  2FYC A;  3CSQ A;  4IAS A;  4EKS A;  2NWD X;  213L A;  242L A;  1OUI A;  4GCC A;  1GF7 A;  5D5F A;  3W6F A;  3WPK A;  4U3X B;  3SB7 A;  3WPJ A;  137L A;  4LT0 A;  109L A;  1C6I A;  1G7H C;  3RZ4 A;  3CDQ A;  1HFY A;  4TUN A;  4EOF A;  1LZG A;  4I7M A;  2L78 A;  2MEE A;  3AB6 A;  4NGY A;  5LIN A;  1JIY A;  2HED A;  2OU9 A;  3A91 A;  115L A;  1VDT A;  230L A;  1LZ4 A;  1SWZ A;  1LYY A;  4N0J A;  4EKQ A;  2DQD Y;  4RLM A;  2HUB A;  1L55 A;  1LZY A;  1GBS A;  3RUN A;  1D3M A;  3WUM A;  3G3B B;  1L01 A;  1NWG A;  1LWG A;  1QTZ A;  129L A;  4NHI A;  1OUA A;  3DMX A;  2NTG A;  3AZ7 A;  4G9S A;  1YAN A;  4GCE A;  1LYH A;  1FLY A;  1QTD A;  1QIO A;  1L05 A;  2B72 A;  1GEZ A;  4H8X A;  5I5Q A;  1RE2 A;  1JTT L;  1EPY A;  3CSR A;  4Z3M A;  198L A;  4L41 A;  1C6F A;  1PZY A;  3TXK A;  1L52 A;  4W55 A;  1L56 A;  3BKV A;  1L44 A;  4YX7 C;  4BAP A;  2F4A A;  1ZV5 L;  3NY9 A;  1LJI A;  1OUE A;  2DQJ Y;  1B5X A;  4ARJ A;  1CV5 A;  4DQ5 A;  1IR7 A;  4H9C A;  2GV0 A;  4DQ7 A;  2XQO A;  3CT0 A;  1JWR A;  3CSZ A;  111L A;  1L65 A;  2BQA A;  3LHM A;  1FLW A;  3HDE A;  3WXU A;  3AW7 A;  3GXR A;  1YAP A;  1HFZ A;  219L A;  4ARP A;  1L99 A;  2BQE A;  4S0W A;  1F6S A;  4CFP A;  1B7Q A;  1AZF A;  1B7R A;  2ANV A;  1C6L A;  1KS3 A;  2I6Z A;  1LSG A;  1L90 A;  4DQJ A;  3SB5 A;  3FI5 A;  1LJH A;  4DD9 A;  1IOT A;  3A90 A;  185L A;  1ZVH L;  3TXI A;  1C6D A;  3ATO A;  2ZIJ A;  4K5Y A;  1L10 A;  4UWV A;  1DYD A;  1CKG A;  2LYO A;  1QS9 A;  4GCF A;  3F9L A;  1HER A;  4HV1 A;  5LYT A;  1L43 A;  1C6N A;  1WQO A;  1DYB A;  1GAY A;  2DQF C;  4WG1 A;  4TX7 A;  3ODU A;  1B9O A;  1YL0 X;  1GB9 A;  3D4S A;  3W6E A;  223L A;  1YKY X;  3K3T A;  4YM8 A;  3SP3 A;  1HSW A;  3GUL A;  3WMK A;  1LSM A;  3QNG A;  256L A;  3CDV A;  3VWO A;  3C7Z A;  3HUK A;  1LYD A;  1C62 A;  1YAQ A;  2LZM A;  1TLA A;  1L88 A;  3EML A;  1XJT A;  4LYM A;  3DN1 A;  2BQM A;  1V7T A;  3P68 A;  1XEP A;  1LZB A;  3SN6 R;  1HHL A;  1VED A;  2XTH A;  195L A;  1WTH A;  1J1P Y;  4NGI A;  1B7L A;  1C46 A;  2MEF A;  2LC9 A;  1BWH A;  3ZVQ A;  1QDT A;  1XGP C;  2G4N A;  4WM5 A;  1D0K A;  2A7F A;  3TXG A;  3SB9 A;  1GF6 A;  1L74 A;  5DLA A;  4LDO A;  3CQL A;  4EPF A;  2RBS A;  1EQ5 A;  177L A;  1ZWN A;  3AZ5 A;  181L A;  1WQP A;  4N8Z A;  4ANR A;  5KXN A;  1L23 A;  1LJG A;  4DT3 A;  1T97 A;  1LJE A;  1GE4 A;  1OUH A;  126L A;  4XEN A;  4RW2 A;  1REY A;  3C8Q A;  2D6B A;  1D6P A;  239L A;  4E3U A;  1LYF A;  1D3N A;  4P2E A;  4NGW A;  1JIT A;  1UIF A;  2NTH A;  3WU9 A;  4EJ4 A;  4LT2 A;  4Z41 A;  5HQ1 A;  3GUN A;  4LYB A;  3TXF A;  2BQF A;  1PS5 A;  142L A;  4YOP A;  2B6Z A;  4ARQ A;  4Z46 A;  4I7N A;  1DI4 A;  1XGU C;  4ARM A;  2LHM A;  4LT1 A;  4XJG A;  138L A;  1B7N A;  3V2W A;  1GFH A;  1L13 A;  4OO9 A;  5FEL A;  1T8G A;  3W6A A;  238L A;  5K7O A;  4CGE A;  1LHK A;  3CT1 A;  165L A;  1SSW A;  4MST A;  1L15 A;  1JKA A;  1OUC A;  5F9X A;  3GUK A;  1C66 A;  1L68 A;  5KXL A;  1L02 A;  4WM6 A;  3A94 A;  123L A;  1L17 A;  252L A;  2OTY X;  4ZIX A;  4WG7 A;  1GF3 A;  260L A;  1G7I C;  133L A;  1B5Y A;  169L A;  3GUJ A;  4KT3 A;  1PQK A;  3WW6 A;  1OV5 A;  1Z55 A;  1ZYT A;  4I7S A;  1P37 A;  1YAM A;  6LYT A;  1HF4 A;  1L26 A;  1GF8 A;  1JTN A;  1C60 A;  1C68 A;  1GF4 A;  2HU3 A;  2CGI A;  4J1B A;  4LDE A;  1L34 A;  5KXY A;  194L A;  3V2Y A;  5KKJ A;  3LYZ A;  1NMM A;  3RNX A;  4KXI A;  1L36 A;  1WTM A;  1GBW A;  4LFX A;  1L35 A;  2HU1 A;  166L A;  1LI3 A;  4NSG A;  1LSD A;  1UUZ C;  168L A;  1QT3 A;  149L A;  4G4H A;  1GF5 A;  2MEA A;  1GBY A;  1CX6 A;  3HT8 A;  2G4Q A;  170L A;  1CUQ A;  4HSF A;  4ZPU A;  4HJY A;  3LYM A;  4ARL A;  4LZM A;  3W6B A;  3B0O A;  1IEE A;  3TXJ A;  4W94 A;  1LYS A;  3HWL A;  1L92 A;  1BB6 A;  1CV1 A;  4OOO A;  1QUS A;  4ML7 A;  3A6C Y;  4GN5 C;  146L A;  3WUL A;  5AMY A;  1QUD A;  1SWY A;  1GPQ C;  5KJ9 A;  1L28 A;  4FJR A;  2Q9E A;  5KKI A;  4W53 A;  5B07 A;  3DN6 A;  2LYM A;  1TAY A;  128L A;  1UIC A;  4HTQ A;  1WQQ A;  3TXB A;  2BLY A;  1LGX A;  5I14 A;  125L A;  3IJU A;  4ETA A;  1CV4 A;  4DD3 A;  2XBS A;  3P66 A;  1CU0 A;  3HTF A;  2OEA X;  1DYF A;  1L40 A;  237L A;  2D4J A;  4H94 A;  4A7D A;  1UIA A;  1L14 A;  1W08 A;  1L96 A;  1HSX A;  1OUB A;  1RFP A;  3ULR A;  1C65 A;  2ZNX Y;  2OE7 X;  4LYZ A;  1KNI A;  1RI8 B;  2EKS C;  4QGZ A;  6LZM A;  1YIK A;  2HTX A;  1FBI X;  3GUP A;  1D2Y A;  1CNS A;  1L08 A;  1KIP C;  5EBH A;  110L A;  2F32 A;  1L75 A;  184L A;  1LZR A;  1GEV A;  1QUO A;  2WAR A;  3J4G A;  1GBZ A;  255L A;  1YRO A;  2DQG Y;  1GD6 A;  2ZWB A;  1GE3 A;  4MR1 A;  1GE2 A;  5F9U A;  174L A;  4J0L A;  108L A;  1L64 A;  218L A;  5IHG A;  1LZS A;  1XEJ A;  1H87 A;  103L A;  4LGK A;  4H9F A;  135L A;  259L A;  2MEC A;  196L A;  3DN8 A;  1QSW A;  1TDY A;  3M3U A;  163L A;  1P64 A;  173L A;  2W1X A;  3L64 A;  1LI2 A;  1IY3 A;  3ZVQ B;  1LI6 A;  233L A;  148L E;  1GXX A;  4WMG A;  5FHW A;  3W6C A;  4I7K A;  1L80 A;  3WU7 A;  4XJB A;  4TWS A;  4HPI A;  3AGH A;  1L04 A;  1T6V L;  1C43 A;  4PHI A;  1CJ8 A;  1HEM A;  2YBN A;  114L A;  226L A;  1LGW A;  1UIH A;  229L A;  1EL1 A;  4NHQ A;  1NHE A;  4NIJ A;  2C8P A;  2LZT A;  1L53 A;  2RH1 A;  1UAC Y;  1LYE A;  4ARQ B;  5ILF A;  1QSB A;  1G0P A;  4AGA A;  4ARM B;  5F16 A;  2Q0M X;  3A96 A;  2LCB A;  1CV0 A;  180L A;  4NSI A;  1LGU A;  2F4G A;  1IY4 A;  1LSP A;  2YBI A;  2CUU A;  3HH5 A;  1P7S A;  1L84 A;  2O79 A;  2HEC A;  4HTK A;  2PC2 A;  2YBL A;  4MCK A;  1L85 A;  1IP4 A;  4ETE A;  1LZT A;  1IP3 A;  2N5Z A;  4N9R A;  1HEN A;  4ETD A;  1C6E A;  2O4W A;  1NBY C;  3W3E A;  4W58 A;  1IWW A;  2FYD A;  1IWY A;  1LSF A;  2B74 A;  1LSE A;  2RBN A;  5LVJ A;  2MEB A;  4TTD A;  1L45 A;  205L A;  1I1Z A;  4H1P A;  241L A;  1ALC A;  1L59 A;  2MED A;  2RAY X;  1KY0 A;  1G0M A;  1UIG A;  5HLL A;  4GBR B;  1CU2 A;  1A2Y C;  4PPO A;  1N4F A;  4H92 A;  3SB6 A;  1L20 A;  3GXK A;  3QY4 A;  3EXD A;  1LSY A;  107L A;  4W54 A;  120L A;  3AJN A;  1OYU A;  4WLY A;  3HH6 A;  4FDY A;  2VB1 A;  1PQI A;  3LYT A;  212L A;  1L91 A;  1WQM A;  1C6C A;  250L A;  4M4O A;  152L A;  4DD0 A;  4HV2 A;  2RSC A;  1QT4 A;  3PBL A;  1DYE A;  1GHL A;  1CKF A;  1SX2 A;  2BQL A;  4H8Z A;  1NDM C;  5HNL A;  1L42 A;  247L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...