1LYGA

Dissection of helix capping in t4 lysozyme by structural and thermodynamic analysis of six amino acid substitutions at thr 59
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
162
structure length
162
Chain Sequence
MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVINKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(o-glycosyl)
molecule keywords T4 LYSOZYME
publication title Dissection of helix capping in T4 lysozyme by structural and thermodynamic analysis of six amino acid substitutions at Thr 59.
pubmed doi rcsb
source organism Enterobacteria phage t4
total genus 59
structure length 162
sequence length 162
ec nomenclature ec 3.2.1.17: Lysozyme.
pdb deposition date 1992-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00959 Phage_lysozyme Phage lysozyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.530.40 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 1lygA00
230LA 111LA 175LA 1L23A 1L86A 1CV4A 1C6LA 4I7RA 205LA 225LA 2Q9DA 146LA 196LA 1L83A 3QAKA 1QT4A 1KY1A 171LA 1C6MA 1LI6A 4PK0A 3CDVA 3HDFA 1QTDA 168LA 1G0QA 3LZMA 4ARQB 139LA 103LA 256LA 2B6ZA 1QT3A 4YXAC 1QUOA 4ZPUA 1P2RA 1KW7A 1QT8A 3PBLA 3G3WA 118LA 226LA 2LC9A 2F2QA 3DN1A 3HT6A 2RB2X 3HH4A 1C6HA 1L15A 1L72A 249LA 3HH3A 162LA 3CDRA 152LA 187LA 3C8RA 1CVKA 1C6DA 3D4SA 3K2RA 1L14A 2Q9EA 1L05A 3HT9A 1OVJA 217LA 1C67A 1L51A 199LA 4W52A 1QS5A 4W59A 4LDEA 114LA 1L03A 1G0LA 3SB8A 3NY9A 1CV5A 1C61A 107LA 4PJZA 138LA 4ARQA 1SWZA 1D9WA 1KNIA 1CX7A 180LA 1L10A 1L17A 2B6XA 1B6IA 3OE6A 1L58A 1L56A 4I7QA 1DYAA 1L85A 2LCBA 1L13A 200LA 2QB0B 1L35A 1QTHA 150LA 2F47A 1L53A 1WTHA 3SB5A 211LA 3SB9A 185LA 3GUMA 248LA 144LA 258LA 244LA 3V2YA 159LA 1L29A 1OVHA 158LA 1L37A 1L90A 1LGUA 1L70A 1L06A 251LA 1L57A 3GUOA 1PQMA 1C65A 4EPIA 1G1WA 3GUNA 1T8FA 1C6BA 1L74A 3DMXA 1ZYTA 3DN8A 109LA 1C68A 198LA 3C7YA 1L67A 4EKRA 2OTZX 1C6PA 254LA 2B75A 1L87A 4W57A 1LI3A 1D2YA 1L82A 4I7PA 3DN4A 1C6TA 3HUAA 126LA 3OE0A 2QARC 1CU3A 4K5YA 1G0GA 214LA 1L42A 2RH1A 3C80A 2NTGA 177LA 2RAZX 1QT7A 1L77A 2B72A 4AQNA 3C82A 209LA 174LA 1ZWNA 213LA 4EKSA 252LA 156LA 1D3FA 1L36A 3G3XA 3V2WA 1L61A 2RBPA 1LYJA 4I7TA 1T8GA 1L95A 192LA 197LA 2RBSA 112LA 1OWYA 167LA 1CTWA 1L11A 189LA 1L71A 3OE8A 7LZMA 1C6AA 1CUQA 4W54A 4I7NA 1OVKA 1I6SA 6LZMA 3CDOA 1L98A 2RB0X 1T97A 231LA 1DYFA 1C6NA 3PDSA 2B73A 1SSWA 1L32A 3DN3A 1L08A 4S0WA 1L12A 1G0JA 1C6IA 227LA 3DMZA 1L28A 5LZMA 1L16A 147LA 2F32A 2B7XA 1L25A 206LA 122LA 241LA 2RBQA 1L27A 212LA 1L40A 3HT8A 145LA 1L21A 3VW7A 1C6QA 1CU0A 3C81A 1SX7A 216LA 3SBBC 250LA 130LA 1G06A 1PQJA 1XEPA 4I7MA 1QTZA 1L48A 1L0KA 3L2XA 113LA 184LA 3G3VA 1L55A 1L41A 4YXCA 1C63A 176LA 2B6YA 1OV7A 1DYEA 3SBAA 1L38A 1L97A 3DMVA 1PQOA 178LA 188LA 1L69A 1L93A 1LI2A 1LGWA 165LA 1QUHA 1L34A 3UONA 1C64A 3EMLA 3GUPA 1G07A 1CV1A 4ARPA 1L99A 3HH5A 1L49A 1L46A 1LWKA 4E97A 108LA 1G0MA 247LA 4I7JA 3C83A 2OU9A 161LA 1L64A 1PQKA 3FADA 4LZMA 169LA 1G0KA 4W56A 115LA 1EPYA 4W51A 160LA 190LA 1L84A 1P7SA 2OU0X 1L33A 164LA 1L63A 3FA0A 3C8SA 1TLAA 223LA 1QUGA 1P3NA 234LA 3C8QA 4I7LA 3F8VA 1L50A 3CDTA 4W55A 1KY0A 3SB6A 1SWYA 1SSYA 3HTDA 4EKQA 1L02A 1D3MA 1L43A 3HDEA 4ARJA 1L94A 3HTBA 1P37A 2HUKA 1L47A 3HU8A 3RZEA 1QTCA 1L75A 2NTHA 1PQDA 173LA 2B6WA 123LA 1C6JA 1L07A 229LA 201LA 260LA 102LA 1OV5A 261LA 220LA 1L0JA 1OWZA 4YX7C 2O4WA 131LA 3GUJA 1CV3A 1L66A 3C7WA 3HU9A 141LA 1G1VA 4ARLA 221LA 1XJTA 3GUKA 4LDLA 4GBRB 1LYEA 1LYDA 2OU8A 2RB1X 195LA 151LA 191LA 239LA 3HUKA 1L96A 1LYIA 3L64A 1PQIA 1KS3A 1P46A 1QT6A 1G0PA 1L24A 1DYBA 1CV0A 1C69A 1L88A 4EKPA 2OTYX 1SX2A 1P36A 1JTMA 3DKEX 1D3NA 3HT7A 242LA 3HUQA 2ANXA 1L45A 1L68A 1T8AA 4ARMB 1QTBA 149LA 1DYDA 3OE9A 1L76A 3SN6R 1L73A 2HUMA 1QT5A 1C60A 137LA 1L19A 1L92A 2OE4X 233LA 2LZMA 1QUDA 3NYAA 3ODUA 148LE 2ANVA 1L22A 3HH6A 1C6GA 183LA 128LA 1P64A 4DKLA 125LA 4W53A 1LYFA 1P2LA 219LA 2HULA 2OE7X 4I7OA 1L04A 142LA 1LYGA 1JTNA 2O79A 2OE9X 1L00A 3FI5A 1L65A 3GUIA 3DN0A 127LA 1QTVA 120LA 4ARMA 1L54A 119LA 163LA 1C6EA 238LA 3HTFA 224LA 1CU6A 1CU2A 157LA 3SB7A 1L91A 110LA 243LA 1L39A 186LA 4OO9A 104LA 2L78A 1L18A 1L59A 257LA 170LA 3RUNA 222LA 1T6HA 2B70A 172LA 240LA 1LGXA 4EXMA 1QSBA 2RAYX 4GRVA 1L52A 1DYGA 235LA 245LA 1L01A 1LYHA 215LA 4IAPA 1L20A 1C6CA 1L09A 1DYCA 3C7ZA 1LWGA 237LA 1XJUA 1LLHA 210LA 181LA 4DJHA 1L60A 140LA 1L44A 1L31A 246LA 218LA 232LA 1ZURA 259LA 2RBNA 3JR6A 3HWLA 143LA 262LA 1CX6A 1L26A 2Z6BA 4LDOA 3F9LA 3NY8A 1CV6A 4EPFA 1C6FA 1LW9A 228LA 1K28A 3DN2A 1CUPA 1P5CA 2B74A 1L79A 1D2WA 1C62A 1NHBA 3HTGA 1CU5A 1L80A 1C66A 1P6YA 1JQUA 182LA 1L62A 2O7AA 255LA 1L30A 2RBOA 236LA 2CUUA 4I7KA 3DNAA 1KW5A 1QSQA 1QS9A 5I14A 3GULA 253LA 166LA 1LPYA 1C6KA 2OEAX 1L81A 4W58A 1L89A 2IGCA 1OYUA 155LA 2A4TA 3CDQA 129LA 4EJ4A 1D3JA 4I7SA 1P56A 2RBRA 2B6TA 4DAJA 3DN6A
chains in the Genus database with same CATH superfamily
230LA 3RNXA 1IOSA 4RLMA 111LA 1B7SA 1GB8A 1L86A 3FE0A 5KJ9A 4NGLA 2Q0MX 5DM9A 1C6LA 4BAPA 4ANRA 1JITA 2Q9DA 1KIPC 1QDRA 1L83A 3QAKA 1YIKA 4PK0A 4NFVA 1HEMA 5I54A 3AGHA 5KXXA 1QUOA 4H90A 4ZPUA 1P2RA 1IEEA 118LA 1LMTA 1HC0A 4XADA 1INUA 1VAUA 4IASA 3QE8A 4NGYA 5D5CA 3HT9A 2MECA 217LA 2EKSC 4W52A 4W59A 2C8PA 4G4BA 1HEOA 4ZIXA 2BQKA 3NY9A 107LA 4B4EA 1FLUA 1SWZA 1G7MC 1CX7A 2YBJA 3EO5A 1B6IA 3OE6A 4I7QA 1LZAA 5HMJA 1QTHA 1WTHA 4XJBA 2DQHY 211LA 3SB9A 1E8LA 1LZDA 248LA 2XTHA 159LA 1L29A 2Z39A 2G4NA 251LA 1L70A 1L06A 4O34A 4HJYA 3WW6A 3GUNA 4NGZA 3WU9A 3DMXA 3AYQA 4NG1A 4D9ZA 5L3IA 4DD0A 109LA 1L67A 1J1XY 4EKRA 4H8YA 254LA 1LI3A 1L82A 3DN4A 5LVHA 5APFA 126LA 1LSGA 5JENB 5KXZA 1QSAA 1G0GA 214LA 1L42A 2RH1A 3IJVA 2NTGA 4GN4A 2F4GA 177LA 3TMXA 4GCBA 4LFXA 209LA 1ZWNA 1L36A 1RFPA 1UIGA 3V2WA 2RBPA 1LYJA 2YVBA 4QDNA 4NGIA 2GV0A 2RBSA 167LA 4KL7A 1L11A 189LA 1F10A 1NDGC 1L71A 1C45A 1GE1A 2BQEA 5FELA 4B0DA 1OVKA 4WL7A 1J1OY 1L98A 1JIYA 2RB0X 1UIFA 1F6RA 1DKKA 1C6NA 3TXJA 3D9AC 1JTTL 3PDSA 2B73A 4H91A 1CKHA 4AGAA 4S0WA 1G0JA 1C6IA 1DI5A 1LYOA 2HEDA 1L25A 2RBQA 5I4YA 4HTQA 1NDMC 3C81A 1WQQA 4WM3A 250LA 1B5ZA 1I56A 1QTZA 113LA 1F6SA 5KXNA 1IP7A 1LSZA 3WVXA 1WQOA 1FLQA 4ML7A 1L34A 1DKJA 1CKDA 3GUPA 1JTOL 1CKGA 1GE3A 1GD6A 3HH5A 4E97A 1GDXA 3CSZA 161LA 4DDCA 5KY1A 4MCKA 1G0KA 1YKYX 4W56A 4DD3A 3A91A 115LA 3M18B 3A6BY 1EQ5A 1WQPA 4HP0A 164LA 1L63A 4WM6A 2B5ZA 1JPOA 1QUGA 3M3UA 1LJGA 3CDTA 4NHQA 3SB6A 3HTDA 194LA 3B0KA 4DD2A 1B2KA 1L02A 1AM7A 1LJIA 4TWSA 3TMVA 5B1FA 1LZBA 2HUKA 3RZEA 1QTCA 2HEEA 1PQDA 173LA 2B6WA 3EBAB 1GFRA 1LSEA 1C6JA 4Z3MA 3A8ZA 1L0JA 1OWZA 5LXWA 3HU9A 4ARLA 3GUKA 1OQMA 4QY9A 1RJCB 208LA 1V7TA 4M6DA 3W6BA 2I6ZA 3A95A 3HUKA 1LYIA 3B0IA 3B72A 1D0KA 1LZSA 1HERA 1LZYA 1GBZA 1CV0A 4H92A 4MR1A 2BQMA 5LIOA 4NGVA 2Y8PA 2BLYA 4OWCA 2ZIKA 5T3FA 4XJHA 3TXIA 1L45A 1T8AA 5LVKA 1QTBA 1UA6Y 4G49A 149LA 3SN6R 4DWXA 4RW1A 2CDSA 2YDGA 1LZ9A 1L19A 5L3HA 1B5VA 5LYZA 3ODUA 3WW5A 1L22A 1VDTA 5J7CA 1C6GA 183LA 1RE2A 4CHXA 4DKLA 2FBDA 219LA 2OE7X 2DBTA 2O79A 2BPUA 1LJHA 3FI5A 1ALCA 2ZILA 1CJ8A 127LA 1L54A 1BWJA 3LZ2A 1CU6A 4FDYA 3SB7A 243LA 110LA 186LA 4OO9A 4PRQA 1L18A 1UIBA 170LA 1IWXA 1YAPA 1XGRC 222LA 2B70A 1TEWA 5EBHA 2ZWBA 2F30A 4I0CA 1OUAA 1IOCA 1WQNA 215LA 2X0AA 1C6CA 1L09A 1XJUA 1LSCA 1L60A 140LA 1L44A 1OUHA 232LA 4DQ5A 1LJKA 1JWRA 5KXYA 1CX6A 5LVJA 1CV6A 4EPFA 1LJ3A 228LA 1K28A 1GPQC 4G4HA 1CUPA 2B74A 5I4XA 1VDPA 1L79A 4DT3A 4NHSA 1CU5A 3WXTA 1P6YA 3W6FA 1RCMA 4IJ4A 2CUUA 2EIZC 1HFZA 1QSQA 1QS9A 5I14A 3CT0A 4DD9A 2OEAX 1C6KA 5B1GA 3WUMA 3WMKA 3OJPA 1LHJA 129LA 3P64A 1IWZA 1P56A 3K3TA 2RBRA 1FDLY 4YENA 1F0WA 1HMLA 5KXWA 3B6LA 196LA 1C6MA 2Z37A 3B0OA 5LAFA 1OUDA 1HSWA 4WM4A 1NBZC 3AGGG 1QUSA 1KW7A 1QSWA 1HSXA 1QT8A 3PBLA 5B59A 3G3WA 2H9KA 1FKQA 2RB2X 249LA 1L72A 3HH3A 1UIHA 187LA 1XGQC 4WG7A 3D4SA 3K2RA 1GFJA 1L05A 1IWTA 1OVJA 5AMYA 4BADA 2DQAA 1QS5A 1TCYA 3IJUA 114LA 3AZ4A 4RLNA 4WO9A 1KXXA 4PJZA 2YBHA 1GF3A 1D9WA 1KNIA 2B6XA 1L56A 1W6ZA 1DYAA 1LHHA 1L85A 2LCBA 4Z98A 2A7FA 1SLYA 1L35A 3VWOA 1IIZA 1YL0X 1LJNA 1GXXA 1GB9A 1DXJA 2AUBA 3GUMA 3V2YA 4R6CA 4HTKA 1LMPA 1L90A 1LGUA 4WM5A 1L57A 4H8XA 1PQMA 1C65A 1T8FA 2G4PA 3P68A 4H9EA 4CJ2A 2Z12A 1C6PA 2B75A 1D2YA 1NQIA 3WULA 1GE4A 1IO5A 4I7PA 1IP6A 1IWYA 2MEIA 1CU3A 4ZFPA 2F4AA 1L77A 2B72A 4ET8A 252LA 1YKXX 3ZEKA 197LA 2A7DA 1OWYA 4LYCA 1JKBA 4XYYA 1OUFA 1WTNA 2XJWA 6LZMA 3FI7A 3A6CY 1T97A 3WPKA 207LA 1SSWA 2Z2FA 3DN3A 1MLCE 2BQCA 1LOZA 4XJGA 2ZIJA 4OWHA 5KXPA 2F2NA 5I53A 2F32A 1LSMA 2B7XA 4I8SA 2VB1A 1QUTA 241LA 2MEGA 1D9UA 1LSAA 216LA 1D6QA 132LA 1DPWA 4C5FA 1C63A 2B6YA 3CT5A 3LN2A 4WM2A 178LA 4Z46A 1L69A 1LGWA 165LA 5I5QA 1CKFA 2PC2A 1C64A 3J4GA 5IDDA 1H87A 1CV1A 1L49A 1L46A 1C08C 1G0MA 1W08A 4I7JA 2OU9A 1GDWA 1GF7A 4LZMA 3TXHA 1EPYA 1GHLA 1JSFA 1L33A 4H8ZA 1V7SA 4X3BA 3C8SA 5KXOA 1P3NA 2ZNWY 1XGPC 4ET9A 4I7LA 3F8VA 4PGJB 4XN6A 133LA 2BQGA 1GBXA 9LYZA 1SSYA 4EKQA 4YEOA 1P2CC 1GBWA 2FYDA 4NSGA 3HTBA 1L47A 4UWUA 4WLXA 3AW6A 201LA 260LA 1HNLA 135LA 1B5WA 220LA 4KPMA 1LZRA 1L66A 1AT6A 3QY4A 5KXMA 5B05A 1XFPL 6LYZA 1A4VA 2YBIA 4Z41A 2OU8A 2RB1X 1IOQA 195LA 4ETEA 1UCOA 5LYMA 3L64A 4LGKA 2XBRA 1B5UA 3CSQA 1G0PA 2FYCA 1L24A 1C69A 1IY4A 1GB6A 2OTYX 2WARA 2G4QA 1D3NA 2DQEY 2W1XA 1LJ4A 1GBYA 1YANA 1L68A 1ZV5L 1DYDA 3OE9A 1L73A 1QT5A 1GF8A 2LZTA 2BQBA 137LA 4LT0A 233LA 4KXIA 2HU1A 3P65A 4ETBA 148LE 1EQ4A 1ZVHL 2OE9X 1L00A 2HEAA 3GUIA 1GF4A 5A3EA 1C6EA 1NMMA 3TXGA 3HTFA 1BWHA 4YEMA 1L91A 4IATA 257LA 4DYGA 172LA 240LA 1LKSA 4EXMA 1IC4Y 3F6ZA 2RAYX 4PRUA 5K7OA 1YAMA 1DYGA 2MEHA 2LYMA 4NHTA 1DYCA 1UIEA 2ZNXY 237LA 210LA 1QTKA 1UIAA 4J1BA 246LA 4WLTA 259LA 1T6VL 1NBYC 3HWLA 143LA 262LA 1JSEA 1L26A 4LDOA 1LHMA 1RI8B 1LW9A 4EMNA 2I25L 5KKJA 2D6BA 3N9EA 2H9JA 1LSYA 182LA 4NG8A 3HBHA 1XGTC 236LA 4OOTA 1LPYA 1UIDA 1JUGA 1G7HC 3BKHA 1L89A 2IGCA 1OYUA 4N9RA 4EJ4A 1DI3A 2B6TA 4EOFA 175LA 1L23A 4I7RA 2CGIA 205LA 225LA 2Z18A 2CWIA 146LA 1REMA 4H9IA 171LA 1LI6A 4C3WA 3CDVA 3HDFA 5IELA 139LA 103LA 1B7MA 256LA 2B6ZA 1QT3A 1B7OA 2DQJY 1ZMYL 2MEAA 4RDSA 1D6PA 1GBOA 2DQIY 1TDYA 3AGIA 4B4IA 193LA 4LT1A 1B7LA 3HBEX 3DN1A 5D5FA 3HH4A 1L15A 4NGJA 1GF6A 3HBDA 152LA 3C8RA 1CVKA 2Q9EA 1JEFA 1LZNA 2XBSA 5C6JA 1L51A 3WU7A 199LA 2DQGY 1FKVA 5LYTA 4HJVA 4LDEA 1WQRA 1L03A 1GBSA 3SB8A 4WOAA 4NEBA 2HUBA 180LA 1L10A 4NY5A 3E3DA 1L58A 1XGUC 1L13A 1LTMA 200LA 1UC0A 3W6CA 1IP3A 2F47A 4OWEA 1L53A 3A3RX 1LAAA 4G4CA 185LA 1H6MA 153LA 1UBZA 3RU5A 1BHZA 1IWVA 244LA 3AJNA 1OVHA 4HSFA 158LA 1L37A 2ZYCA 3GUOA 4GLVA 3RW8A 3WU8A 1KXWA 4NSIA 4EPIA 1IY3A 1G1WA 2BQAA 2LHMA 5ILCA 2RSCA 3DN8A 1QTEA 1C68A 3C7YA 3W6AA 2OTZX 4W57A 3WXUA 2BQIA 2D4JA 1C6TA 3HUAA 1Z55A 3OE0A 2QARC 4II8A 4ETDA 4K5YA 2DQDY 2RAZX 1QT7A 4AQNA 3C82A 1LJFA 174LA 4EKSA 213LA 156LA 3W6DA 2CJLA 1HEWA 1L61A 1G7JC 5DN5A 1B7NA 5LA8A 4I7TA 5FEKA 1T8GA 1IR8A 4PPOA 1IOTA 5KXLA 2NWDX 3OE8A 4YOPA 7LZMA 3N9AA 5E4PA 4W54A 1IVMA 1HELA 2YSSC 3WUNA 1I6SA 1YAQA 2BLXA 1LCNA 231LA 4CFOA 2HEBA 1KIRC 1L08A 5E9RA 1WVVA 1B0DA 1L12A 3DMZA 1LYSA 5LZMA 1L16A 1VEDA 122LA 1L40A 5KKIA 145LA 1L21A 1LZEA 3GXRA 1IORA 1SX7A 3SBBC 4TX7A 1XEPA 5LINA 1T3PA 1IC5Y 4B49A 1L55A 1L41A 2BQJA 3CT1A 176LA 3A3QA 1DYEA 1L97A 3DMVA 4WLYA 1PQOA 188LA 1L93A 5DL9A 1QUHA 1LJJA 2MEBA 2W1LA 3EMLA 4G9SA 5FHWA 4LT2A 1G07A 1QIOA 247LA 4HJZA 4J1AA 3IWRA 3C83A 1L64A 3FADA 3D3DA 2IFFY 190LA 1L84A 2OU0X 3WPJA 4OOOA 1IP4A 3A96A 134LA 1GFUA 1TLAA 4NGWA 223LA 1DPXA 3TXKA 1LSFA 1LSDA 3TXFA 5C6LA 1HMKA 2YBNA 2Z38A 1C10A 1SWYA 4GCEA 1D0MA 3HDEA 2I26L 3TXEA 3TMUA 3LYOA 1LYZA 1GF9A 4XJFA 1YKZX 6LYTA 1L75A 3CB7A 3W6EA 1JJ3A 123LA 5F9UA 1VDQA 1LMNA 102LA 1GAZA 261LA 4OW1A 2D91A 1EQEA 3W3EA 1CV3A 3C7WA 141LA 4H9CA 5KXKA 1WVUA 221LA 1XJTA 154LA 5LVIA 3ULRA 1C43A 3WVYA 1QDTA 191LA 1BGIA 3AZ6A 4AXTA 3TMWA 1L96A 4XENA 1B9OA 2YBLA 1PQIA 2BQOA 1P46A 1QT6A 1BQLY 4TTDA 1DYBA 4DDBA 3LYMA 4WL6A 1FLYA 1O23A 1GFAA 4EKPA 1P36A 1JTMA 3DKEX 3HT7A 3HUQA 2ANXA 2DQCY 4NGKA 4LFPA 1A2YC 4HV2A 1MELL 4XJIA 1FN5A 2HEFA 2HUMA 4HPEA 1C60A 4UWNA 5HNCA 5FCPA 3A93A 4BAFA 2OE4X 2LZMA 3WYHA 1QUDA 2HECA 4LYBA 4ZEEA 1GFKA 2ANVA 3SP3A 3HH6A 4LT3A 2EQLA 1XEKA 4LZTA 128LA 1OUCA 1GE2A 1HHLA 1LHLA 1LYFA 4I7OA 4N8ZA 1L04A 1LYGA 1JTNA 1IR7A 3WUAA 3T36A 1L65A 3DN0A 1JKAA 1IP5A 1HF4A 119LA 163LA 4FJRA 224LA 1BB3A 1CU2A 1C7PA 4NSJA 1LPIA 1L39A 2D4KA 104LA 1JKDA 4HV1A 1B5XA 1L59A 3RUNA 1OUEA 1XEJA 1T6HA 1LMQA 1GB7A 2XQOA 1UICA 1LGXA 1YQVY 1L52A 235LA 245LA 4NWHA 4GN5C 2FBBA 5ILFA 4B4JA 4N5RA 1GF0A 3EXDA 1ZVYB 1REZA 2HU3A 3C7ZA 1GEVA 1LLHA 2YBMA 4WM1A 1L31A 218LA 5II3A 3A92A 1ZURA 1NHEA 1GEZA 1GAYA 2RBNA 3JR6A 3A94A 4MSTA 1LYYA 3NY8A 1HFYA 1C6FA 3DN2A 3WH1A 3T6UA 1LZ8A 5KXRA 1P5CA 4CFPA 5HNLA 1KXYA 1L80A 4DC4A 1C66A 1LSPA 4WG1A 1YL1X 1JQUA 4L41A 2IHLA 5APEA 1CJ9A 4LYOA 5HQ1A 4I7KA 3DNAA 1OUGA 1XEIA 1BB4A 253LA 1JTPL 166LA 1IP2A 1L81A 1LZ5A 155LA 1GF5A 1GWDA 3N9CA 1GB0A 4I7SA 3A67Y 1GB3A 4DAJA 1GFEA 4J7VA 1CV4A 3AZ7A 4E3UA 4HTNA 5B07A 1QT4A 1KY1A 1B7RA 5IHGA 2MEDA 2MEFA 4H9HA 1JJ0A 1QTDA 2BAAA 3WL2A 168LA 1G0QA 3LZMA 4ARQB 5M1YA 5APDA 4OWBA 4YXAC 1IWUA 1WQMA 2LC9A 226LA 1J1PY 3OK0A 2F2QA 3QNGA 1G7IC 3HT6A 1C6HA 4N0JA 4B1AA 162LA 1B7PA 1HFXA 3CDRA 1IP1A 1C6DA 1L14A 1C67A 4NWEA 1SQ2L 1G0LA 1CV5A 1C61A 138LA 1AZFA 4ARQA 1IWWA 1L17A 1LSBA 2QB0B 4WO6A 1UACY 1LMCA 150LA 3SB5A 2LYZA 1GFHA 1TBYA 144LA 258LA 1G7LC 4DQ7A 5DN4A 1PS5A 1C6BA 1L74A 1ZYTA 4ETAA 1HEPA 4H93A 4U3XB 3P4ZA 198LA 3A90A 1L87A 4PJ2C 1NKHA 3LYTA 1LZCA 3BKVA 1I1ZA 4NHIA 4J0LA 2LYOA 3C80A 4GCCA 4CGEA 4QGZA 4H9FA 5B06A 1D3FA 1YILA 4R0FA 3G3XA 1NWGA 5KXSA 2C8OA 1L95A 192LA 2Z2EA 112LA 1CTWA 1FLWA 1VDSA 3A34A 5C6IA 4A7DA 3LHMA 1C6AA 1CUQA 2LZ2A 1JJ1A 4I7NA 2W1MA 3CDOA 4LYZA 4HPIA 3GXKA 1DYFA 4DDAA 1L32A 4TSBA 1LZGA 1JKCA 227LA 1L28A 1PZYA 1GB5A 147LA 206LA 2Z19A 1L27A 212LA 3LZTA 2ZQ4A 4YM8A 5HMVA 3HT8A 4WMGA 1IX0A 3VW7A 1C6QA 1CU0A 1LHKA 5F16A 130LA 1G06A 1PQJA 4I7MA 1L48A 1L0KA 1VFBC 3L2XA 4NHPA 184LA 3G3VA 4OWAA 2MEEA 4YXCA 4WLDA 1OV7A 2D4IA 1I20A 1LZ6A 1L38A 3SBAA 2W1YA 3ZVQB 1LI2A 4H94A 1JHLA 3UONA 3WPLA 1LJEA 1BB7A 3G3AB 4ARPA 1L99A 1LWKA 108LA 1D0LA 1C46A 2DQFC 3P66A 5DLAA 1PQKA 169LA 5LAGA 3KAMA 3AB6A 4W51A 160LA 1LZ4A 1P7SA 3FA0A 2EPEA 1DI4A 4N1EI 5F14A 5LVGA 5KXTA 3ZVQA 234LA 3C8QA 1L50A 8LYZA 3TXBA 4W55A 1KY0A 2ZYPA 1D3MA 1GFVA 1L43A 4ARJA 3ATOA 1L94A 3RZ4A 4DD1A 1P37A 1UUZC 3CQLA 3HU8A 2HTXA 4LYMA 4DQJA 1BWIA 2N5ZA 2NTHA 1L07A 229LA 5APCA 5A3ZA 1OV5A 1VATA 4YX7C 1BVKC 2O4WA 131LA 3GUJA 1LSNA 1G1VA 4NSHA 1NF5A 4LDLA 4NGOA 1CNSA 4GBRB 1CJ7A 1LYEA 1LYDA 1WTMA 3AW7A 151LA 4W96A 4M4OA 239LA 4YF2A 4N1CC 1KS3A 1QQYA 4UWVA 4LYTA 5F9XA 1L88A 3J6KA 1SX2A 4XJDA 2BQFA 5F81A 3AZ5A 242LA 4ARMB 4P2EA 3LYZA 1L76A 1AT5A 1IR9A 2H5ZA 1L92A 1AKIA 3RT5X 1BVXA 3NYAA 4TUNA 1N4FA 4KT3A 4QEQA 4H1PA 1OUBA 1CJ6A 1P64A 1XSFA 125LA 1BB6A 4W53A 2HULA 1P2LA 142LA 1LMAA 1IC7Y 1OUJA 1QTVA 120LA 1YROA 1LKRA 4ARMA 4TSCA 238LA 3TXDA 1JISA 157LA 2L78A 4W94A 2BQDA 4GCFA 1LMOA 1LZ1A 2DKVA 2BQLA 1GXV2 1QSBA 4RW2A 1DQJC 5L9JA 4GRVA 5LA5A 1CKCA 1HENA 1L01A 1LYHA 4IAPA 4H9BA 1B7QA 3MGWA 1L20A 1LHIA 3ATNA 1TAYA 1LWGA 1HEQA 181LA 1GFGA 4DJHA 1GFTA 1BB5A 4GLAA 4BS7A 4NIJA 4GN3A 1GB2A 4PHIA 7LYZA 2Z6BA 3F9LA 1KIQC 4ETCA 3HFMY 5FDJA 1OP9B 1D2WA 1C62A 1NHBA 3HTGA 4H9AA 1GE0A 1REXA 1REYA 1L62A 2BQHA 2O7AA 1B5YA 255LA 1L30A 1FBIX 2ZQ3A 2RBOA 4GCDA 1EL1A 1KW5A 1YAOA 5HLLA 1DZBX 4DD7A 3GULA 3EMSA 5I4WA 4W58A 3G3BB 2BQNA 1LZTA 2A4TA 3CDQA 3CSRA 1D3JA 1OUIA 5FSTA 3DN6A
chains in the Genus database with same CATH topology
230LA 3RNXA 1IOSA 4RLMA 111LA 1B7SA 1GB8A 1L86A 3FE0A 5KJ9A 4NGLA 2Q0MX 5DM9A 1C6LA 4BAPA 4ANRA 1JITA 2Q9DA 1KIPC 1QDRA 1L83A 3QAKA 1YIKA 4PK0A 4NFVA 1HEMA 5I54A 3AGHA 5KXXA 1QUOA 4H90A 4ZPUA 1P2RA 1IEEA 118LA 1LMTA 1HC0A 4XADA 1INUA 1VAUA 4IASA 3QE8A 4NGYA 5D5CA 3HT9A 2MECA 217LA 2EKSC 4W52A 4W59A 2C8PA 4G4BA 1HEOA 4ZIXA 2BQKA 3NY9A 107LA 4B4EA 1FLUA 1SWZA 1G7MC 1CX7A 2YBJA 3EO5A 1B6IA 3OE6A 4I7QA 1LZAA 5HMJA 1QTHA 1WTHA 4XJBA 2DQHY 211LA 3SB9A 1E8LA 1LZDA 248LA 2XTHA 159LA 1L29A 2Z39A 2G4NA 251LA 1L70A 1L06A 4O34A 4HJYA 3WW6A 3GUNA 4NGZA 3WU9A 3DMXA 3AYQA 4NG1A 4D9ZA 5L3IA 4DD0A 109LA 1L67A 1J1XY 4EKRA 4H8YA 254LA 1LI3A 1L82A 3DN4A 5LVHA 5APFA 126LA 1LSGA 5JENB 5KXZA 1QSAA 1G0GA 214LA 1L42A 2RH1A 3IJVA 2NTGA 4GN4A 2F4GA 177LA 3TMXA 4GCBA 4LFXA 209LA 1ZWNA 1L36A 1RFPA 1UIGA 3V2WA 2RBPA 1LYJA 2YVBA 4QDNA 4NGIA 2GV0A 2RBSA 167LA 4KL7A 1L11A 189LA 1F10A 1NDGC 1L71A 1C45A 1GE1A 2BQEA 5FELA 4B0DA 1OVKA 4WL7A 1J1OY 1L98A 1JIYA 2RB0X 1UIFA 1F6RA 1DKKA 1C6NA 3TXJA 3D9AC 1JTTL 3PDSA 2B73A 4H91A 1CKHA 4AGAA 4S0WA 1G0JA 1C6IA 1DI5A 1LYOA 2HEDA 1L25A 2RBQA 5I4YA 4HTQA 1NDMC 3C81A 1WQQA 4WM3A 250LA 1B5ZA 1I56A 1QTZA 113LA 1F6SA 5KXNA 1IP7A 1LSZA 3WVXA 1WQOA 1FLQA 4ML7A 1L34A 1DKJA 1CKDA 3GUPA 1JTOL 1CKGA 1GE3A 1GD6A 3HH5A 4E97A 1GDXA 3CSZA 161LA 4DDCA 5KY1A 4MCKA 1G0KA 1YKYX 4W56A 4DD3A 3A91A 115LA 3M18B 3A6BY 1EQ5A 1WQPA 4HP0A 164LA 1L63A 4WM6A 2B5ZA 1JPOA 1QUGA 3M3UA 1LJGA 3CDTA 4NHQA 3SB6A 3HTDA 194LA 3B0KA 4DD2A 1B2KA 1L02A 1AM7A 1LJIA 4TWSA 3TMVA 5B1FA 1LZBA 2HUKA 3RZEA 1QTCA 2HEEA 1PQDA 173LA 2B6WA 3EBAB 1GFRA 1LSEA 1C6JA 4Z3MA 3A8ZA 1L0JA 1OWZA 5LXWA 3HU9A 4ARLA 3GUKA 1OQMA 4QY9A 1RJCB 208LA 1V7TA 4M6DA 3W6BA 2I6ZA 3A95A 3HUKA 1LYIA 3B0IA 3B72A 1D0KA 1LZSA 1HERA 1LZYA 1GBZA 1CV0A 4H92A 4MR1A 2BQMA 5LIOA 4NGVA 2Y8PA 2BLYA 4OWCA 2ZIKA 5T3FA 4XJHA 3TXIA 1L45A 1T8AA 5LVKA 1QTBA 1UA6Y 4G49A 149LA 3SN6R 4DWXA 4RW1A 2CDSA 2YDGA 1LZ9A 1L19A 5L3HA 1B5VA 5LYZA 3ODUA 3WW5A 1L22A 1VDTA 5J7CA 1C6GA 183LA 1RE2A 4CHXA 4DKLA 2FBDA 219LA 2OE7X 2DBTA 2O79A 2BPUA 1LJHA 3FI5A 1ALCA 2ZILA 1CJ8A 127LA 1L54A 1BWJA 3LZ2A 1CU6A 4FDYA 3SB7A 243LA 110LA 186LA 4OO9A 4PRQA 1L18A 1UIBA 170LA 1IWXA 1YAPA 1XGRC 222LA 2B70A 1TEWA 5EBHA 2ZWBA 2F30A 4I0CA 1OUAA 1IOCA 1WQNA 215LA 2X0AA 1C6CA 1L09A 1XJUA 1LSCA 1L60A 140LA 1L44A 1OUHA 232LA 4DQ5A 1LJKA 1JWRA 5KXYA 1CX6A 5LVJA 1CV6A 4EPFA 1LJ3A 228LA 1K28A 1GPQC 4G4HA 1CUPA 2B74A 5I4XA 1VDPA 1L79A 4DT3A 4NHSA 1CU5A 3WXTA 1P6YA 3W6FA 1RCMA 4IJ4A 2CUUA 2EIZC 1HFZA 1QSQA 1QS9A 5I14A 3CT0A 4DD9A 2OEAX 1C6KA 5B1GA 3WUMA 3WMKA 3OJPA 1LHJA 129LA 3P64A 1IWZA 1P56A 3K3TA 2RBRA 1FDLY 4YENA 1F0WA 1HMLA 5KXWA 3B6LA 196LA 1C6MA 2Z37A 3B0OA 5LAFA 1OUDA 1HSWA 4WM4A 1NBZC 3AGGG 1QUSA 1KW7A 1QSWA 1HSXA 1QT8A 3PBLA 5B59A 3G3WA 2H9KA 1FKQA 2RB2X 249LA 1L72A 3HH3A 1UIHA 187LA 1XGQC 4WG7A 3D4SA 3K2RA 1GFJA 1L05A 1IWTA 1OVJA 5AMYA 4BADA 2DQAA 1QS5A 1TCYA 3IJUA 114LA 3AZ4A 4RLNA 4WO9A 1KXXA 4PJZA 2YBHA 1GF3A 1D9WA 1KNIA 2B6XA 1L56A 1W6ZA 1DYAA 1LHHA 1L85A 2LCBA 4Z98A 2A7FA 1SLYA 1L35A 3VWOA 1IIZA 1YL0X 1LJNA 1GXXA 1GB9A 1DXJA 2AUBA 3GUMA 3V2YA 4R6CA 4HTKA 1LMPA 1L90A 1LGUA 4WM5A 1L57A 4H8XA 1PQMA 1C65A 1T8FA 2G4PA 3P68A 4H9EA 4CJ2A 2Z12A 1C6PA 2B75A 1D2YA 1NQIA 3WULA 1GE4A 1IO5A 4I7PA 1IP6A 1IWYA 2MEIA 1CU3A 4ZFPA 2F4AA 1L77A 2B72A 4ET8A 252LA 1YKXX 3ZEKA 197LA 2A7DA 1OWYA 4LYCA 1JKBA 4XYYA 1OUFA 1WTNA 2XJWA 6LZMA 3FI7A 3A6CY 1T97A 3WPKA 207LA 1SSWA 2Z2FA 3DN3A 1MLCE 2BQCA 1LOZA 4XJGA 2ZIJA 4OWHA 5KXPA 2F2NA 5I53A 2F32A 1LSMA 2B7XA 4I8SA 2VB1A 1QUTA 241LA 2MEGA 1D9UA 1LSAA 216LA 1D6QA 132LA 1DPWA 4C5FA 1C63A 2B6YA 3CT5A 3LN2A 4WM2A 178LA 4Z46A 1L69A 1LGWA 165LA 5I5QA 1CKFA 2PC2A 1C64A 3J4GA 5IDDA 1H87A 1CV1A 1L49A 1L46A 1C08C 1G0MA 1W08A 4I7JA 2OU9A 1GDWA 1GF7A 4LZMA 3TXHA 1EPYA 1GHLA 1JSFA 1L33A 4H8ZA 1V7SA 4X3BA 3C8SA 5KXOA 1P3NA 2ZNWY 1XGPC 4ET9A 4I7LA 3F8VA 4PGJB 4XN6A 133LA 2BQGA 1GBXA 9LYZA 1SSYA 4EKQA 4YEOA 1P2CC 1GBWA 2FYDA 4NSGA 3HTBA 1L47A 4UWUA 4WLXA 3AW6A 201LA 260LA 1HNLA 135LA 1B5WA 220LA 4KPMA 1LZRA 1L66A 1AT6A 3QY4A 5KXMA 5B05A 1XFPL 6LYZA 1A4VA 2YBIA 4Z41A 2OU8A 2RB1X 1IOQA 195LA 4ETEA 1UCOA 5LYMA 3L64A 4LGKA 2XBRA 1B5UA 3CSQA 1G0PA 2FYCA 1L24A 1C69A 1IY4A 1GB6A 2OTYX 2WARA 2G4QA 1D3NA 2DQEY 2W1XA 1LJ4A 1GBYA 1YANA 1L68A 1ZV5L 1DYDA 3OE9A 1L73A 1QT5A 1GF8A 2LZTA 2BQBA 137LA 4LT0A 233LA 4KXIA 2HU1A 3P65A 4ETBA 148LE 1EQ4A 1ZVHL 2OE9X 1L00A 2HEAA 3GUIA 1GF4A 5A3EA 1C6EA 1NMMA 3TXGA 3HTFA 1BWHA 4YEMA 1L91A 4IATA 257LA 4DYGA 172LA 240LA 1LKSA 4EXMA 1IC4Y 3F6ZA 2RAYX 4PRUA 5K7OA 1YAMA 1DYGA 2MEHA 2LYMA 4NHTA 1DYCA 1UIEA 2ZNXY 237LA 210LA 1QTKA 1UIAA 4J1BA 246LA 4WLTA 259LA 1T6VL 1NBYC 3HWLA 143LA 262LA 1JSEA 1L26A 4LDOA 1LHMA 1RI8B 1LW9A 4EMNA 2I25L 5KKJA 2D6BA 3N9EA 2H9JA 1LSYA 182LA 4NG8A 3HBHA 1XGTC 236LA 4OOTA 1LPYA 1UIDA 1JUGA 1G7HC 3BKHA 1L89A 2IGCA 1OYUA 4N9RA 4EJ4A 1DI3A 2B6TA 4EOFA 175LA 1L23A 4I7RA 2CGIA 205LA 225LA 2Z18A 2CWIA 146LA 1REMA 4H9IA 171LA 1LI6A 4C3WA 3CDVA 3HDFA 5IELA 139LA 103LA 1B7MA 256LA 2B6ZA 1QT3A 1B7OA 2DQJY 1ZMYL 2MEAA 4RDSA 1D6PA 1GBOA 2DQIY 1TDYA 3AGIA 4B4IA 193LA 4LT1A 1B7LA 3HBEX 3DN1A 5D5FA 3HH4A 1L15A 4NGJA 1GF6A 3HBDA 152LA 3C8RA 1CVKA 2Q9EA 1JEFA 1LZNA 2XBSA 5C6JA 1L51A 3WU7A 199LA 2DQGY 1FKVA 5LYTA 4HJVA 4LDEA 1WQRA 1L03A 1GBSA 3SB8A 4WOAA 4NEBA 2HUBA 180LA 1L10A 4NY5A 3E3DA 1L58A 1XGUC 1L13A 1LTMA 200LA 1UC0A 3W6CA 1IP3A 2F47A 4OWEA 1L53A 3A3RX 1LAAA 4G4CA 185LA 1H6MA 153LA 1UBZA 3RU5A 1BHZA 1IWVA 244LA 3AJNA 1OVHA 4HSFA 158LA 1L37A 2ZYCA 3GUOA 4GLVA 3RW8A 3WU8A 1KXWA 4NSIA 4EPIA 1IY3A 1G1WA 2BQAA 2LHMA 5ILCA 2RSCA 3DN8A 1QTEA 1C68A 3C7YA 3W6AA 2OTZX 4W57A 3WXUA 2BQIA 2D4JA 1C6TA 3HUAA 1Z55A 3OE0A 2QARC 4II8A 4ETDA 4K5YA 2DQDY 2RAZX 1QT7A 4AQNA 3C82A 1LJFA 174LA 4EKSA 213LA 156LA 3W6DA 2CJLA 1HEWA 1L61A 1G7JC 5DN5A 1B7NA 5LA8A 4I7TA 5FEKA 1T8GA 1IR8A 4PPOA 1IOTA 5KXLA 2NWDX 3OE8A 4YOPA 7LZMA 3N9AA 5E4PA 4W54A 1IVMA 1HELA 2YSSC 3WUNA 1I6SA 1YAQA 2BLXA 1LCNA 231LA 4CFOA 2HEBA 1KIRC 1L08A 5E9RA 1WVVA 1B0DA 1L12A 3DMZA 1LYSA 5LZMA 1L16A 1VEDA 122LA 1L40A 5KKIA 145LA 1L21A 1LZEA 3GXRA 1IORA 1SX7A 3SBBC 4TX7A 1XEPA 5LINA 1T3PA 1IC5Y 4B49A 1L55A 1L41A 2BQJA 3CT1A 176LA 3A3QA 1DYEA 1L97A 3DMVA 4WLYA 1PQOA 188LA 1L93A 5DL9A 1QUHA 1LJJA 2MEBA 2W1LA 3EMLA 4G9SA 5FHWA 4LT2A 1G07A 1QIOA 247LA 4HJZA 4J1AA 3IWRA 3C83A 1L64A 3FADA 3D3DA 2IFFY 190LA 1L84A 2OU0X 3WPJA 4OOOA 1IP4A 3A96A 134LA 1GFUA 1TLAA 4NGWA 223LA 1DPXA 3TXKA 1LSFA 1LSDA 3TXFA 5C6LA 1HMKA 2YBNA 2Z38A 1C10A 1SWYA 4GCEA 1D0MA 3HDEA 2I26L 3TXEA 3TMUA 3LYOA 1LYZA 1GF9A 4XJFA 1YKZX 6LYTA 1L75A 3CB7A 3W6EA 1JJ3A 123LA 5F9UA 1VDQA 1LMNA 102LA 1GAZA 261LA 4OW1A 2D91A 1EQEA 3W3EA 1CV3A 3C7WA 141LA 4H9CA 5KXKA 1WVUA 221LA 1XJTA 154LA 5LVIA 3ULRA 1C43A 3WVYA 1QDTA 191LA 1BGIA 3AZ6A 4AXTA 3TMWA 1L96A 4XENA 1B9OA 2YBLA 1PQIA 2BQOA 1P46A 1QT6A 1BQLY 4TTDA 1DYBA 4DDBA 3LYMA 4WL6A 1FLYA 1O23A 1GFAA 4EKPA 1P36A 1JTMA 3DKEX 3HT7A 3HUQA 2ANXA 2DQCY 4NGKA 4LFPA 1A2YC 4HV2A 1MELL 4XJIA 1FN5A 2HEFA 2HUMA 4HPEA 1C60A 4UWNA 5HNCA 5FCPA 3A93A 4BAFA 2OE4X 2LZMA 3WYHA 1QUDA 2HECA 4LYBA 4ZEEA 1GFKA 2ANVA 3SP3A 3HH6A 4LT3A 2EQLA 1XEKA 4LZTA 128LA 1OUCA 1GE2A 1HHLA 1LHLA 1LYFA 4I7OA 4N8ZA 1L04A 1LYGA 1JTNA 1IR7A 3WUAA 3T36A 1L65A 3DN0A 1JKAA 1IP5A 1HF4A 119LA 163LA 4FJRA 224LA 1BB3A 1CU2A 1C7PA 4NSJA 1LPIA 1L39A 2D4KA 104LA 1JKDA 4HV1A 1B5XA 1L59A 3RUNA 1OUEA 1XEJA 1T6HA 1LMQA 1GB7A 2XQOA 1UICA 1LGXA 1YQVY 1L52A 235LA 245LA 4NWHA 4GN5C 2FBBA 5ILFA 4B4JA 4N5RA 1GF0A 3EXDA 1ZVYB 1REZA 2HU3A 3C7ZA 1GEVA 1LLHA 2YBMA 4WM1A 1L31A 218LA 5II3A 3A92A 1ZURA 1NHEA 1GEZA 1GAYA 2RBNA 3JR6A 3A94A 4MSTA 1LYYA 3NY8A 1HFYA 1C6FA 3DN2A 3WH1A 3T6UA 1LZ8A 5KXRA 1P5CA 4CFPA 5HNLA 1KXYA 1L80A 4DC4A 1C66A 1LSPA 4WG1A 1YL1X 1JQUA 4L41A 2IHLA 5APEA 1CJ9A 4LYOA 5HQ1A 4I7KA 3DNAA 1OUGA 1XEIA 1BB4A 253LA 1JTPL 166LA 1IP2A 1L81A 1LZ5A 155LA 1GF5A 1GWDA 3N9CA 1GB0A 4I7SA 3A67Y 1GB3A 4DAJA 1GFEA 4J7VA 1CV4A 3AZ7A 4E3UA 4HTNA 5B07A 1QT4A 1KY1A 1B7RA 5IHGA 2MEDA 2MEFA 4H9HA 1JJ0A 1QTDA 2BAAA 3WL2A 168LA 1G0QA 3LZMA 4ARQB 5M1YA 5APDA 4OWBA 4YXAC 1IWUA 1WQMA 2LC9A 226LA 1J1PY 3OK0A 2F2QA 3QNGA 1G7IC 3HT6A 1C6HA 4N0JA 4B1AA 162LA 1B7PA 1HFXA 3CDRA 1IP1A 1C6DA 1L14A 1C67A 4NWEA 1SQ2L 1G0LA 1CV5A 1C61A 138LA 1AZFA 4ARQA 1IWWA 1L17A 1LSBA 2QB0B 4WO6A 1UACY 1LMCA 150LA 3SB5A 2LYZA 1GFHA 1TBYA 144LA 258LA 1G7LC 4DQ7A 5DN4A 1PS5A 1C6BA 1L74A 1ZYTA 4ETAA 1HEPA 4H93A 4U3XB 3P4ZA 198LA 3A90A 1L87A 4PJ2C 1NKHA 3LYTA 1LZCA 3BKVA 1I1ZA 4NHIA 4J0LA 2LYOA 3C80A 4GCCA 4CGEA 4QGZA 4H9FA 5B06A 1D3FA 1YILA 4R0FA 3G3XA 1NWGA 5KXSA 2C8OA 1L95A 192LA 2Z2EA 112LA 1CTWA 1FLWA 1VDSA 3A34A 5C6IA 4A7DA 3LHMA 1C6AA 1CUQA 2LZ2A 1JJ1A 4I7NA 2W1MA 3CDOA 4LYZA 4HPIA 3GXKA 1DYFA 4DDAA 1L32A 4TSBA 1LZGA 1JKCA 227LA 1L28A 1PZYA 1GB5A 147LA 206LA 2Z19A 1L27A 212LA 3LZTA 2ZQ4A 4YM8A 5HMVA 3HT8A 4WMGA 1IX0A 3VW7A 1C6QA 1CU0A 1LHKA 5F16A 130LA 1G06A 1PQJA 4I7MA 1L48A 1L0KA 1VFBC 3L2XA 4NHPA 184LA 3G3VA 4OWAA 2MEEA 4YXCA 4WLDA 1OV7A 2D4IA 1I20A 1LZ6A 1L38A 3SBAA 2W1YA 3ZVQB 1LI2A 4H94A 1JHLA 3UONA 3WPLA 1LJEA 1BB7A 3G3AB 4ARPA 1L99A 1LWKA 108LA 1D0LA 1C46A 2DQFC 3P66A 5DLAA 1PQKA 169LA 5LAGA 3KAMA 3AB6A 4W51A 160LA 1LZ4A 1P7SA 3FA0A 2EPEA 1DI4A 4N1EI 5F14A 5LVGA 5KXTA 3ZVQA 234LA 3C8QA 1L50A 8LYZA 3TXBA 4W55A 1KY0A 2ZYPA 1D3MA 1GFVA 1L43A 4ARJA 3ATOA 1L94A 3RZ4A 4DD1A 1P37A 1UUZC 3CQLA 3HU8A 2HTXA 4LYMA 4DQJA 1BWIA 2N5ZA 2NTHA 1L07A 229LA 5APCA 5A3ZA 1OV5A 1VATA 4YX7C 1BVKC 2O4WA 131LA 3GUJA 1LSNA 1G1VA 4NSHA 1NF5A 4LDLA 4NGOA 1CNSA 4GBRB 1CJ7A 1LYEA 1LYDA 1WTMA 3AW7A 151LA 4W96A 4M4OA 239LA 4YF2A 4N1CC 1KS3A 1QQYA 4UWVA 4LYTA 5F9XA 1L88A 3J6KA 1SX2A 4XJDA 2BQFA 5F81A 3AZ5A 242LA 4ARMB 4P2EA 3LYZA 1L76A 1AT5A 1IR9A 2H5ZA 1L92A 1AKIA 3RT5X 1BVXA 3NYAA 4TUNA 1N4FA 4KT3A 4QEQA 4H1PA 1OUBA 1CJ6A 1P64A 1XSFA 125LA 1BB6A 4W53A 2HULA 1P2LA 142LA 1LMAA 1IC7Y 1OUJA 1QTVA 120LA 1YROA 1LKRA 4ARMA 4TSCA 238LA 3TXDA 1JISA 157LA 2L78A 4W94A 2BQDA 4GCFA 1LMOA 1LZ1A 2DKVA 2BQLA 1GXV2 1QSBA 4RW2A 1DQJC 5L9JA 4GRVA 5LA5A 1CKCA 1HENA 1L01A 1LYHA 4IAPA 4H9BA 1B7QA 3MGWA 1L20A 1LHIA 3ATNA 1TAYA 1LWGA 1HEQA 181LA 1GFGA 4DJHA 1GFTA 1BB5A 4GLAA 4BS7A 4NIJA 4GN3A 1GB2A 4PHIA 7LYZA 2Z6BA 3F9LA 1KIQC 4ETCA 3HFMY 5FDJA 1OP9B 1D2WA 1C62A 1NHBA 3HTGA 4H9AA 1GE0A 1REXA 1REYA 1L62A 2BQHA 2O7AA 1B5YA 255LA 1L30A 1FBIX 2ZQ3A 2RBOA 4GCDA 1EL1A 1KW5A 1YAOA 5HLLA 1DZBX 4DD7A 3GULA 3EMSA 5I4WA 4W58A 3G3BB 2BQNA 1LZTA 2A4TA 3CDQA 3CSRA 1D3JA 1OUIA 5FSTA 3DN6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 230L A;  111L A;  175L A;  1L23 A;  1L86 A;  1CV4 A;  1C6L A;  4I7R A;  205L A;  225L A;  2Q9D A;  146L A;  196L A;  1L83 A;  3QAK A;  1QT4 A;  1KY1 A;  171L A;  1C6M A;  1LI6 A;  4PK0 A;  3CDV A;  3HDF A;  1QTD A;  168L A;  1G0Q A;  3LZM A;  4ARQ B;  139L A;  103L A;  256L A;  2B6Z A;  1QT3 A;  4YXA C;  1QUO A;  4ZPU A;  1P2R A;  1KW7 A;  1QT8 A;  3PBL A;  3G3W A;  118L A;  226L A;  2LC9 A;  2F2Q A;  3DN1 A;  3HT6 A;  2RB2 X;  3HH4 A;  1C6H A;  1L15 A;  1L72 A;  249L A;  3HH3 A;  162L A;  3CDR A;  152L A;  187L A;  3C8R A;  1CVK A;  1C6D A;  3D4S A;  3K2R A;  1L14 A;  2Q9E A;  1L05 A;  3HT9 A;  1OVJ A;  217L A;  1C67 A;  1L51 A;  199L A;  4W52 A;  1QS5 A;  4W59 A;  4LDE A;  114L A;  1L03 A;  1G0L A;  3SB8 A;  3NY9 A;  1CV5 A;  1C61 A;  107L A;  4PJZ A;  138L A;  4ARQ A;  1SWZ A;  1D9W A;  1KNI A;  1CX7 A;  180L A;  1L10 A;  1L17 A;  2B6X A;  1B6I A;  3OE6 A;  1L58 A;  1L56 A;  4I7Q A;  1DYA A;  1L85 A;  2LCB A;  1L13 A;  200L A;  2QB0 B;  1L35 A;  1QTH A;  150L A;  2F47 A;  1L53 A;  1WTH A;  3SB5 A;  211L A;  3SB9 A;  185L A;  3GUM A;  248L A;  144L A;  258L A;  244L A;  3V2Y A;  159L A;  1L29 A;  1OVH A;  158L A;  1L37 A;  1L90 A;  1LGU A;  1L70 A;  1L06 A;  251L A;  1L57 A;  3GUO A;  1PQM A;  1C65 A;  4EPI A;  1G1W A;  3GUN A;  1T8F A;  1C6B A;  1L74 A;  3DMX A;  1ZYT A;  3DN8 A;  109L A;  1C68 A;  198L A;  3C7Y A;  1L67 A;  4EKR A;  2OTZ X;  1C6P A;  254L A;  2B75 A;  1L87 A;  4W57 A;  1LI3 A;  1D2Y A;  1L82 A;  4I7P A;  3DN4 A;  1C6T A;  3HUA A;  126L A;  3OE0 A;  2QAR C;  1CU3 A;  4K5Y A;  1G0G A;  214L A;  1L42 A;  2RH1 A;  3C80 A;  2NTG A;  177L A;  2RAZ X;  1QT7 A;  1L77 A;  2B72 A;  4AQN A;  3C82 A;  209L A;  174L A;  1ZWN A;  213L A;  4EKS A;  252L A;  156L A;  1D3F A;  1L36 A;  3G3X A;  3V2W A;  1L61 A;  2RBP A;  1LYJ A;  4I7T A;  1T8G A;  1L95 A;  192L A;  197L A;  2RBS A;  112L A;  1OWY A;  167L A;  1CTW A;  1L11 A;  189L A;  1L71 A;  3OE8 A;  7LZM A;  1C6A A;  1CUQ A;  4W54 A;  4I7N A;  1OVK A;  1I6S A;  6LZM A;  3CDO A;  1L98 A;  2RB0 X;  1T97 A;  231L A;  1DYF A;  1C6N A;  3PDS A;  2B73 A;  1SSW A;  1L32 A;  3DN3 A;  1L08 A;  4S0W A;  1L12 A;  1G0J A;  1C6I A;  227L A;  3DMZ A;  1L28 A;  5LZM A;  1L16 A;  147L A;  2F32 A;  2B7X A;  1L25 A;  206L A;  122L A;  241L A;  2RBQ A;  1L27 A;  212L A;  1L40 A;  3HT8 A;  145L A;  1L21 A;  3VW7 A;  1C6Q A;  1CU0 A;  3C81 A;  1SX7 A;  216L A;  3SBB C;  250L A;  130L A;  1G06 A;  1PQJ A;  1XEP A;  4I7M A;  1QTZ A;  1L48 A;  1L0K A;  3L2X A;  113L A;  184L A;  3G3V A;  1L55 A;  1L41 A;  4YXC A;  1C63 A;  176L A;  2B6Y A;  1OV7 A;  1DYE A;  3SBA A;  1L38 A;  1L97 A;  3DMV A;  1PQO A;  178L A;  188L A;  1L69 A;  1L93 A;  1LI2 A;  1LGW A;  165L A;  1QUH A;  1L34 A;  3UON A;  1C64 A;  3EML A;  3GUP A;  1G07 A;  1CV1 A;  4ARP A;  1L99 A;  3HH5 A;  1L49 A;  1L46 A;  1LWK A;  4E97 A;  108L A;  1G0M A;  247L A;  4I7J A;  3C83 A;  2OU9 A;  161L A;  1L64 A;  1PQK A;  3FAD A;  4LZM A;  169L A;  1G0K A;  4W56 A;  115L A;  1EPY A;  4W51 A;  160L A;  190L A;  1L84 A;  1P7S A;  2OU0 X;  1L33 A;  164L A;  1L63 A;  3FA0 A;  3C8S A;  1TLA A;  223L A;  1QUG A;  1P3N A;  234L A;  3C8Q A;  4I7L A;  3F8V A;  1L50 A;  3CDT A;  4W55 A;  1KY0 A;  3SB6 A;  1SWY A;  1SSY A;  3HTD A;  4EKQ A;  1L02 A;  1D3M A;  1L43 A;  3HDE A;  4ARJ A;  1L94 A;  3HTB A;  1P37 A;  2HUK A;  1L47 A;  3HU8 A;  3RZE A;  1QTC A;  1L75 A;  2NTH A;  1PQD A;  173L A;  2B6W A;  123L A;  1C6J A;  1L07 A;  229L A;  201L A;  260L A;  102L A;  1OV5 A;  261L A;  220L A;  1L0J A;  1OWZ A;  4YX7 C;  2O4W A;  131L A;  3GUJ A;  1CV3 A;  1L66 A;  3C7W A;  3HU9 A;  141L A;  1G1V A;  4ARL A;  221L A;  1XJT A;  3GUK A;  4LDL A;  4GBR B;  1LYE A;  1LYD A;  2OU8 A;  2RB1 X;  195L A;  151L A;  191L A;  239L A;  3HUK A;  1L96 A;  1LYI A;  3L64 A;  1PQI A;  1KS3 A;  1P46 A;  1QT6 A;  1G0P A;  1L24 A;  1DYB A;  1CV0 A;  1C69 A;  1L88 A;  4EKP A;  2OTY X;  1SX2 A;  1P36 A;  1JTM A;  3DKE X;  1D3N A;  3HT7 A;  242L A;  3HUQ A;  2ANX A;  1L45 A;  1L68 A;  1T8A A;  4ARM B;  1QTB A;  149L A;  1DYD A;  3OE9 A;  1L76 A;  3SN6 R;  1L73 A;  2HUM A;  1QT5 A;  1C60 A;  137L A;  1L19 A;  1L92 A;  2OE4 X;  233L A;  2LZM A;  1QUD A;  3NYA A;  3ODU A;  148L E;  2ANV A;  1L22 A;  3HH6 A;  1C6G A;  183L A;  128L A;  1P64 A;  4DKL A;  125L A;  4W53 A;  1LYF A;  1P2L A;  219L A;  2HUL A;  2OE7 X;  4I7O A;  1L04 A;  142L A;  1LYG A;  1JTN A;  2O79 A;  2OE9 X;  1L00 A;  3FI5 A;  1L65 A;  3GUI A;  3DN0 A;  127L A;  1QTV A;  120L A;  4ARM A;  1L54 A;  119L A;  163L A;  1C6E A;  238L A;  3HTF A;  224L A;  1CU6 A;  1CU2 A;  157L A;  3SB7 A;  1L91 A;  110L A;  243L A;  1L39 A;  186L A;  4OO9 A;  104L A;  2L78 A;  1L18 A;  1L59 A;  257L A;  170L A;  3RUN A;  222L A;  1T6H A;  2B70 A;  172L A;  240L A;  1LGX A;  4EXM A;  1QSB A;  2RAY X;  4GRV A;  1L52 A;  1DYG A;  235L A;  245L A;  1L01 A;  1LYH A;  215L A;  4IAP A;  1L20 A;  1C6C A;  1L09 A;  1DYC A;  3C7Z A;  1LWG A;  237L A;  1XJU A;  1LLH A;  210L A;  181L A;  4DJH A;  1L60 A;  140L A;  1L44 A;  1L31 A;  246L A;  218L A;  232L A;  1ZUR A;  259L A;  2RBN A;  3JR6 A;  3HWL A;  143L A;  262L A;  1CX6 A;  1L26 A;  2Z6B A;  4LDO A;  3F9L A;  3NY8 A;  1CV6 A;  4EPF A;  1C6F A;  1LW9 A;  228L A;  1K28 A;  3DN2 A;  1CUP A;  1P5C A;  2B74 A;  1L79 A;  1D2W A;  1C62 A;  1NHB A;  3HTG A;  1CU5 A;  1L80 A;  1C66 A;  1P6Y A;  1JQU A;  182L A;  1L62 A;  2O7A A;  255L A;  1L30 A;  2RBO A;  236L A;  2CUU A;  4I7K A;  3DNA A;  1KW5 A;  1QSQ A;  1QS9 A;  5I14 A;  3GUL A;  253L A;  166L A;  1LPY A;  1C6K A;  2OEA X;  1L81 A;  4W58 A;  1L89 A;  2IGC A;  1OYU A;  155L A;  2A4T A;  3CDQ A;  129L A;  4EJ4 A;  1D3J A;  4I7S A;  1P56 A;  2RBR A;  2B6T A;  4DAJ A;  3DN6 A; 
#chains in the Genus database with same CATH topology
 230L A;  3RNX A;  1IOS A;  4RLM A;  111L A;  1B7S A;  1GB8 A;  1L86 A;  3FE0 A;  5KJ9 A;  4NGL A;  2Q0M X;  5DM9 A;  1C6L A;  4BAP A;  4ANR A;  1JIT A;  2Q9D A;  1KIP C;  1QDR A;  1L83 A;  3QAK A;  1YIK A;  4PK0 A;  4NFV A;  1HEM A;  5I54 A;  3AGH A;  5KXX A;  1QUO A;  4H90 A;  4ZPU A;  1P2R A;  1IEE A;  118L A;  1LMT A;  1HC0 A;  4XAD A;  1INU A;  1VAU A;  4IAS A;  3QE8 A;  4NGY A;  5D5C A;  3HT9 A;  2MEC A;  217L A;  2EKS C;  4W52 A;  4W59 A;  2C8P A;  4G4B A;  1HEO A;  4ZIX A;  2BQK A;  3NY9 A;  107L A;  4B4E A;  1FLU A;  1SWZ A;  1G7M C;  1CX7 A;  2YBJ A;  3EO5 A;  1B6I A;  3OE6 A;  4I7Q A;  1LZA A;  5HMJ A;  1QTH A;  1WTH A;  4XJB A;  2DQH Y;  211L A;  3SB9 A;  1E8L A;  1LZD A;  248L A;  2XTH A;  159L A;  1L29 A;  2Z39 A;  2G4N A;  251L A;  1L70 A;  1L06 A;  4O34 A;  4HJY A;  3WW6 A;  3GUN A;  4NGZ A;  3WU9 A;  3DMX A;  3AYQ A;  4NG1 A;  4D9Z A;  5L3I A;  4DD0 A;  109L A;  1L67 A;  1J1X Y;  4EKR A;  4H8Y A;  254L A;  1LI3 A;  1L82 A;  3DN4 A;  5LVH A;  5APF A;  126L A;  1LSG A;  5JEN B;  5KXZ A;  1QSA A;  1G0G A;  214L A;  1L42 A;  2RH1 A;  3IJV A;  2NTG A;  4GN4 A;  2F4G A;  177L A;  3TMX A;  4GCB A;  4LFX A;  209L A;  1ZWN A;  1L36 A;  1RFP A;  1UIG A;  3V2W A;  2RBP A;  1LYJ A;  2YVB A;  4QDN A;  4NGI A;  2GV0 A;  2RBS A;  167L A;  4KL7 A;  1L11 A;  189L A;  1F10 A;  1NDG C;  1L71 A;  1C45 A;  1GE1 A;  2BQE A;  5FEL A;  4B0D A;  1OVK A;  4WL7 A;  1J1O Y;  1L98 A;  1JIY A;  2RB0 X;  1UIF A;  1F6R A;  1DKK A;  1C6N A;  3TXJ A;  3D9A C;  1JTT L;  3PDS A;  2B73 A;  4H91 A;  1CKH A;  4AGA A;  4S0W A;  1G0J A;  1C6I A;  1DI5 A;  1LYO A;  2HED A;  1L25 A;  2RBQ A;  5I4Y A;  4HTQ A;  1NDM C;  3C81 A;  1WQQ A;  4WM3 A;  250L A;  1B5Z A;  1I56 A;  1QTZ A;  113L A;  1F6S A;  5KXN A;  1IP7 A;  1LSZ A;  3WVX A;  1WQO A;  1FLQ A;  4ML7 A;  1L34 A;  1DKJ A;  1CKD A;  3GUP A;  1JTO L;  1CKG A;  1GE3 A;  1GD6 A;  3HH5 A;  4E97 A;  1GDX A;  3CSZ A;  161L A;  4DDC A;  5KY1 A;  4MCK A;  1G0K A;  1YKY X;  4W56 A;  4DD3 A;  3A91 A;  115L A;  3M18 B;  3A6B Y;  1EQ5 A;  1WQP A;  4HP0 A;  164L A;  1L63 A;  4WM6 A;  2B5Z A;  1JPO A;  1QUG A;  3M3U A;  1LJG A;  3CDT A;  4NHQ A;  3SB6 A;  3HTD A;  194L A;  3B0K A;  4DD2 A;  1B2K A;  1L02 A;  1AM7 A;  1LJI A;  4TWS A;  3TMV A;  5B1F A;  1LZB A;  2HUK A;  3RZE A;  1QTC A;  2HEE A;  1PQD A;  173L A;  2B6W A;  3EBA B;  1GFR A;  1LSE A;  1C6J A;  4Z3M A;  3A8Z A;  1L0J A;  1OWZ A;  5LXW A;  3HU9 A;  4ARL A;  3GUK A;  1OQM A;  4QY9 A;  1RJC B;  208L A;  1V7T A;  4M6D A;  3W6B A;  2I6Z A;  3A95 A;  3HUK A;  1LYI A;  3B0I A;  3B72 A;  1D0K A;  1LZS A;  1HER A;  1LZY A;  1GBZ A;  1CV0 A;  4H92 A;  4MR1 A;  2BQM A;  5LIO A;  4NGV A;  2Y8P A;  2BLY A;  4OWC A;  2ZIK A;  5T3F A;  4XJH A;  3TXI A;  1L45 A;  1T8A A;  5LVK A;  1QTB A;  1UA6 Y;  4G49 A;  149L A;  3SN6 R;  4DWX A;  4RW1 A;  2CDS A;  2YDG A;  1LZ9 A;  1L19 A;  5L3H A;  1B5V A;  5LYZ A;  3ODU A;  3WW5 A;  1L22 A;  1VDT A;  5J7C A;  1C6G A;  183L A;  1RE2 A;  4CHX A;  4DKL A;  2FBD A;  219L A;  2OE7 X;  2DBT A;  2O79 A;  2BPU A;  1LJH A;  3FI5 A;  1ALC A;  2ZIL A;  1CJ8 A;  127L A;  1L54 A;  1BWJ A;  3LZ2 A;  1CU6 A;  4FDY A;  3SB7 A;  243L A;  110L A;  186L A;  4OO9 A;  4PRQ A;  1L18 A;  1UIB A;  170L A;  1IWX A;  1YAP A;  1XGR C;  222L A;  2B70 A;  1TEW A;  5EBH A;  2ZWB A;  2F30 A;  4I0C A;  1OUA A;  1IOC A;  1WQN A;  215L A;  2X0A A;  1C6C A;  1L09 A;  1XJU A;  1LSC A;  1L60 A;  140L A;  1L44 A;  1OUH A;  232L A;  4DQ5 A;  1LJK A;  1JWR A;  5KXY A;  1CX6 A;  5LVJ A;  1CV6 A;  4EPF A;  1LJ3 A;  228L A;  1K28 A;  1GPQ C;  4G4H A;  1CUP A;  2B74 A;  5I4X A;  1VDP A;  1L79 A;  4DT3 A;  4NHS A;  1CU5 A;  3WXT A;  1P6Y A;  3W6F A;  1RCM A;  4IJ4 A;  2CUU A;  2EIZ C;  1HFZ A;  1QSQ A;  1QS9 A;  5I14 A;  3CT0 A;  4DD9 A;  2OEA X;  1C6K A;  5B1G A;  3WUM A;  3WMK A;  3OJP A;  1LHJ A;  129L A;  3P64 A;  1IWZ A;  1P56 A;  3K3T A;  2RBR A;  1FDL Y;  4YEN A;  1F0W A;  1HML A;  5KXW A;  3B6L A;  196L A;  1C6M A;  2Z37 A;  3B0O A;  5LAF A;  1OUD A;  1HSW A;  4WM4 A;  1NBZ C;  3AGG G;  1QUS A;  1KW7 A;  1QSW A;  1HSX A;  1QT8 A;  3PBL A;  5B59 A;  3G3W A;  2H9K A;  1FKQ A;  2RB2 X;  249L A;  1L72 A;  3HH3 A;  1UIH A;  187L A;  1XGQ C;  4WG7 A;  3D4S A;  3K2R A;  1GFJ A;  1L05 A;  1IWT A;  1OVJ A;  5AMY A;  4BAD A;  2DQA A;  1QS5 A;  1TCY A;  3IJU A;  114L A;  3AZ4 A;  4RLN A;  4WO9 A;  1KXX A;  4PJZ A;  2YBH A;  1GF3 A;  1D9W A;  1KNI A;  2B6X A;  1L56 A;  1W6Z A;  1DYA A;  1LHH A;  1L85 A;  2LCB A;  4Z98 A;  2A7F A;  1SLY A;  1L35 A;  3VWO A;  1IIZ A;  1YL0 X;  1LJN A;  1GXX A;  1GB9 A;  1DXJ A;  2AUB A;  3GUM A;  3V2Y A;  4R6C A;  4HTK A;  1LMP A;  1L90 A;  1LGU A;  4WM5 A;  1L57 A;  4H8X A;  1PQM A;  1C65 A;  1T8F A;  2G4P A;  3P68 A;  4H9E A;  4CJ2 A;  2Z12 A;  1C6P A;  2B75 A;  1D2Y A;  1NQI A;  3WUL A;  1GE4 A;  1IO5 A;  4I7P A;  1IP6 A;  1IWY A;  2MEI A;  1CU3 A;  4ZFP A;  2F4A A;  1L77 A;  2B72 A;  4ET8 A;  252L A;  1YKX X;  3ZEK A;  197L A;  2A7D A;  1OWY A;  4LYC A;  1JKB A;  4XYY A;  1OUF A;  1WTN A;  2XJW A;  6LZM A;  3FI7 A;  3A6C Y;  1T97 A;  3WPK A;  207L A;  1SSW A;  2Z2F A;  3DN3 A;  1MLC E;  2BQC A;  1LOZ A;  4XJG A;  2ZIJ A;  4OWH A;  5KXP A;  2F2N A;  5I53 A;  2F32 A;  1LSM A;  2B7X A;  4I8S A;  2VB1 A;  1QUT A;  241L A;  2MEG A;  1D9U A;  1LSA A;  216L A;  1D6Q A;  132L A;  1DPW A;  4C5F A;  1C63 A;  2B6Y A;  3CT5 A;  3LN2 A;  4WM2 A;  178L A;  4Z46 A;  1L69 A;  1LGW A;  165L A;  5I5Q A;  1CKF A;  2PC2 A;  1C64 A;  3J4G A;  5IDD A;  1H87 A;  1CV1 A;  1L49 A;  1L46 A;  1C08 C;  1G0M A;  1W08 A;  4I7J A;  2OU9 A;  1GDW A;  1GF7 A;  4LZM A;  3TXH A;  1EPY A;  1GHL A;  1JSF A;  1L33 A;  4H8Z A;  1V7S A;  4X3B A;  3C8S A;  5KXO A;  1P3N A;  2ZNW Y;  1XGP C;  4ET9 A;  4I7L A;  3F8V A;  4PGJ B;  4XN6 A;  133L A;  2BQG A;  1GBX A;  9LYZ A;  1SSY A;  4EKQ A;  4YEO A;  1P2C C;  1GBW A;  2FYD A;  4NSG A;  3HTB A;  1L47 A;  4UWU A;  4WLX A;  3AW6 A;  201L A;  260L A;  1HNL A;  135L A;  1B5W A;  220L A;  4KPM A;  1LZR A;  1L66 A;  1AT6 A;  3QY4 A;  5KXM A;  5B05 A;  1XFP L;  6LYZ A;  1A4V A;  2YBI A;  4Z41 A;  2OU8 A;  2RB1 X;  1IOQ A;  195L A;  4ETE A;  1UCO A;  5LYM A;  3L64 A;  4LGK A;  2XBR A;  1B5U A;  3CSQ A;  1G0P A;  2FYC A;  1L24 A;  1C69 A;  1IY4 A;  1GB6 A;  2OTY X;  2WAR A;  2G4Q A;  1D3N A;  2DQE Y;  2W1X A;  1LJ4 A;  1GBY A;  1YAN A;  1L68 A;  1ZV5 L;  1DYD A;  3OE9 A;  1L73 A;  1QT5 A;  1GF8 A;  2LZT A;  2BQB A;  137L A;  4LT0 A;  233L A;  4KXI A;  2HU1 A;  3P65 A;  4ETB A;  148L E;  1EQ4 A;  1ZVH L;  2OE9 X;  1L00 A;  2HEA A;  3GUI A;  1GF4 A;  5A3E A;  1C6E A;  1NMM A;  3TXG A;  3HTF A;  1BWH A;  4YEM A;  1L91 A;  4IAT A;  257L A;  4DYG A;  172L A;  240L A;  1LKS A;  4EXM A;  1IC4 Y;  3F6Z A;  2RAY X;  4PRU A;  5K7O A;  1YAM A;  1DYG A;  2MEH A;  2LYM A;  4NHT A;  1DYC A;  1UIE A;  2ZNX Y;  237L A;  210L A;  1QTK A;  1UIA A;  4J1B A;  246L A;  4WLT A;  259L A;  1T6V L;  1NBY C;  3HWL A;  143L A;  262L A;  1JSE A;  1L26 A;  4LDO A;  1LHM A;  1RI8 B;  1LW9 A;  4EMN A;  2I25 L;  5KKJ A;  2D6B A;  3N9E A;  2H9J A;  1LSY A;  182L A;  4NG8 A;  3HBH A;  1XGT C;  236L A;  4OOT A;  1LPY A;  1UID A;  1JUG A;  1G7H C;  3BKH A;  1L89 A;  2IGC A;  1OYU A;  4N9R A;  4EJ4 A;  1DI3 A;  2B6T A;  4EOF A;  175L A;  1L23 A;  4I7R A;  2CGI A;  205L A;  225L A;  2Z18 A;  2CWI A;  146L A;  1REM A;  4H9I A;  171L A;  1LI6 A;  4C3W A;  3CDV A;  3HDF A;  5IEL A;  139L A;  103L A;  1B7M A;  256L A;  2B6Z A;  1QT3 A;  1B7O A;  2DQJ Y;  1ZMY L;  2MEA A;  4RDS A;  1D6P A;  1GBO A;  2DQI Y;  1TDY A;  3AGI A;  4B4I A;  193L A;  4LT1 A;  1B7L A;  3HBE X;  3DN1 A;  5D5F A;  3HH4 A;  1L15 A;  4NGJ A;  1GF6 A;  3HBD A;  152L A;  3C8R A;  1CVK A;  2Q9E A;  1JEF A;  1LZN A;  2XBS A;  5C6J A;  1L51 A;  3WU7 A;  199L A;  2DQG Y;  1FKV A;  5LYT A;  4HJV A;  4LDE A;  1WQR A;  1L03 A;  1GBS A;  3SB8 A;  4WOA A;  4NEB A;  2HUB A;  180L A;  1L10 A;  4NY5 A;  3E3D A;  1L58 A;  1XGU C;  1L13 A;  1LTM A;  200L A;  1UC0 A;  3W6C A;  1IP3 A;  2F47 A;  4OWE A;  1L53 A;  3A3R X;  1LAA A;  4G4C A;  185L A;  1H6M A;  153L A;  1UBZ A;  3RU5 A;  1BHZ A;  1IWV A;  244L A;  3AJN A;  1OVH A;  4HSF A;  158L A;  1L37 A;  2ZYC A;  3GUO A;  4GLV A;  3RW8 A;  3WU8 A;  1KXW A;  4NSI A;  4EPI A;  1IY3 A;  1G1W A;  2BQA A;  2LHM A;  5ILC A;  2RSC A;  3DN8 A;  1QTE A;  1C68 A;  3C7Y A;  3W6A A;  2OTZ X;  4W57 A;  3WXU A;  2BQI A;  2D4J A;  1C6T A;  3HUA A;  1Z55 A;  3OE0 A;  2QAR C;  4II8 A;  4ETD A;  4K5Y A;  2DQD Y;  2RAZ X;  1QT7 A;  4AQN A;  3C82 A;  1LJF A;  174L A;  4EKS A;  213L A;  156L A;  3W6D A;  2CJL A;  1HEW A;  1L61 A;  1G7J C;  5DN5 A;  1B7N A;  5LA8 A;  4I7T A;  5FEK A;  1T8G A;  1IR8 A;  4PPO A;  1IOT A;  5KXL A;  2NWD X;  3OE8 A;  4YOP A;  7LZM A;  3N9A A;  5E4P A;  4W54 A;  1IVM A;  1HEL A;  2YSS C;  3WUN A;  1I6S A;  1YAQ A;  2BLX A;  1LCN A;  231L A;  4CFO A;  2HEB A;  1KIR C;  1L08 A;  5E9R A;  1WVV A;  1B0D A;  1L12 A;  3DMZ A;  1LYS A;  5LZM A;  1L16 A;  1VED A;  122L A;  1L40 A;  5KKI A;  145L A;  1L21 A;  1LZE A;  3GXR A;  1IOR A;  1SX7 A;  3SBB C;  4TX7 A;  1XEP A;  5LIN A;  1T3P A;  1IC5 Y;  4B49 A;  1L55 A;  1L41 A;  2BQJ A;  3CT1 A;  176L A;  3A3Q A;  1DYE A;  1L97 A;  3DMV A;  4WLY A;  1PQO A;  188L A;  1L93 A;  5DL9 A;  1QUH A;  1LJJ A;  2MEB A;  2W1L A;  3EML A;  4G9S A;  5FHW A;  4LT2 A;  1G07 A;  1QIO A;  247L A;  4HJZ A;  4J1A A;  3IWR A;  3C83 A;  1L64 A;  3FAD A;  3D3D A;  2IFF Y;  190L A;  1L84 A;  2OU0 X;  3WPJ A;  4OOO A;  1IP4 A;  3A96 A;  134L A;  1GFU A;  1TLA A;  4NGW A;  223L A;  1DPX A;  3TXK A;  1LSF A;  1LSD A;  3TXF A;  5C6L A;  1HMK A;  2YBN A;  2Z38 A;  1C10 A;  1SWY A;  4GCE A;  1D0M A;  3HDE A;  2I26 L;  3TXE A;  3TMU A;  3LYO A;  1LYZ A;  1GF9 A;  4XJF A;  1YKZ X;  6LYT A;  1L75 A;  3CB7 A;  3W6E A;  1JJ3 A;  123L A;  5F9U A;  1VDQ A;  1LMN A;  102L A;  1GAZ A;  261L A;  4OW1 A;  2D91 A;  1EQE A;  3W3E A;  1CV3 A;  3C7W A;  141L A;  4H9C A;  5KXK A;  1WVU A;  221L A;  1XJT A;  154L A;  5LVI A;  3ULR A;  1C43 A;  3WVY A;  1QDT A;  191L A;  1BGI A;  3AZ6 A;  4AXT A;  3TMW A;  1L96 A;  4XEN A;  1B9O A;  2YBL A;  1PQI A;  2BQO A;  1P46 A;  1QT6 A;  1BQL Y;  4TTD A;  1DYB A;  4DDB A;  3LYM A;  4WL6 A;  1FLY A;  1O23 A;  1GFA A;  4EKP A;  1P36 A;  1JTM A;  3DKE X;  3HT7 A;  3HUQ A;  2ANX A;  2DQC Y;  4NGK A;  4LFP A;  1A2Y C;  4HV2 A;  1MEL L;  4XJI A;  1FN5 A;  2HEF A;  2HUM A;  4HPE A;  1C60 A;  4UWN A;  5HNC A;  5FCP A;  3A93 A;  4BAF A;  2OE4 X;  2LZM A;  3WYH A;  1QUD A;  2HEC A;  4LYB A;  4ZEE A;  1GFK A;  2ANV A;  3SP3 A;  3HH6 A;  4LT3 A;  2EQL A;  1XEK A;  4LZT A;  128L A;  1OUC A;  1GE2 A;  1HHL A;  1LHL A;  1LYF A;  4I7O A;  4N8Z A;  1L04 A;  1LYG A;  1JTN A;  1IR7 A;  3WUA A;  3T36 A;  1L65 A;  3DN0 A;  1JKA A;  1IP5 A;  1HF4 A;  119L A;  163L A;  4FJR A;  224L A;  1BB3 A;  1CU2 A;  1C7P A;  4NSJ A;  1LPI A;  1L39 A;  2D4K A;  104L A;  1JKD A;  4HV1 A;  1B5X A;  1L59 A;  3RUN A;  1OUE A;  1XEJ A;  1T6H A;  1LMQ A;  1GB7 A;  2XQO A;  1UIC A;  1LGX A;  1YQV Y;  1L52 A;  235L A;  245L A;  4NWH A;  4GN5 C;  2FBB A;  5ILF A;  4B4J A;  4N5R A;  1GF0 A;  3EXD A;  1ZVY B;  1REZ A;  2HU3 A;  3C7Z A;  1GEV A;  1LLH A;  2YBM A;  4WM1 A;  1L31 A;  218L A;  5II3 A;  3A92 A;  1ZUR A;  1NHE A;  1GEZ A;  1GAY A;  2RBN A;  3JR6 A;  3A94 A;  4MST A;  1LYY A;  3NY8 A;  1HFY A;  1C6F A;  3DN2 A;  3WH1 A;  3T6U A;  1LZ8 A;  5KXR A;  1P5C A;  4CFP A;  5HNL A;  1KXY A;  1L80 A;  4DC4 A;  1C66 A;  1LSP A;  4WG1 A;  1YL1 X;  1JQU A;  4L41 A;  2IHL A;  5APE A;  1CJ9 A;  4LYO A;  5HQ1 A;  4I7K A;  3DNA A;  1OUG A;  1XEI A;  1BB4 A;  253L A;  1JTP L;  166L A;  1IP2 A;  1L81 A;  1LZ5 A;  155L A;  1GF5 A;  1GWD A;  3N9C A;  1GB0 A;  4I7S A;  3A67 Y;  1GB3 A;  4DAJ A;  1GFE A;  4J7V A;  1CV4 A;  3AZ7 A;  4E3U A;  4HTN A;  5B07 A;  1QT4 A;  1KY1 A;  1B7R A;  5IHG A;  2MED A;  2MEF A;  4H9H A;  1JJ0 A;  1QTD A;  2BAA A;  3WL2 A;  168L A;  1G0Q A;  3LZM A;  4ARQ B;  5M1Y A;  5APD A;  4OWB A;  4YXA C;  1IWU A;  1WQM A;  2LC9 A;  226L A;  1J1P Y;  3OK0 A;  2F2Q A;  3QNG A;  1G7I C;  3HT6 A;  1C6H A;  4N0J A;  4B1A A;  162L A;  1B7P A;  1HFX A;  3CDR A;  1IP1 A;  1C6D A;  1L14 A;  1C67 A;  4NWE A;  1SQ2 L;  1G0L A;  1CV5 A;  1C61 A;  138L A;  1AZF A;  4ARQ A;  1IWW A;  1L17 A;  1LSB A;  2QB0 B;  4WO6 A;  1UAC Y;  1LMC A;  150L A;  3SB5 A;  2LYZ A;  1GFH A;  1TBY A;  144L A;  258L A;  1G7L C;  4DQ7 A;  5DN4 A;  1PS5 A;  1C6B A;  1L74 A;  1ZYT A;  4ETA A;  1HEP A;  4H93 A;  4U3X B;  3P4Z A;  198L A;  3A90 A;  1L87 A;  4PJ2 C;  1NKH A;  3LYT A;  1LZC A;  3BKV A;  1I1Z A;  4NHI A;  4J0L A;  2LYO A;  3C80 A;  4GCC A;  4CGE A;  4QGZ A;  4H9F A;  5B06 A;  1D3F A;  1YIL A;  4R0F A;  3G3X A;  1NWG A;  5KXS A;  2C8O A;  1L95 A;  192L A;  2Z2E A;  112L A;  1CTW A;  1FLW A;  1VDS A;  3A34 A;  5C6I A;  4A7D A;  3LHM A;  1C6A A;  1CUQ A;  2LZ2 A;  1JJ1 A;  4I7N A;  2W1M A;  3CDO A;  4LYZ A;  4HPI A;  3GXK A;  1DYF A;  4DDA A;  1L32 A;  4TSB A;  1LZG A;  1JKC A;  227L A;  1L28 A;  1PZY A;  1GB5 A;  147L A;  206L A;  2Z19 A;  1L27 A;  212L A;  3LZT A;  2ZQ4 A;  4YM8 A;  5HMV A;  3HT8 A;  4WMG A;  1IX0 A;  3VW7 A;  1C6Q A;  1CU0 A;  1LHK A;  5F16 A;  130L A;  1G06 A;  1PQJ A;  4I7M A;  1L48 A;  1L0K A;  1VFB C;  3L2X A;  4NHP A;  184L A;  3G3V A;  4OWA A;  2MEE A;  4YXC A;  4WLD A;  1OV7 A;  2D4I A;  1I20 A;  1LZ6 A;  1L38 A;  3SBA A;  2W1Y A;  3ZVQ B;  1LI2 A;  4H94 A;  1JHL A;  3UON A;  3WPL A;  1LJE A;  1BB7 A;  3G3A B;  4ARP A;  1L99 A;  1LWK A;  108L A;  1D0L A;  1C46 A;  2DQF C;  3P66 A;  5DLA A;  1PQK A;  169L A;  5LAG A;  3KAM A;  3AB6 A;  4W51 A;  160L A;  1LZ4 A;  1P7S A;  3FA0 A;  2EPE A;  1DI4 A;  4N1E I;  5F14 A;  5LVG A;  5KXT A;  3ZVQ A;  234L A;  3C8Q A;  1L50 A;  8LYZ A;  3TXB A;  4W55 A;  1KY0 A;  2ZYP A;  1D3M A;  1GFV A;  1L43 A;  4ARJ A;  3ATO A;  1L94 A;  3RZ4 A;  4DD1 A;  1P37 A;  1UUZ C;  3CQL A;  3HU8 A;  2HTX A;  4LYM A;  4DQJ A;  1BWI A;  2N5Z A;  2NTH A;  1L07 A;  229L A;  5APC A;  5A3Z A;  1OV5 A;  1VAT A;  4YX7 C;  1BVK C;  2O4W A;  131L A;  3GUJ A;  1LSN A;  1G1V A;  4NSH A;  1NF5 A;  4LDL A;  4NGO A;  1CNS A;  4GBR B;  1CJ7 A;  1LYE A;  1LYD A;  1WTM A;  3AW7 A;  151L A;  4W96 A;  4M4O A;  239L A;  4YF2 A;  4N1C C;  1KS3 A;  1QQY A;  4UWV A;  4LYT A;  5F9X A;  1L88 A;  3J6K A;  1SX2 A;  4XJD A;  2BQF A;  5F81 A;  3AZ5 A;  242L A;  4ARM B;  4P2E A;  3LYZ A;  1L76 A;  1AT5 A;  1IR9 A;  2H5Z A;  1L92 A;  1AKI A;  3RT5 X;  1BVX A;  3NYA A;  4TUN A;  1N4F A;  4KT3 A;  4QEQ A;  4H1P A;  1OUB A;  1CJ6 A;  1P64 A;  1XSF A;  125L A;  1BB6 A;  4W53 A;  2HUL A;  1P2L A;  142L A;  1LMA A;  1IC7 Y;  1OUJ A;  1QTV A;  120L A;  1YRO A;  1LKR A;  4ARM A;  4TSC A;  238L A;  3TXD A;  1JIS A;  157L A;  2L78 A;  4W94 A;  2BQD A;  4GCF A;  1LMO A;  1LZ1 A;  2DKV A;  2BQL A;  1GXV 2;  1QSB A;  4RW2 A;  1DQJ C;  5L9J A;  4GRV A;  5LA5 A;  1CKC A;  1HEN A;  1L01 A;  1LYH A;  4IAP A;  4H9B A;  1B7Q A;  3MGW A;  1L20 A;  1LHI A;  3ATN A;  1TAY A;  1LWG A;  1HEQ A;  181L A;  1GFG A;  4DJH A;  1GFT A;  1BB5 A;  4GLA A;  4BS7 A;  4NIJ A;  4GN3 A;  1GB2 A;  4PHI A;  7LYZ A;  2Z6B A;  3F9L A;  1KIQ C;  4ETC A;  3HFM Y;  5FDJ A;  1OP9 B;  1D2W A;  1C62 A;  1NHB A;  3HTG A;  4H9A A;  1GE0 A;  1REX A;  1REY A;  1L62 A;  2BQH A;  2O7A A;  1B5Y A;  255L A;  1L30 A;  1FBI X;  2ZQ3 A;  2RBO A;  4GCD A;  1EL1 A;  1KW5 A;  1YAO A;  5HLL A;  1DZB X;  4DD7 A;  3GUL A;  3EMS A;  5I4W A;  4W58 A;  3G3B B;  2BQN A;  1LZT A;  2A4T A;  3CDQ A;  3CSR A;  1D3J A;  1OUI A;  5FST A;  3DN6 A; 
#chains in the Genus database with same CATH homology
 230L A;  3RNX A;  1IOS A;  4RLM A;  111L A;  1B7S A;  1GB8 A;  1L86 A;  3FE0 A;  5KJ9 A;  4NGL A;  2Q0M X;  5DM9 A;  1C6L A;  4BAP A;  4ANR A;  1JIT A;  2Q9D A;  1KIP C;  1QDR A;  1L83 A;  3QAK A;  1YIK A;  4PK0 A;  4NFV A;  1HEM A;  5I54 A;  3AGH A;  5KXX A;  1QUO A;  4H90 A;  4ZPU A;  1P2R A;  1IEE A;  118L A;  1LMT A;  1HC0 A;  4XAD A;  1INU A;  1VAU A;  4IAS A;  3QE8 A;  4NGY A;  5D5C A;  3HT9 A;  2MEC A;  217L A;  2EKS C;  4W52 A;  4W59 A;  2C8P A;  4G4B A;  1HEO A;  4ZIX A;  2BQK A;  3NY9 A;  107L A;  4B4E A;  1FLU A;  1SWZ A;  1G7M C;  1CX7 A;  2YBJ A;  3EO5 A;  1B6I A;  3OE6 A;  4I7Q A;  1LZA A;  5HMJ A;  1QTH A;  1WTH A;  4XJB A;  2DQH Y;  211L A;  3SB9 A;  1E8L A;  1LZD A;  248L A;  2XTH A;  159L A;  1L29 A;  2Z39 A;  2G4N A;  251L A;  1L70 A;  1L06 A;  4O34 A;  4HJY A;  3WW6 A;  3GUN A;  4NGZ A;  3WU9 A;  3DMX A;  3AYQ A;  4NG1 A;  4D9Z A;  5L3I A;  4DD0 A;  109L A;  1L67 A;  1J1X Y;  4EKR A;  4H8Y A;  254L A;  1LI3 A;  1L82 A;  3DN4 A;  5LVH A;  5APF A;  126L A;  1LSG A;  5JEN B;  5KXZ A;  1QSA A;  1G0G A;  214L A;  1L42 A;  2RH1 A;  3IJV A;  2NTG A;  4GN4 A;  2F4G A;  177L A;  3TMX A;  4GCB A;  4LFX A;  209L A;  1ZWN A;  1L36 A;  1RFP A;  1UIG A;  3V2W A;  2RBP A;  1LYJ A;  2YVB A;  4QDN A;  4NGI A;  2GV0 A;  2RBS A;  167L A;  4KL7 A;  1L11 A;  189L A;  1F10 A;  1NDG C;  1L71 A;  1C45 A;  1GE1 A;  2BQE A;  5FEL A;  4B0D A;  1OVK A;  4WL7 A;  1J1O Y;  1L98 A;  1JIY A;  2RB0 X;  1UIF A;  1F6R A;  1DKK A;  1C6N A;  3TXJ A;  3D9A C;  1JTT L;  3PDS A;  2B73 A;  4H91 A;  1CKH A;  4AGA A;  4S0W A;  1G0J A;  1C6I A;  1DI5 A;  1LYO A;  2HED A;  1L25 A;  2RBQ A;  5I4Y A;  4HTQ A;  1NDM C;  3C81 A;  1WQQ A;  4WM3 A;  250L A;  1B5Z A;  1I56 A;  1QTZ A;  113L A;  1F6S A;  5KXN A;  1IP7 A;  1LSZ A;  3WVX A;  1WQO A;  1FLQ A;  4ML7 A;  1L34 A;  1DKJ A;  1CKD A;  3GUP A;  1JTO L;  1CKG A;  1GE3 A;  1GD6 A;  3HH5 A;  4E97 A;  1GDX A;  3CSZ A;  161L A;  4DDC A;  5KY1 A;  4MCK A;  1G0K A;  1YKY X;  4W56 A;  4DD3 A;  3A91 A;  115L A;  3M18 B;  3A6B Y;  1EQ5 A;  1WQP A;  4HP0 A;  164L A;  1L63 A;  4WM6 A;  2B5Z A;  1JPO A;  1QUG A;  3M3U A;  1LJG A;  3CDT A;  4NHQ A;  3SB6 A;  3HTD A;  194L A;  3B0K A;  4DD2 A;  1B2K A;  1L02 A;  1AM7 A;  1LJI A;  4TWS A;  3TMV A;  5B1F A;  1LZB A;  2HUK A;  3RZE A;  1QTC A;  2HEE A;  1PQD A;  173L A;  2B6W A;  3EBA B;  1GFR A;  1LSE A;  1C6J A;  4Z3M A;  3A8Z A;  1L0J A;  1OWZ A;  5LXW A;  3HU9 A;  4ARL A;  3GUK A;  1OQM A;  4QY9 A;  1RJC B;  208L A;  1V7T A;  4M6D A;  3W6B A;  2I6Z A;  3A95 A;  3HUK A;  1LYI A;  3B0I A;  3B72 A;  1D0K A;  1LZS A;  1HER A;  1LZY A;  1GBZ A;  1CV0 A;  4H92 A;  4MR1 A;  2BQM A;  5LIO A;  4NGV A;  2Y8P A;  2BLY A;  4OWC A;  2ZIK A;  5T3F A;  4XJH A;  3TXI A;  1L45 A;  1T8A A;  5LVK A;  1QTB A;  1UA6 Y;  4G49 A;  149L A;  3SN6 R;  4DWX A;  4RW1 A;  2CDS A;  2YDG A;  1LZ9 A;  1L19 A;  5L3H A;  1B5V A;  5LYZ A;  3ODU A;  3WW5 A;  1L22 A;  1VDT A;  5J7C A;  1C6G A;  183L A;  1RE2 A;  4CHX A;  4DKL A;  2FBD A;  219L A;  2OE7 X;  2DBT A;  2O79 A;  2BPU A;  1LJH A;  3FI5 A;  1ALC A;  2ZIL A;  1CJ8 A;  127L A;  1L54 A;  1BWJ A;  3LZ2 A;  1CU6 A;  4FDY A;  3SB7 A;  243L A;  110L A;  186L A;  4OO9 A;  4PRQ A;  1L18 A;  1UIB A;  170L A;  1IWX A;  1YAP A;  1XGR C;  222L A;  2B70 A;  1TEW A;  5EBH A;  2ZWB A;  2F30 A;  4I0C A;  1OUA A;  1IOC A;  1WQN A;  215L A;  2X0A A;  1C6C A;  1L09 A;  1XJU A;  1LSC A;  1L60 A;  140L A;  1L44 A;  1OUH A;  232L A;  4DQ5 A;  1LJK A;  1JWR A;  5KXY A;  1CX6 A;  5LVJ A;  1CV6 A;  4EPF A;  1LJ3 A;  228L A;  1K28 A;  1GPQ C;  4G4H A;  1CUP A;  2B74 A;  5I4X A;  1VDP A;  1L79 A;  4DT3 A;  4NHS A;  1CU5 A;  3WXT A;  1P6Y A;  3W6F A;  1RCM A;  4IJ4 A;  2CUU A;  2EIZ C;  1HFZ A;  1QSQ A;  1QS9 A;  5I14 A;  3CT0 A;  4DD9 A;  2OEA X;  1C6K A;  5B1G A;  3WUM A;  3WMK A;  3OJP A;  1LHJ A;  129L A;  3P64 A;  1IWZ A;  1P56 A;  3K3T A;  2RBR A;  1FDL Y;  4YEN A;  1F0W A;  1HML A;  5KXW A;  3B6L A;  196L A;  1C6M A;  2Z37 A;  3B0O A;  5LAF A;  1OUD A;  1HSW A;  4WM4 A;  1NBZ C;  3AGG G;  1QUS A;  1KW7 A;  1QSW A;  1HSX A;  1QT8 A;  3PBL A;  5B59 A;  3G3W A;  2H9K A;  1FKQ A;  2RB2 X;  249L A;  1L72 A;  3HH3 A;  1UIH A;  187L A;  1XGQ C;  4WG7 A;  3D4S A;  3K2R A;  1GFJ A;  1L05 A;  1IWT A;  1OVJ A;  5AMY A;  4BAD A;  2DQA A;  1QS5 A;  1TCY A;  3IJU A;  114L A;  3AZ4 A;  4RLN A;  4WO9 A;  1KXX A;  4PJZ A;  2YBH A;  1GF3 A;  1D9W A;  1KNI A;  2B6X A;  1L56 A;  1W6Z A;  1DYA A;  1LHH A;  1L85 A;  2LCB A;  4Z98 A;  2A7F A;  1SLY A;  1L35 A;  3VWO A;  1IIZ A;  1YL0 X;  1LJN A;  1GXX A;  1GB9 A;  1DXJ A;  2AUB A;  3GUM A;  3V2Y A;  4R6C A;  4HTK A;  1LMP A;  1L90 A;  1LGU A;  4WM5 A;  1L57 A;  4H8X A;  1PQM A;  1C65 A;  1T8F A;  2G4P A;  3P68 A;  4H9E A;  4CJ2 A;  2Z12 A;  1C6P A;  2B75 A;  1D2Y A;  1NQI A;  3WUL A;  1GE4 A;  1IO5 A;  4I7P A;  1IP6 A;  1IWY A;  2MEI A;  1CU3 A;  4ZFP A;  2F4A A;  1L77 A;  2B72 A;  4ET8 A;  252L A;  1YKX X;  3ZEK A;  197L A;  2A7D A;  1OWY A;  4LYC A;  1JKB A;  4XYY A;  1OUF A;  1WTN A;  2XJW A;  6LZM A;  3FI7 A;  3A6C Y;  1T97 A;  3WPK A;  207L A;  1SSW A;  2Z2F A;  3DN3 A;  1MLC E;  2BQC A;  1LOZ A;  4XJG A;  2ZIJ A;  4OWH A;  5KXP A;  2F2N A;  5I53 A;  2F32 A;  1LSM A;  2B7X A;  4I8S A;  2VB1 A;  1QUT A;  241L A;  2MEG A;  1D9U A;  1LSA A;  216L A;  1D6Q A;  132L A;  1DPW A;  4C5F A;  1C63 A;  2B6Y A;  3CT5 A;  3LN2 A;  4WM2 A;  178L A;  4Z46 A;  1L69 A;  1LGW A;  165L A;  5I5Q A;  1CKF A;  2PC2 A;  1C64 A;  3J4G A;  5IDD A;  1H87 A;  1CV1 A;  1L49 A;  1L46 A;  1C08 C;  1G0M A;  1W08 A;  4I7J A;  2OU9 A;  1GDW A;  1GF7 A;  4LZM A;  3TXH A;  1EPY A;  1GHL A;  1JSF A;  1L33 A;  4H8Z A;  1V7S A;  4X3B A;  3C8S A;  5KXO A;  1P3N A;  2ZNW Y;  1XGP C;  4ET9 A;  4I7L A;  3F8V A;  4PGJ B;  4XN6 A;  133L A;  2BQG A;  1GBX A;  9LYZ A;  1SSY A;  4EKQ A;  4YEO A;  1P2C C;  1GBW A;  2FYD A;  4NSG A;  3HTB A;  1L47 A;  4UWU A;  4WLX A;  3AW6 A;  201L A;  260L A;  1HNL A;  135L A;  1B5W A;  220L A;  4KPM A;  1LZR A;  1L66 A;  1AT6 A;  3QY4 A;  5KXM A;  5B05 A;  1XFP L;  6LYZ A;  1A4V A;  2YBI A;  4Z41 A;  2OU8 A;  2RB1 X;  1IOQ A;  195L A;  4ETE A;  1UCO A;  5LYM A;  3L64 A;  4LGK A;  2XBR A;  1B5U A;  3CSQ A;  1G0P A;  2FYC A;  1L24 A;  1C69 A;  1IY4 A;  1GB6 A;  2OTY X;  2WAR A;  2G4Q A;  1D3N A;  2DQE Y;  2W1X A;  1LJ4 A;  1GBY A;  1YAN A;  1L68 A;  1ZV5 L;  1DYD A;  3OE9 A;  1L73 A;  1QT5 A;  1GF8 A;  2LZT A;  2BQB A;  137L A;  4LT0 A;  233L A;  4KXI A;  2HU1 A;  3P65 A;  4ETB A;  148L E;  1EQ4 A;  1ZVH L;  2OE9 X;  1L00 A;  2HEA A;  3GUI A;  1GF4 A;  5A3E A;  1C6E A;  1NMM A;  3TXG A;  3HTF A;  1BWH A;  4YEM A;  1L91 A;  4IAT A;  257L A;  4DYG A;  172L A;  240L A;  1LKS A;  4EXM A;  1IC4 Y;  3F6Z A;  2RAY X;  4PRU A;  5K7O A;  1YAM A;  1DYG A;  2MEH A;  2LYM A;  4NHT A;  1DYC A;  1UIE A;  2ZNX Y;  237L A;  210L A;  1QTK A;  1UIA A;  4J1B A;  246L A;  4WLT A;  259L A;  1T6V L;  1NBY C;  3HWL A;  143L A;  262L A;  1JSE A;  1L26 A;  4LDO A;  1LHM A;  1RI8 B;  1LW9 A;  4EMN A;  2I25 L;  5KKJ A;  2D6B A;  3N9E A;  2H9J A;  1LSY A;  182L A;  4NG8 A;  3HBH A;  1XGT C;  236L A;  4OOT A;  1LPY A;  1UID A;  1JUG A;  1G7H C;  3BKH A;  1L89 A;  2IGC A;  1OYU A;  4N9R A;  4EJ4 A;  1DI3 A;  2B6T A;  4EOF A;  175L A;  1L23 A;  4I7R A;  2CGI A;  205L A;  225L A;  2Z18 A;  2CWI A;  146L A;  1REM A;  4H9I A;  171L A;  1LI6 A;  4C3W A;  3CDV A;  3HDF A;  5IEL A;  139L A;  103L A;  1B7M A;  256L A;  2B6Z A;  1QT3 A;  1B7O A;  2DQJ Y;  1ZMY L;  2MEA A;  4RDS A;  1D6P A;  1GBO A;  2DQI Y;  1TDY A;  3AGI A;  4B4I A;  193L A;  4LT1 A;  1B7L A;  3HBE X;  3DN1 A;  5D5F A;  3HH4 A;  1L15 A;  4NGJ A;  1GF6 A;  3HBD A;  152L A;  3C8R A;  1CVK A;  2Q9E A;  1JEF A;  1LZN A;  2XBS A;  5C6J A;  1L51 A;  3WU7 A;  199L A;  2DQG Y;  1FKV A;  5LYT A;  4HJV A;  4LDE A;  1WQR A;  1L03 A;  1GBS A;  3SB8 A;  4WOA A;  4NEB A;  2HUB A;  180L A;  1L10 A;  4NY5 A;  3E3D A;  1L58 A;  1XGU C;  1L13 A;  1LTM A;  200L A;  1UC0 A;  3W6C A;  1IP3 A;  2F47 A;  4OWE A;  1L53 A;  3A3R X;  1LAA A;  4G4C A;  185L A;  1H6M A;  153L A;  1UBZ A;  3RU5 A;  1BHZ A;  1IWV A;  244L A;  3AJN A;  1OVH A;  4HSF A;  158L A;  1L37 A;  2ZYC A;  3GUO A;  4GLV A;  3RW8 A;  3WU8 A;  1KXW A;  4NSI A;  4EPI A;  1IY3 A;  1G1W A;  2BQA A;  2LHM A;  5ILC A;  2RSC A;  3DN8 A;  1QTE A;  1C68 A;  3C7Y A;  3W6A A;  2OTZ X;  4W57 A;  3WXU A;  2BQI A;  2D4J A;  1C6T A;  3HUA A;  1Z55 A;  3OE0 A;  2QAR C;  4II8 A;  4ETD A;  4K5Y A;  2DQD Y;  2RAZ X;  1QT7 A;  4AQN A;  3C82 A;  1LJF A;  174L A;  4EKS A;  213L A;  156L A;  3W6D A;  2CJL A;  1HEW A;  1L61 A;  1G7J C;  5DN5 A;  1B7N A;  5LA8 A;  4I7T A;  5FEK A;  1T8G A;  1IR8 A;  4PPO A;  1IOT A;  5KXL A;  2NWD X;  3OE8 A;  4YOP A;  7LZM A;  3N9A A;  5E4P A;  4W54 A;  1IVM A;  1HEL A;  2YSS C;  3WUN A;  1I6S A;  1YAQ A;  2BLX A;  1LCN A;  231L A;  4CFO A;  2HEB A;  1KIR C;  1L08 A;  5E9R A;  1WVV A;  1B0D A;  1L12 A;  3DMZ A;  1LYS A;  5LZM A;  1L16 A;  1VED A;  122L A;  1L40 A;  5KKI A;  145L A;  1L21 A;  1LZE A;  3GXR A;  1IOR A;  1SX7 A;  3SBB C;  4TX7 A;  1XEP A;  5LIN A;  1T3P A;  1IC5 Y;  4B49 A;  1L55 A;  1L41 A;  2BQJ A;  3CT1 A;  176L A;  3A3Q A;  1DYE A;  1L97 A;  3DMV A;  4WLY A;  1PQO A;  188L A;  1L93 A;  5DL9 A;  1QUH A;  1LJJ A;  2MEB A;  2W1L A;  3EML A;  4G9S A;  5FHW A;  4LT2 A;  1G07 A;  1QIO A;  247L A;  4HJZ A;  4J1A A;  3IWR A;  3C83 A;  1L64 A;  3FAD A;  3D3D A;  2IFF Y;  190L A;  1L84 A;  2OU0 X;  3WPJ A;  4OOO A;  1IP4 A;  3A96 A;  134L A;  1GFU A;  1TLA A;  4NGW A;  223L A;  1DPX A;  3TXK A;  1LSF A;  1LSD A;  3TXF A;  5C6L A;  1HMK A;  2YBN A;  2Z38 A;  1C10 A;  1SWY A;  4GCE A;  1D0M A;  3HDE A;  2I26 L;  3TXE A;  3TMU A;  3LYO A;  1LYZ A;  1GF9 A;  4XJF A;  1YKZ X;  6LYT A;  1L75 A;  3CB7 A;  3W6E A;  1JJ3 A;  123L A;  5F9U A;  1VDQ A;  1LMN A;  102L A;  1GAZ A;  261L A;  4OW1 A;  2D91 A;  1EQE A;  3W3E A;  1CV3 A;  3C7W A;  141L A;  4H9C A;  5KXK A;  1WVU A;  221L A;  1XJT A;  154L A;  5LVI A;  3ULR A;  1C43 A;  3WVY A;  1QDT A;  191L A;  1BGI A;  3AZ6 A;  4AXT A;  3TMW A;  1L96 A;  4XEN A;  1B9O A;  2YBL A;  1PQI A;  2BQO A;  1P46 A;  1QT6 A;  1BQL Y;  4TTD A;  1DYB A;  4DDB A;  3LYM A;  4WL6 A;  1FLY A;  1O23 A;  1GFA A;  4EKP A;  1P36 A;  1JTM A;  3DKE X;  3HT7 A;  3HUQ A;  2ANX A;  2DQC Y;  4NGK A;  4LFP A;  1A2Y C;  4HV2 A;  1MEL L;  4XJI A;  1FN5 A;  2HEF A;  2HUM A;  4HPE A;  1C60 A;  4UWN A;  5HNC A;  5FCP A;  3A93 A;  4BAF A;  2OE4 X;  2LZM A;  3WYH A;  1QUD A;  2HEC A;  4LYB A;  4ZEE A;  1GFK A;  2ANV A;  3SP3 A;  3HH6 A;  4LT3 A;  2EQL A;  1XEK A;  4LZT A;  128L A;  1OUC A;  1GE2 A;  1HHL A;  1LHL A;  1LYF A;  4I7O A;  4N8Z A;  1L04 A;  1LYG A;  1JTN A;  1IR7 A;  3WUA A;  3T36 A;  1L65 A;  3DN0 A;  1JKA A;  1IP5 A;  1HF4 A;  119L A;  163L A;  4FJR A;  224L A;  1BB3 A;  1CU2 A;  1C7P A;  4NSJ A;  1LPI A;  1L39 A;  2D4K A;  104L A;  1JKD A;  4HV1 A;  1B5X A;  1L59 A;  3RUN A;  1OUE A;  1XEJ A;  1T6H A;  1LMQ A;  1GB7 A;  2XQO A;  1UIC A;  1LGX A;  1YQV Y;  1L52 A;  235L A;  245L A;  4NWH A;  4GN5 C;  2FBB A;  5ILF A;  4B4J A;  4N5R A;  1GF0 A;  3EXD A;  1ZVY B;  1REZ A;  2HU3 A;  3C7Z A;  1GEV A;  1LLH A;  2YBM A;  4WM1 A;  1L31 A;  218L A;  5II3 A;  3A92 A;  1ZUR A;  1NHE A;  1GEZ A;  1GAY A;  2RBN A;  3JR6 A;  3A94 A;  4MST A;  1LYY A;  3NY8 A;  1HFY A;  1C6F A;  3DN2 A;  3WH1 A;  3T6U A;  1LZ8 A;  5KXR A;  1P5C A;  4CFP A;  5HNL A;  1KXY A;  1L80 A;  4DC4 A;  1C66 A;  1LSP A;  4WG1 A;  1YL1 X;  1JQU A;  4L41 A;  2IHL A;  5APE A;  1CJ9 A;  4LYO A;  5HQ1 A;  4I7K A;  3DNA A;  1OUG A;  1XEI A;  1BB4 A;  253L A;  1JTP L;  166L A;  1IP2 A;  1L81 A;  1LZ5 A;  155L A;  1GF5 A;  1GWD A;  3N9C A;  1GB0 A;  4I7S A;  3A67 Y;  1GB3 A;  4DAJ A;  1GFE A;  4J7V A;  1CV4 A;  3AZ7 A;  4E3U A;  4HTN A;  5B07 A;  1QT4 A;  1KY1 A;  1B7R A;  5IHG A;  2MED A;  2MEF A;  4H9H A;  1JJ0 A;  1QTD A;  2BAA A;  3WL2 A;  168L A;  1G0Q A;  3LZM A;  4ARQ B;  5M1Y A;  5APD A;  4OWB A;  4YXA C;  1IWU A;  1WQM A;  2LC9 A;  226L A;  1J1P Y;  3OK0 A;  2F2Q A;  3QNG A;  1G7I C;  3HT6 A;  1C6H A;  4N0J A;  4B1A A;  162L A;  1B7P A;  1HFX A;  3CDR A;  1IP1 A;  1C6D A;  1L14 A;  1C67 A;  4NWE A;  1SQ2 L;  1G0L A;  1CV5 A;  1C61 A;  138L A;  1AZF A;  4ARQ A;  1IWW A;  1L17 A;  1LSB A;  2QB0 B;  4WO6 A;  1UAC Y;  1LMC A;  150L A;  3SB5 A;  2LYZ A;  1GFH A;  1TBY A;  144L A;  258L A;  1G7L C;  4DQ7 A;  5DN4 A;  1PS5 A;  1C6B A;  1L74 A;  1ZYT A;  4ETA A;  1HEP A;  4H93 A;  4U3X B;  3P4Z A;  198L A;  3A90 A;  1L87 A;  4PJ2 C;  1NKH A;  3LYT A;  1LZC A;  3BKV A;  1I1Z A;  4NHI A;  4J0L A;  2LYO A;  3C80 A;  4GCC A;  4CGE A;  4QGZ A;  4H9F A;  5B06 A;  1D3F A;  1YIL A;  4R0F A;  3G3X A;  1NWG A;  5KXS A;  2C8O A;  1L95 A;  192L A;  2Z2E A;  112L A;  1CTW A;  1FLW A;  1VDS A;  3A34 A;  5C6I A;  4A7D A;  3LHM A;  1C6A A;  1CUQ A;  2LZ2 A;  1JJ1 A;  4I7N A;  2W1M A;  3CDO A;  4LYZ A;  4HPI A;  3GXK A;  1DYF A;  4DDA A;  1L32 A;  4TSB A;  1LZG A;  1JKC A;  227L A;  1L28 A;  1PZY A;  1GB5 A;  147L A;  206L A;  2Z19 A;  1L27 A;  212L A;  3LZT A;  2ZQ4 A;  4YM8 A;  5HMV A;  3HT8 A;  4WMG A;  1IX0 A;  3VW7 A;  1C6Q A;  1CU0 A;  1LHK A;  5F16 A;  130L A;  1G06 A;  1PQJ A;  4I7M A;  1L48 A;  1L0K A;  1VFB C;  3L2X A;  4NHP A;  184L A;  3G3V A;  4OWA A;  2MEE A;  4YXC A;  4WLD A;  1OV7 A;  2D4I A;  1I20 A;  1LZ6 A;  1L38 A;  3SBA A;  2W1Y A;  3ZVQ B;  1LI2 A;  4H94 A;  1JHL A;  3UON A;  3WPL A;  1LJE A;  1BB7 A;  3G3A B;  4ARP A;  1L99 A;  1LWK A;  108L A;  1D0L A;  1C46 A;  2DQF C;  3P66 A;  5DLA A;  1PQK A;  169L A;  5LAG A;  3KAM A;  3AB6 A;  4W51 A;  160L A;  1LZ4 A;  1P7S A;  3FA0 A;  2EPE A;  1DI4 A;  4N1E I;  5F14 A;  5LVG A;  5KXT A;  3ZVQ A;  234L A;  3C8Q A;  1L50 A;  8LYZ A;  3TXB A;  4W55 A;  1KY0 A;  2ZYP A;  1D3M A;  1GFV A;  1L43 A;  4ARJ A;  3ATO A;  1L94 A;  3RZ4 A;  4DD1 A;  1P37 A;  1UUZ C;  3CQL A;  3HU8 A;  2HTX A;  4LYM A;  4DQJ A;  1BWI A;  2N5Z A;  2NTH A;  1L07 A;  229L A;  5APC A;  5A3Z A;  1OV5 A;  1VAT A;  4YX7 C;  1BVK C;  2O4W A;  131L A;  3GUJ A;  1LSN A;  1G1V A;  4NSH A;  1NF5 A;  4LDL A;  4NGO A;  1CNS A;  4GBR B;  1CJ7 A;  1LYE A;  1LYD A;  1WTM A;  3AW7 A;  151L A;  4W96 A;  4M4O A;  239L A;  4YF2 A;  4N1C C;  1KS3 A;  1QQY A;  4UWV A;  4LYT A;  5F9X A;  1L88 A;  3J6K A;  1SX2 A;  4XJD A;  2BQF A;  5F81 A;  3AZ5 A;  242L A;  4ARM B;  4P2E A;  3LYZ A;  1L76 A;  1AT5 A;  1IR9 A;  2H5Z A;  1L92 A;  1AKI A;  3RT5 X;  1BVX A;  3NYA A;  4TUN A;  1N4F A;  4KT3 A;  4QEQ A;  4H1P A;  1OUB A;  1CJ6 A;  1P64 A;  1XSF A;  125L A;  1BB6 A;  4W53 A;  2HUL A;  1P2L A;  142L A;  1LMA A;  1IC7 Y;  1OUJ A;  1QTV A;  120L A;  1YRO A;  1LKR A;  4ARM A;  4TSC A;  238L A;  3TXD A;  1JIS A;  157L A;  2L78 A;  4W94 A;  2BQD A;  4GCF A;  1LMO A;  1LZ1 A;  2DKV A;  2BQL A;  1GXV 2;  1QSB A;  4RW2 A;  1DQJ C;  5L9J A;  4GRV A;  5LA5 A;  1CKC A;  1HEN A;  1L01 A;  1LYH A;  4IAP A;  4H9B A;  1B7Q A;  3MGW A;  1L20 A;  1LHI A;  3ATN A;  1TAY A;  1LWG A;  1HEQ A;  181L A;  1GFG A;  4DJH A;  1GFT A;  1BB5 A;  4GLA A;  4BS7 A;  4NIJ A;  4GN3 A;  1GB2 A;  4PHI A;  7LYZ A;  2Z6B A;  3F9L A;  1KIQ C;  4ETC A;  3HFM Y;  5FDJ A;  1OP9 B;  1D2W A;  1C62 A;  1NHB A;  3HTG A;  4H9A A;  1GE0 A;  1REX A;  1REY A;  1L62 A;  2BQH A;  2O7A A;  1B5Y A;  255L A;  1L30 A;  1FBI X;  2ZQ3 A;  2RBO A;  4GCD A;  1EL1 A;  1KW5 A;  1YAO A;  5HLL A;  1DZB X;  4DD7 A;  3GUL A;  3EMS A;  5I4W A;  4W58 A;  3G3B B;  2BQN A;  1LZT A;  2A4T A;  3CDQ A;  3CSR A;  1D3J A;  1OUI A;  5FST A;  3DN6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...