1LYIA

Dissection of helix capping in t4 lysozyme by structural and thermodynamic analysis of six amino acid substitutions at thr 59
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
162
structure length
162
Chain Sequence
MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVIDKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(o-glycosyl)
molecule keywords T4 LYSOZYME
publication title Dissection of helix capping in T4 lysozyme by structural and thermodynamic analysis of six amino acid substitutions at Thr 59.
pubmed doi rcsb
source organism Enterobacteria phage t4
total genus 59
structure length 162
sequence length 162
ec nomenclature ec 3.2.1.17: Lysozyme.
pdb deposition date 1992-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00959 Phage_lysozyme Phage lysozyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.530.40 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 1lyiA00
1ZURA 1L66A 1L0JA 181LA 1L70A 1P7SA 1L45A 4PK0A 1QUHA 1D9WA 1L25A 3GUNA 4I7QA 2OU8A 3C80A 262LA 4EPFA 178LA 4DAJA 4EJ4A 1PQIA 3HTFA 1L31A 1G0PA 1C62A 4DJHA 1JTMA 2B75A 231LA 3OE0A 1QT5A 1C6DA 1L56A 1KY0A 1L09A 2RBSA 3DN2A 1C67A 1QSBA 104LA 227LA 189LA 4W58A 3C7WA 1T8AA 128LA 224LA 200LA 188LA 113LA 3NY9A 223LA 1L60A 1KW7A 1T8FA 1P64A 1L52A 251LA 1CU6A 3GUIA 114LA 3CDQA 1L84A 4LDOA 3F9LA 4YX7C 1L49A 1L35A 1XJTA 3HUQA 2ANVA 3SB8A 2Z6BA 166LA 3HH3A 4ARQA 2OTYX 4W52A 1C6CA 1LGXA 209LA 173LA 2QB0B 4I7PA 1XEPA 4I7MA 213LA 1LGUA 3HUAA 162LA 1PQJA 7LZMA 1QUDA 4W59A 239LA 1QTHA 149LA 1KNIA 145LA 3HT8A 1QTCA 1L86A 1L38A 228LA 1P3NA 1G0QA 3HTDA 1L73A 2F2QA 3D4SA 1L91A 4EKRA 1C6EA 2B6WA 1L21A 1PQMA 4YXCA 118LA 3GUJA 3SBBC 3EMLA 4ARJA 1L15A 167LA 2RBOA 4ARMB 3C8QA 1L14A 1P5CA 243LA 2HUMA 1CU0A 2RBQA 4GBRB 3HH5A 229LA 1L39A 148LE 157LA 1OYUA 3ODUA 3SBAA 2B70A 1QS9A 2OU0X 1T6HA 159LA 1L93A 4EKPA 1L46A 1L12A 1C6PA 144LA 4I7NA 1C6MA 4S0WA 3GULA 102LA 1L08A 252LA 258LA 3SN6R 242LA 3V2YA 1CV4A 1G0JA 244LA 1CX6A 4ARPA 4LDLA 1L03A 197LA 249LA 1EPYA 1C6AA 1L97A 1L48A 2IGCA 1L83A 212LA 1L17A 1C6KA 1L85A 1OWYA 226LA 1L74A 219LA 3G3WA 5I14A 1T97A 4OO9A 170LA 6LZMA 255LA 1LLHA 1G0LA 3NY8A 3DMVA 1QTDA 245LA 2HULA 190LA 1QTVA 1L99A 210LA 4W53A 1L47A 1LYIA 1L67A 1C6FA 1QT4A 4ZPUA 1G1WA 1L16A 241LA 1L89A 256LA 237LA 2L78A 5LZMA 3GUKA 195LA 184LA 1WTHA 3DN0A 4EKSA 3OE9A 126LA 196LA 165LA 1L53A 176LA 1C65A 1L76A 1L33A 4I7SA 4W57A 1CV6A 174LA 1JQUA 2B72A 3G3XA 3OE6A 236LA 1KY1A 3SB7A 137LA 4E97A 1L02A 1L05A 1DYEA 1L10A 2O79A 1L01A 1L51A 217LA 220LA 160LA 1LGWA 141LA 191LA 1LYJA 1L58A 1L22A 3DN6A 1L00A 4AQNA 1DYAA 163LA 2LC9A 1L71A 1D3FA 1L43A 1G0MA 205LA 1TLAA 2ANXA 3GUPA 1L50A 3L64A 253LA 2Q9EA 1G0GA 3CDVA 103LA 3G3VA 1LYDA 1L63A 1C6BA 180LA 1L07A 3HDFA 142LA 187LA 1L29A 1QSQA 1QTBA 158LA 192LA 1P2LA 3SB5A 2OE7X 3DN3A 1L40A 1XJUA 2HUKA 1CTWA 1DYBA 248LA 2CUUA 1L23A 3C7YA 107LA 129LA 218LA 1L81A 1C6GA 1L54A 172LA 1C63A 151LA 1C6JA 2LZMA 1LYGA 130LA 1I6SA 1CUPA 1G06A 1ZWNA 3DN4A 1ZYTA 1QUGA 1CU5A 3DKEX 152LA 1QTZA 175LA 3HUKA 206LA 1C69A 1L94A 3PBLA 1K28A 230LA 2F32A 4I7KA 1L75A 1L64A 3UONA 2RH1A 4ARLA 1C6NA 4EXMA 1CU2A 3HU8A 1L95A 238LA 2B6YA 211LA 1L19A 1LPYA 150LA 3JR6A 1OWZA 1P46A 3HT6A 3HU9A 115LA 2QARC 1D3MA 1L96A 3FI5A 2RB1X 1KW5A 4I7TA 3HH4A 4I7OA 3C8RA 1L11A 1QT8A 3HWLA 221LA 254LA 110LA 1LYHA 1QUOA 234LA 1PQKA 4EPIA 4PJZA 1SWYA 1L27A 3DN8A 1G1VA 1P6YA 1C64A 2NTGA 1L24A 1QT7A 4I7LA 4LDEA 4EKQA 1L26A 1DYDA 1L79A 1CVKA 1D2WA 257LA 1CUQA 1L72A 2RAZX 1T8GA 1L34A 3NYAA 259LA 3C81A 3RZEA 1LI6A 1L98A 1PQOA 3C83A 3CDOA 1CX7A 122LA 4W55A 1SSWA 1L28A 2OE4X 143LA 3SB9A 1L68A 3PDSA 2RAYX 4DKLA 247LA 3DMZA 260LA 125LA 1C6IA 156LA 1L69A 1P56A 112LA 2Q9DA 3DMXA 4LZMA 171LA 3OE8A 1LW9A 1C6TA 3C7ZA 4I7RA 1L55A 201LA 3CDRA 3CDTA 3V2WA 4IAPA 2RB2X 233LA 183LA 1CU3A 216LA 3DNAA 2LCBA 2NTHA 1L59A 3L2XA 3DN1A 2B7XA 1L36A 3HTGA 2O4WA 2RB0X 1SSYA 2OEAX 1NHBA 138LA 1L42A 1P36A 1DYGA 1L82A 1OV7A 1C61A 1QS5A 1LWGA 1PQDA 3GUMA 1SX2A 1KS3A 3FA0A 1D2YA 168LA 1G0KA 1L62A 246LA 4YXAC 2A4TA 2B74A 2RBPA 199LA 1JTNA 139LA 1L87A 1CV3A 1D3NA 1B6IA 1L80A 1LI3A 4ARMA 146LA 1C6QA 3HDEA 4W54A 177LA 2OE9X 111LA 1L37A 1OV5A 1L06A 1P2RA 1SX7A 1LI2A 250LA 1L92A 1L0KA 1C68A 1P37A 240LA 1G07A 4ARQB 4I7JA 3HTBA 214LA 1L32A 3FADA 1SWZA 1CV1A 2RBNA 1L77A 261LA 1L44A 1L61A 1LYEA 3HT9A 1QT3A 3QAKA 3F8VA 2B6TA 1C66A 186LA 3C8SA 161LA 131LA 2F47A 1L20A 1QT6A 3HH6A 169LA 1C60A 185LA 1L04A 222LA 3RUNA 198LA 2RBRA 147LA 1L30A 120LA 109LA 1L18A 1L88A 3LZMA 1DYCA 1CV0A 215LA 2B6ZA 3VW7A 1L90A 164LA 4W56A 1D3JA 3SB6A 3C82A 4K5YA 2OU9A 1LYFA 1L65A 123LA 108LA 1DYFA 4W51A 119LA 1C6HA 182LA 1CV5A 2O7AA 225LA 2B73A 2OTZX 3HT7A 235LA 1OVHA 3GUOA 2B6XA 127LA 4GRVA 140LA 1LWKA 3K2RA 1C6LA 155LA 1OVJA 1OVKA 232LA 1L57A 1L13A 1L41A
chains in the Genus database with same CATH superfamily
5KXWA 1D9UA 4PK0A 1LMQA 4NSHA 3CSZA 5D5FA 1REZA 5T3FA 1PQIA 1G0PA 2F4GA 4LGKA 3P68A 2W1YA 5APDA 1XGQC 1DXJA 231LA 3OE0A 1QT5A 4OWBA 227LA 2EIZC 1H6MA 1T8AA 128LA 2LHMA 224LA 2DQCY 3VWOA 4J7VA 1BWJA 4ETBA 4BAFA 4W94A 2GV0A 3AZ6A 251LA 1CU6A 4QEQA 1L84A 5B59A 4YX7C 3RNXA 1IORA 2ANVA 1IY3A 1OQMA 4WLTA 1HFZA 1BB4A 2OTYX 2VB1A 1C6CA 1LGXA 1INUA 4I7MA 1IP6A 1V7SA 4LYCA 1PQJA 1QUDA 239LA 1QTHA 1WQQA 3T36A 145LA 1L38A 1VDQA 4KPMA 1IP7A 1L91A 2EQLA 5F14A 1SQ2L 4NFVA 118LA 3TMWA 4R0FA 1V7TA 1OUBA 167LA 2DQAA 1LZ4A 1DZBX 4B4JA 1P5CA 2HUMA 1LSZA 5KY1A 5LAGA 4DQ7A 5L3HA 4XJBA 1RFPA 2BQHA 1HNLA 2B70A 5KXYA 5APFA 1PS5A 5KXZA 1L46A 3IWRA 1C6PA 5K7OA 102LA 1FN5A 1L08A 258LA 1CV4A 1H87A 2D4IA 5DL9A 1A4VA 1B7QA 4ANRA 4HTNA 4LDLA 249LA 4DQJA 1BB5A 1DI3A 1EPYA 1C6AA 4WM1A 4YM8A 1L83A 212LA 1IP3A 1CKFA 4I8SA 1L17A 1L85A 1OWYA 5KXMA 226LA 5L9JA 4HJVA 1L74A 5C6IA 5I14A 6LZMA 170LA 3J4GA 5LVIA 3WVXA 5E4PA 1J1OY 1GFTA 1KXWA 190LA 1QTVA 2Q0MX 1L99A 210LA 4OW1A 5HQ1A 4CFOA 1QT4A 1C6FA 2IHLA 1C08C 1O23A 3DN0A 4TSCA 3OE9A 4PHIA 126LA 1LZBA 1OUEA 5KXNA 4H93A 1LYOA 1I1ZA 1NF5A 3WU8A 1KY1A 3TXJA 1ZVHL 1L05A 1DYEA 1G7JC 1L10A 1L01A 1L51A 2Z12A 2D4KA 3A92A 141LA 1DQJC 1LYJA 3LZTA 3DN6A 2FBBA 4KXIA 4XJFA 1G0MA 2HU1A 3G3VA 5KKIA 4H8YA 4LYOA 187LA 1P2LA 2OE7X 4B0DA 1L40A 2ZNXY 2CUUA 248LA 3C7YA 1IR8A 2ZIJA 4Z41A 172LA 130LA 5LIOA 1G06A 3TXIA 3DN4A 1GB8A 1ZYTA 1GBXA 2HU3A 4RLMA 5I4XA 152LA 1LHMA 1C69A 1JHLA 230LA 2F32A 1XGRC 3UONA 4ET9A 1BVXA 4YEMA 1WVVA 3TMXA 1HEWA 1L95A 150LA 1AT5A 3JR6A 5D5CA 1F6SA 1GF0A 4CHXA 1B5XA 1GB7A 5KJ9A 2YBHA 3LYMA 4I7OA 3C8RA 1QT8A 2BQGA 3M3UA 1IIZA 1QSWA 1ZV5L 1HEOA 1L27A 1RCMA 2AUBA 1L24A 4LDEA 3WU7A 2BQJA 5LVGA 1CVKA 1D2WA 1CUQA 2RAZX 3C81A 1TDYA 4QDNA 3RZEA 1KXXA 1KXYA 1B7LA 5LXWA 3CDOA 2C8OA 4TWSA 2HEEA 5I53A 1LHIA 3PDSA 2RAYX 1WQNA 4TSBA 1WTNA 156LA 1L69A 112LA 4WG1A 4NG8A 4I7RA 1L55A 3CDRA 3IJVA 4IAPA 183LA 1CU3A 1LJ4A 1GBOA 2FYDA 2MEFA 4WM2A 2NTHA 4QGZA 1L36A 1QUSA 3AYQA 2RB0X 1SSYA 5LYZA 1NHBA 1P36A 1LJJA 1L82A 1B7MA 2DQHY 4HTKA 1UIDA 1LWGA 1GE2A 3GUMA 168LA 1G0KA 1BB6A 199LA 1LSCA 1UIGA 1GXV2 4HV2A 5KXPA 1L80A 1YROA 2HEBA 177LA 1LI2A 1L0KA 2BAAA 5LAFA 1B5VA 3W6CA 1BB7A 1L32A 2B5ZA 2IFFY 4NGOA 4LYZA 1C45A 3CSRA 3D3DA 3WL2A 3TMVA 1E8LA 1WQMA 3GXKA 4KL7A 5I5QA 5LYTA 1UIFA 186LA 4B49A 5L3IA 1DPXA 131LA 1LTMA 1GF3A 1L20A 1G7HC 2BLXA 5B1GA 1VFBC 185LA 1LHLA 3QE8A 1GDXA 120LA 2XTHA 4H9FA 3T6UA 1L90A 1D3JA 2W1XA 3C82A 2OU9A 1LYFA 1DYFA 108LA 1LSPA 1QTEA 4NGKA 1CV5A 225LA 135LA 2MEGA 2MEEA 4EOFA 3K2RA 1C6LA 1GFGA 4M4OA 4N0JA 1OVKA 232LA 1L57A 7LYZA 3J6KA 2XQOA 3OJPA 181LA 5B1FA 1L45A 5HMVA 1QUHA 4FJRA 1L25A 3GUNA 4I7QA 4WLDA 2HEDA 2OU8A 3C80A 4EPFA 4U3XB 2G4NA 4EJ4A 1JKDA 4NSIA 4OOOA 2HUBA 4DJHA 5IHGA 1GB2A 1JTMA 4N9RA 2H5ZA 1IY4A 4NGJA 1L56A 1L09A 3WPLA 5I4WA 3A67Y 4NHSA 189LA 4W58A 1HC0A 3C7WA 2DBTA 5LVKA 1JWRA 200LA 4PRQA 6LYZA 1L52A 4WM3A 1D0MA 114LA 1KIQC 4LDOA 2ZNWY 3RU5A 1L35A 4IASA 4NGZA 1OUAA 4NWHA 1FDLY 5KXTA 3N9CA 166LA 1LCNA 3HH3A 1I20A 1HFXA 3TXDA 4W52A 209LA 1XEPA 1OUDA 1GHLA 162LA 1LKRA 4GN5C 4QY9A 5KXRA 1C10A 4W96A 3AGHA 149LA 1KNIA 1RJCB 1QTCA 1L86A 3HTDA 1MELL 4XJDA 1BGIA 2F2QA 1IP2A 3D4SA 1JISA 153LA 1C6EA 3SBBC 3TMUA 1B5ZA 1TCYA 1GEVA 2C8PA 1EQEA 2LZTA 3HH5A 229LA 1OYUA 157LA 3ODUA 3LYZA 4OOTA 1NDMC 1QS9A 2XBRA 4X3BA 159LA 1BB3A 1D0KA 1OUJA 4I7NA 3AZ7A 4Z3MA 4E3UA 1GFAA 4OWEA 242LA 1N4FA 2YBMA 1G0JA 3A93A 3AGGG 5A3ZA 4Z46A 4N1EI 1B7OA 1L03A 2LYMA 2CJLA 4WM5A 1WTMA 1LSBA 3CQLA 1L97A 3TXGA 3A94A 4NSJA 3D9AC 2YDGA 4DD9A 5KXOA 5II3A 1GFRA 1T97A 255LA 1YANA 3NY8A 1RI8B 3LZ2A 4PRUA 3W6AA 4EMNA 1AM7A 2Z18A 1XGTC 1LYIA 4KT3A 241LA 1L89A 5LZMA 1G7IC 2XBSA 2XJWA 196LA 165LA 2MEBA 1C65A 2ZYPA 4W57A 174LA 3TXFA 1JQUA 1NHEA 4TX7A 137LA 1XGUC 1L02A 1NQIA 1GAYA 5F81A 2O79A 2DQJY 217LA 4H9BA 1HMLA 1HSWA 1QIOA 1L22A 1DYAA 1YKXX 1IWXA 1LMNA 1LZTA 3RT5X 1GB5A 1LAAA 3WULA 3TXEA 4LT2A 3W6BA 5J7CA 1VDPA 4WL6A 180LA 1LMTA 1LZNA 2YBIA 1GF9A 2YBNA 1QTBA 158LA 207LA 3DN3A 1HEPA 1XJUA 2HUKA 2F4AA 1CTWA 1L23A 4GN3A 107LA 218LA 1L81A 1C6GA 1EQ4A 1JKAA 1IWUA 4DD0A 1C46A 1LZEA 4H92A 1B5YA 1GE4A 1CU5A 1MLCE 4UWNA 1GAZA 1IWTA 2BQIA 3PBLA 3CSQA 1EQ5A 3A91A 3TXBA 4ARLA 1UACY 1C6NA 1GB9A 1HF4A 1CU2A 3HU8A 1LSNA 1AT6A 2B6YA 3AGIA 4GN4A 4XENA 1CJ9A 4C3WA 1P46A 3HT6A 3HU9A 1LZAA 2QARC 4DD7A 4I7TA 4HPIA 3WPJA 3HWLA 221LA 1LYHA 2DQEY 1PQKA 3ATNA 2Y8PA 4PJZA 1XEIA 1GF4A 4WM4A 3DN8A 4I7LA 2NTGA 3TXHA 1LJ3A 1L79A 2BQCA 1NBZC 257LA 2LYOA 3CT0A 1LMPA 3NYAA 1LI6A 1PQOA 3C83A 4HPEA 2DQDY 1FLUA 1JTPL 1P2CC 1L28A 5AMYA 143LA 3SB9A 5M1YA 2Z39A 4DKLA 1QUTA 247LA 260LA 5DM9A 1C6IA 1GE3A 2Q9DA 1P56A 4J0LA 1LW9A 1C6TA 4NHPA 3WXTA 3CDTA 3V2WA 1CJ7A 1LJIA 2RB2X 233LA 4C5FA 4UWUA 4DC4A 2O4WA 4MR1A 4OWAA 1YILA 2OEAX 1LJGA 1UIAA 1DYGA 1OV7A 1C61A 1LZ5A 154LA 1QS5A 1IOTA 1LMCA 1PQDA 1FKQA 1GE0A 1LZDA 1D2YA 246LA 5FCPA 4N8ZA 1VAUA 139LA 1F0WA 1L87A 4M6DA 1CV3A 1JKBA 1B6IA 1XGPC 5I54A 146LA 1C43A 1C6QA 1EL1A 2I26L 2OE9X 1OV5A 1L06A 2A7FA 1LHKA 4DWXA 1JTTL 1C68A 4ARQB 1NDGC 3P64A 1CV1A 4GCBA 1LSGA 2RBNA 261LA 4Z98A 1L61A 3HT9A 1QT3A 2MEAA 1AZFA 2B6TA 3LN2A 3HBDA 3C8SA 161LA 1GF5A 1IX0A 1VEDA 2G4PA 2ZILA 5B06A 2F47A 3HH6A 1C60A 3RUNA 1OP9B 2LZ2A 4P2EA 1L18A 1DYCA 1LSAA 1YKYX 1C6HA 1OUIA 182LA 1UA6Y 2O7AA 1YL1X 4WMGA 3WYHA 1IOCA 4GRVA 1HELA 3CT5A 1LMOA 1ZURA 4DYGA 1L70A 1P7SA 1IVMA 5HNCA 1UUZC 1GBWA 1CNSA 3ZVQB 178LA 4TUNA 4DD1A 4HJYA 5DN5A 2DQIY 2HEFA 1I56A 2B75A 5LYMA 1GBYA 3DN2A 1GD6A 1JSEA 3AZ4A 1REYA 4LFPA 2MEHA 4ETEA 1J1XY 4RW1A 223LA 1L60A 1KW7A 1T8FA 1P64A 1JJ1A 4XN6A 4DD3A 5ILCA 1LSDA 1L49A 1ZMYL 1XJTA 4MSTA 2BQLA 3HUQA 4LZTA 3SB8A 2Z6BA 1KIPC 4IJ4A 4ARQA 1B7RA 2ZIKA 213LA 2Z19A 3IJUA 4H8XA 4LFXA 4W59A 1IP1A 5ILFA 4DDCA 5HLLA 3W6FA 1JKCA 1P3NA 5FSTA 1HEQA 1L73A 1IOSA 3KAMA 1NMMA 4DQ5A 1JPOA 3EBAB 1LOZA 1L21A 1CJ8A 4YXCA 4G4CA 3GUJA 1HMKA 4GLAA 1XFPL 2RBOA 4ARMB 5A3EA 1GFUA 4ETCA 1CU0A 2RBQA 4GBRB 4CJ2A 1L39A 148LE 1GFEA 4TTDA 5JENB 3SBAA 2RSCA 1HSXA 2D6BA 2OU0X 2WARA 4EKPA 2BPUA 1L12A 1UCOA 1C6MA 4S0WA 3SN6R 2CDSA 244LA 3P4ZA 4L41A 5KXKA 4XJHA 1CX6A 2N5ZA 4ARPA 197LA 4GCCA 3TXKA 3WUAA 2IGCA 2EKSC 1IR9A 1C6KA 2BQKA 3G3WA 1GF6A 4OO9A 4H9HA 1G0LA 3A95A 1QTDA 245LA 4OWCA 2DQFC 1L47A 1JIYA 1GBZA 2YBLA 1L67A 1B7SA 1G1WA 256LA 2L78A 1IEEA 5FEKA 195LA 184LA 1WTHA 4EKSA 1IC4Y 3WXUA 3N9AA 1L53A 176LA 1L76A 1NBYC 1JUGA 1CV6A 4NGWA 1DPWA 2B72A 3OE6A 236LA 3SB7A 1GFVA 4E97A 3P65A 4R6CA 220LA 2MEDA 160LA 1LGWA 1GE1A 4XYYA 3WW5A 191LA 1W08A 1L00A 4AQNA 5FHWA 1IP4A 4XJGA 2Z37A 1L43A 1TLAA 3L64A 1JTOL 2BQDA 1LSEA 1OUHA 1Z55A 2Z2FA 5APEA 4HTQA 1L63A 1LYDA 5KXLA 1IWVA 2BQNA 3HDFA 142LA 1L29A 1QSQA 3AW7A 4LT1A 4DT3A 1DYBA 5FDJA 129LA 1UC0A 5EBHA 1C63A 1C6JA 1D0LA 2ZQ4A 2LZMA 4NHQA 4NGVA 1I6SA 5LA8A 3SP3A 4YOPA 1NWGA 1QUGA 3WVYA 2LYZA 1QDRA 1QTZA 175LA 3HUKA 206LA 1D6QA 1L94A 4CFPA 4I7KA 2Z2EA 1YAQA 134LA 1L64A 1LZSA 238LA 4NEBA 1L19A 1LPYA 4J1BA 4NGIA 1PZYA 1D3MA 1L96A 1KW5A 1YAPA 1L11A 1VATA 4AGAA 4ETDA 234LA 1GDWA 4FDYA 2H9JA 1CKGA 1VDTA 3WMKA 5LVHA 1REMA 1SWYA 4N5RA 1G1VA 1P6YA 4BAPA 1QT7A 1CKHA 4EKQA 3MGWA 1BWIA 1LZ9A 3HBHA 1G7MC 1L72A 1T8GA 1L34A 1LHJA 3CT1A 1L98A 2G4QA 1XSFA 1CX7A 4H8ZA 122LA 1YIKA 4HSFA 1SSWA 4N1CC 1GFKA 2OE4X 5LA5A 2ZWBA 1L68A 1LJFA 2A7DA 125LA 171LA 1DKKA 3W6DA 3C7ZA 2BQFA 1JJ0A 201LA 4H9IA 5DN4A 3DNAA 1DI4A 1L59A 1LKSA 2B7XA 4H9CA 4H9EA 138LA 4B1AA 4AXTA 4LYMA 132LA 1XEKA 1TAYA 1SX2A 1KS3A 1L62A 4YXAC 2A4TA 4NHIA 133LA 2BQBA 1JTNA 1HFYA 4OWHA 1TBYA 3A3RX 4GCFA 3HDEA 4UWVA 4W54A 1LZ6A 2NWDX 3LYTA 1LJNA 1L37A 1P2RA 1SX7A 250LA 1P37A 1LYZA 5I4YA 3B0OA 214LA 3FADA 1SWZA 5F9XA 1BWHA 1L77A 1LSYA 1D6PA 5KXSA 3GXRA 3A34A 2I6ZA 1B5WA 4PJ2C 4D9ZA 2I25L 1LPIA 1QT6A 4GCEA 169LA 222LA 2RBRA 1L30A 4B4EA 4LT0A 1L88A 3A8ZA 1CV0A 2EPEA 4MCKA 164LA 3SB6A 4K5YA 2MECA 2W1LA 1HENA 1L65A 123LA 4W51A 3HBEX 119LA 1NKHA 3M18B 2BQEA 4ET8A 5B07A 235LA 4PGJB 4BS7A 3GUOA 5C6JA 2B6XA 127LA 1LWKA 155LA 2BQMA 1OVJA 1L13A 1L41A 1OUFA 1GB0A 1L66A 1L0JA 3FE0A 1QDTA 3EO5A 1SLYA 1YAOA 3FI7A 4LT3A 1D9WA 262LA 5APCA 4DAJA 4G4BA 4NHTA 3HTFA 1L31A 1LZ1A 2YVBA 5F9UA 1LHHA 1C62A 3HFMY 1C6DA 1KY0A 4PPOA 4H1PA 2RBSA 1C67A 3G3BB 4YF2A 1QSBA 1QSAA 104LA 1KIRC 3AW6A 4XJIA 1GF8A 2F30A 2H9KA 1REXA 188LA 3A6BY 113LA 3NY9A 3ULRA 4RLNA 4NGLA 3B6LA 3GUIA 3CDQA 2YSSC 3F9LA 3QY4A 1UIHA 3AZ5A 3WPKA 1LYYA 3F6ZA 4DD2A 5C6LA 3A3QA 4ETAA 1J1PY 1BQLY 2PC2A 1IR7A 2QB0B 173LA 1T6VL 4I7PA 1LGUA 3EMSA 3HUAA 1GFJA 7LZMA 1IP5A 4LYBA 1IC5Y 1FLWA 3HT8A 2HEAA 3P66A 228LA 1G0QA 2X0AA 3K3TA 4IATA 1FKVA 1F10A 1HEMA 1GEZA 4EKRA 2B6WA 1PQMA 1RE2A 1GB3A 2DKVA 1YQVY 3EMLA 4ARJA 1L15A 2CWIA 3C8QA 1L14A 243LA 3WUMA 3OK0A 2YBJA 1GPQC 4YENA 2ZYCA 1DI5A 3AB6A 3B0KA 1B7PA 1T6HA 1L93A 144LA 1LJKA 1W6ZA 3GULA 5IELA 252LA 3V2YA 3AJNA 1OUCA 4WOAA 1B9OA 1LJHA 4RDSA 3WW6A 1GWDA 1LZRA 4NIJA 1IOQA 1G7LC 1TEWA 1WQRA 4WG7A 5LINA 3RZ4A 3E3DA 1JSFA 1L48A 1WVUA 2ZQ3A 219LA 4HV1A 2BQOA 1LLHA 1FLYA 3DMVA 2HULA 1IO5A 1GB6A 1LSMA 1UIBA 4LYTA 1ALCA 1HERA 4W53A 1CJ6A 1UIEA 1GFHA 4ZPUA 1L16A 1LSFA 1QQYA 237LA 3A90A 3GUKA 3G3AB 2Z38A 3BKHA 4J1AA 1GBSA 1L33A 4I7SA 4NGYA 1DKJA 3G3XA 1QTKA 2W1MA 3W6EA 1L58A 163LA 2LC9A 1L71A 1D3FA 205LA 3GUPA 2ANXA 1L50A 4WL7A 253LA 2Q9EA 1G0GA 1XEJA 3CDVA 4ML7A 103LA 4ZIXA 1YAMA 1JJ3A 3WH1A 1C6BA 1B0DA 1L07A 1CKCA 1B2KA 192LA 3SB5A 4G49A 194LA 3W3EA 1YKZX 1LMAA 3A96A 3N9EA 5KKJA 1L54A 2HTXA 5LVJA 151LA 1LYGA 1HHLA 1CUPA 1ZWNA 4CGEA 5F16A 4RW2A 1YL0X 3DKEX 1CKDA 8LYZA 5E9RA 1K28A 193LA 1L75A 2RH1A 1IC7Y 1IWZA 1VDSA 4GCDA 4H91A 3A6CY 4EXMA 4G9SA 211LA 1FBIX 1OWZA 115LA 4DDAA 2F2NA 3ZVQA 1LJEA 3FI5A 2RB1X 4XADA 1LZYA 3HH4A 254LA 110LA 4EPIA 1QUOA 4NY5A 3B72A 2MEIA 4WO9A 1UICA 3QNGA 1C64A 1WQPA 3ZEKA 4A7DA 1L26A 1IWYA 1DYDA 1GF7A 1F6RA 4H94A 5IDDA 259LA 2D4JA 4II8A 5DLAA 4WLYA 3BKVA 1LYSA 4W55A 4O34A 4G4HA 4H9AA 1C7PA 4DDBA 3DMZA 4LZMA 5HNLA 3DMXA 4ZFPA 3OE8A 3LHMA 1B5UA 3B0IA 1IWWA 216LA 3EXDA 2DQGY 4NG1A 1LZ8A 2LCBA 3L2XA 3DN1A 3HTGA 2FYCA 1BVKC 1BHZA 1LZGA 1L42A 5HMJA 2D91A 9LYZA 4H90A 4HP0A 1WQOA 3RW8A 3LYOA 208LA 3FA0A 1ZVYB 4I0CA 2B74A 2RBPA 4YEOA 5FELA 1B7NA 1D3NA 1LI3A 4ARMA 4NSGA 1JITA 1GXXA 1LZCA 5B05A 111LA 2BLYA 3WUNA 3CB7A 1UBZA 2FBDA 1L92A 240LA 1G07A 4ZEEA 4I7JA 3HTBA 1OUGA 1L44A 1LYEA 3ATOA 3QAKA 3F8VA 1A2YC 6LYTA 1C66A 4NWEA 1JEFA 4WO6A 198LA 1L04A 2BQAA 147LA 109LA 3LZMA 4HJZA 215LA 3WU9A 4WLXA 2B6ZA 3VW7A 4W56A 1AKIA 4GLVA 4BADA 2B73A 2OTZX 3HT7A 5KXXA 1OVHA 2HECA 4B4IA 140LA 2CGIA 1T3PA 4WM6A 1FLQA
chains in the Genus database with same CATH topology
5KXWA 1D9UA 4PK0A 1LMQA 4NSHA 3CSZA 5D5FA 1REZA 5T3FA 1PQIA 1G0PA 2F4GA 4LGKA 3P68A 2W1YA 5APDA 1XGQC 1DXJA 231LA 3OE0A 1QT5A 4OWBA 227LA 2EIZC 1H6MA 1T8AA 128LA 2LHMA 224LA 2DQCY 3VWOA 4J7VA 1BWJA 4ETBA 4BAFA 4W94A 2GV0A 3AZ6A 251LA 1CU6A 4QEQA 1L84A 5B59A 4YX7C 3RNXA 1IORA 2ANVA 1IY3A 1OQMA 4WLTA 1HFZA 1BB4A 2OTYX 2VB1A 1C6CA 1LGXA 1INUA 4I7MA 1IP6A 1V7SA 4LYCA 1PQJA 1QUDA 239LA 1QTHA 1WQQA 3T36A 145LA 1L38A 1VDQA 4KPMA 1IP7A 1L91A 2EQLA 5F14A 1SQ2L 4NFVA 118LA 3TMWA 4R0FA 1V7TA 1OUBA 167LA 2DQAA 1LZ4A 1DZBX 4B4JA 1P5CA 2HUMA 1LSZA 5KY1A 5LAGA 4DQ7A 5L3HA 4XJBA 1RFPA 2BQHA 1HNLA 2B70A 5KXYA 5APFA 1PS5A 5KXZA 1L46A 3IWRA 1C6PA 5K7OA 102LA 1FN5A 1L08A 258LA 1CV4A 1H87A 2D4IA 5DL9A 1A4VA 1B7QA 4ANRA 4HTNA 4LDLA 249LA 4DQJA 1BB5A 1DI3A 1EPYA 1C6AA 4WM1A 4YM8A 1L83A 212LA 1IP3A 1CKFA 4I8SA 1L17A 1L85A 1OWYA 5KXMA 226LA 5L9JA 4HJVA 1L74A 5C6IA 5I14A 6LZMA 170LA 3J4GA 5LVIA 3WVXA 5E4PA 1J1OY 1GFTA 1KXWA 190LA 1QTVA 2Q0MX 1L99A 210LA 4OW1A 5HQ1A 4CFOA 1QT4A 1C6FA 2IHLA 1C08C 1O23A 3DN0A 4TSCA 3OE9A 4PHIA 126LA 1LZBA 1OUEA 5KXNA 4H93A 1LYOA 1I1ZA 1NF5A 3WU8A 1KY1A 3TXJA 1ZVHL 1L05A 1DYEA 1G7JC 1L10A 1L01A 1L51A 2Z12A 2D4KA 3A92A 141LA 1DQJC 1LYJA 3LZTA 3DN6A 2FBBA 4KXIA 4XJFA 1G0MA 2HU1A 3G3VA 5KKIA 4H8YA 4LYOA 187LA 1P2LA 2OE7X 4B0DA 1L40A 2ZNXY 2CUUA 248LA 3C7YA 1IR8A 2ZIJA 4Z41A 172LA 130LA 5LIOA 1G06A 3TXIA 3DN4A 1GB8A 1ZYTA 1GBXA 2HU3A 4RLMA 5I4XA 152LA 1LHMA 1C69A 1JHLA 230LA 2F32A 1XGRC 3UONA 4ET9A 1BVXA 4YEMA 1WVVA 3TMXA 1HEWA 1L95A 150LA 1AT5A 3JR6A 5D5CA 1F6SA 1GF0A 4CHXA 1B5XA 1GB7A 5KJ9A 2YBHA 3LYMA 4I7OA 3C8RA 1QT8A 2BQGA 3M3UA 1IIZA 1QSWA 1ZV5L 1HEOA 1L27A 1RCMA 2AUBA 1L24A 4LDEA 3WU7A 2BQJA 5LVGA 1CVKA 1D2WA 1CUQA 2RAZX 3C81A 1TDYA 4QDNA 3RZEA 1KXXA 1KXYA 1B7LA 5LXWA 3CDOA 2C8OA 4TWSA 2HEEA 5I53A 1LHIA 3PDSA 2RAYX 1WQNA 4TSBA 1WTNA 156LA 1L69A 112LA 4WG1A 4NG8A 4I7RA 1L55A 3CDRA 3IJVA 4IAPA 183LA 1CU3A 1LJ4A 1GBOA 2FYDA 2MEFA 4WM2A 2NTHA 4QGZA 1L36A 1QUSA 3AYQA 2RB0X 1SSYA 5LYZA 1NHBA 1P36A 1LJJA 1L82A 1B7MA 2DQHY 4HTKA 1UIDA 1LWGA 1GE2A 3GUMA 168LA 1G0KA 1BB6A 199LA 1LSCA 1UIGA 1GXV2 4HV2A 5KXPA 1L80A 1YROA 2HEBA 177LA 1LI2A 1L0KA 2BAAA 5LAFA 1B5VA 3W6CA 1BB7A 1L32A 2B5ZA 2IFFY 4NGOA 4LYZA 1C45A 3CSRA 3D3DA 3WL2A 3TMVA 1E8LA 1WQMA 3GXKA 4KL7A 5I5QA 5LYTA 1UIFA 186LA 4B49A 5L3IA 1DPXA 131LA 1LTMA 1GF3A 1L20A 1G7HC 2BLXA 5B1GA 1VFBC 185LA 1LHLA 3QE8A 1GDXA 120LA 2XTHA 4H9FA 3T6UA 1L90A 1D3JA 2W1XA 3C82A 2OU9A 1LYFA 1DYFA 108LA 1LSPA 1QTEA 4NGKA 1CV5A 225LA 135LA 2MEGA 2MEEA 4EOFA 3K2RA 1C6LA 1GFGA 4M4OA 4N0JA 1OVKA 232LA 1L57A 7LYZA 3J6KA 2XQOA 3OJPA 181LA 5B1FA 1L45A 5HMVA 1QUHA 4FJRA 1L25A 3GUNA 4I7QA 4WLDA 2HEDA 2OU8A 3C80A 4EPFA 4U3XB 2G4NA 4EJ4A 1JKDA 4NSIA 4OOOA 2HUBA 4DJHA 5IHGA 1GB2A 1JTMA 4N9RA 2H5ZA 1IY4A 4NGJA 1L56A 1L09A 3WPLA 5I4WA 3A67Y 4NHSA 189LA 4W58A 1HC0A 3C7WA 2DBTA 5LVKA 1JWRA 200LA 4PRQA 6LYZA 1L52A 4WM3A 1D0MA 114LA 1KIQC 4LDOA 2ZNWY 3RU5A 1L35A 4IASA 4NGZA 1OUAA 4NWHA 1FDLY 5KXTA 3N9CA 166LA 1LCNA 3HH3A 1I20A 1HFXA 3TXDA 4W52A 209LA 1XEPA 1OUDA 1GHLA 162LA 1LKRA 4GN5C 4QY9A 5KXRA 1C10A 4W96A 3AGHA 149LA 1KNIA 1RJCB 1QTCA 1L86A 3HTDA 1MELL 4XJDA 1BGIA 2F2QA 1IP2A 3D4SA 1JISA 153LA 1C6EA 3SBBC 3TMUA 1B5ZA 1TCYA 1GEVA 2C8PA 1EQEA 2LZTA 3HH5A 229LA 1OYUA 157LA 3ODUA 3LYZA 4OOTA 1NDMC 1QS9A 2XBRA 4X3BA 159LA 1BB3A 1D0KA 1OUJA 4I7NA 3AZ7A 4Z3MA 4E3UA 1GFAA 4OWEA 242LA 1N4FA 2YBMA 1G0JA 3A93A 3AGGG 5A3ZA 4Z46A 4N1EI 1B7OA 1L03A 2LYMA 2CJLA 4WM5A 1WTMA 1LSBA 3CQLA 1L97A 3TXGA 3A94A 4NSJA 3D9AC 2YDGA 4DD9A 5KXOA 5II3A 1GFRA 1T97A 255LA 1YANA 3NY8A 1RI8B 3LZ2A 4PRUA 3W6AA 4EMNA 1AM7A 2Z18A 1XGTC 1LYIA 4KT3A 241LA 1L89A 5LZMA 1G7IC 2XBSA 2XJWA 196LA 165LA 2MEBA 1C65A 2ZYPA 4W57A 174LA 3TXFA 1JQUA 1NHEA 4TX7A 137LA 1XGUC 1L02A 1NQIA 1GAYA 5F81A 2O79A 2DQJY 217LA 4H9BA 1HMLA 1HSWA 1QIOA 1L22A 1DYAA 1YKXX 1IWXA 1LMNA 1LZTA 3RT5X 1GB5A 1LAAA 3WULA 3TXEA 4LT2A 3W6BA 5J7CA 1VDPA 4WL6A 180LA 1LMTA 1LZNA 2YBIA 1GF9A 2YBNA 1QTBA 158LA 207LA 3DN3A 1HEPA 1XJUA 2HUKA 2F4AA 1CTWA 1L23A 4GN3A 107LA 218LA 1L81A 1C6GA 1EQ4A 1JKAA 1IWUA 4DD0A 1C46A 1LZEA 4H92A 1B5YA 1GE4A 1CU5A 1MLCE 4UWNA 1GAZA 1IWTA 2BQIA 3PBLA 3CSQA 1EQ5A 3A91A 3TXBA 4ARLA 1UACY 1C6NA 1GB9A 1HF4A 1CU2A 3HU8A 1LSNA 1AT6A 2B6YA 3AGIA 4GN4A 4XENA 1CJ9A 4C3WA 1P46A 3HT6A 3HU9A 1LZAA 2QARC 4DD7A 4I7TA 4HPIA 3WPJA 3HWLA 221LA 1LYHA 2DQEY 1PQKA 3ATNA 2Y8PA 4PJZA 1XEIA 1GF4A 4WM4A 3DN8A 4I7LA 2NTGA 3TXHA 1LJ3A 1L79A 2BQCA 1NBZC 257LA 2LYOA 3CT0A 1LMPA 3NYAA 1LI6A 1PQOA 3C83A 4HPEA 2DQDY 1FLUA 1JTPL 1P2CC 1L28A 5AMYA 143LA 3SB9A 5M1YA 2Z39A 4DKLA 1QUTA 247LA 260LA 5DM9A 1C6IA 1GE3A 2Q9DA 1P56A 4J0LA 1LW9A 1C6TA 4NHPA 3WXTA 3CDTA 3V2WA 1CJ7A 1LJIA 2RB2X 233LA 4C5FA 4UWUA 4DC4A 2O4WA 4MR1A 4OWAA 1YILA 2OEAX 1LJGA 1UIAA 1DYGA 1OV7A 1C61A 1LZ5A 154LA 1QS5A 1IOTA 1LMCA 1PQDA 1FKQA 1GE0A 1LZDA 1D2YA 246LA 5FCPA 4N8ZA 1VAUA 139LA 1F0WA 1L87A 4M6DA 1CV3A 1JKBA 1B6IA 1XGPC 5I54A 146LA 1C43A 1C6QA 1EL1A 2I26L 2OE9X 1OV5A 1L06A 2A7FA 1LHKA 4DWXA 1JTTL 1C68A 4ARQB 1NDGC 3P64A 1CV1A 4GCBA 1LSGA 2RBNA 261LA 4Z98A 1L61A 3HT9A 1QT3A 2MEAA 1AZFA 2B6TA 3LN2A 3HBDA 3C8SA 161LA 1GF5A 1IX0A 1VEDA 2G4PA 2ZILA 5B06A 2F47A 3HH6A 1C60A 3RUNA 1OP9B 2LZ2A 4P2EA 1L18A 1DYCA 1LSAA 1YKYX 1C6HA 1OUIA 182LA 1UA6Y 2O7AA 1YL1X 4WMGA 3WYHA 1IOCA 4GRVA 1HELA 3CT5A 1LMOA 1ZURA 4DYGA 1L70A 1P7SA 1IVMA 5HNCA 1UUZC 1GBWA 1CNSA 3ZVQB 178LA 4TUNA 4DD1A 4HJYA 5DN5A 2DQIY 2HEFA 1I56A 2B75A 5LYMA 1GBYA 3DN2A 1GD6A 1JSEA 3AZ4A 1REYA 4LFPA 2MEHA 4ETEA 1J1XY 4RW1A 223LA 1L60A 1KW7A 1T8FA 1P64A 1JJ1A 4XN6A 4DD3A 5ILCA 1LSDA 1L49A 1ZMYL 1XJTA 4MSTA 2BQLA 3HUQA 4LZTA 3SB8A 2Z6BA 1KIPC 4IJ4A 4ARQA 1B7RA 2ZIKA 213LA 2Z19A 3IJUA 4H8XA 4LFXA 4W59A 1IP1A 5ILFA 4DDCA 5HLLA 3W6FA 1JKCA 1P3NA 5FSTA 1HEQA 1L73A 1IOSA 3KAMA 1NMMA 4DQ5A 1JPOA 3EBAB 1LOZA 1L21A 1CJ8A 4YXCA 4G4CA 3GUJA 1HMKA 4GLAA 1XFPL 2RBOA 4ARMB 5A3EA 1GFUA 4ETCA 1CU0A 2RBQA 4GBRB 4CJ2A 1L39A 148LE 1GFEA 4TTDA 5JENB 3SBAA 2RSCA 1HSXA 2D6BA 2OU0X 2WARA 4EKPA 2BPUA 1L12A 1UCOA 1C6MA 4S0WA 3SN6R 2CDSA 244LA 3P4ZA 4L41A 5KXKA 4XJHA 1CX6A 2N5ZA 4ARPA 197LA 4GCCA 3TXKA 3WUAA 2IGCA 2EKSC 1IR9A 1C6KA 2BQKA 3G3WA 1GF6A 4OO9A 4H9HA 1G0LA 3A95A 1QTDA 245LA 4OWCA 2DQFC 1L47A 1JIYA 1GBZA 2YBLA 1L67A 1B7SA 1G1WA 256LA 2L78A 1IEEA 5FEKA 195LA 184LA 1WTHA 4EKSA 1IC4Y 3WXUA 3N9AA 1L53A 176LA 1L76A 1NBYC 1JUGA 1CV6A 4NGWA 1DPWA 2B72A 3OE6A 236LA 3SB7A 1GFVA 4E97A 3P65A 4R6CA 220LA 2MEDA 160LA 1LGWA 1GE1A 4XYYA 3WW5A 191LA 1W08A 1L00A 4AQNA 5FHWA 1IP4A 4XJGA 2Z37A 1L43A 1TLAA 3L64A 1JTOL 2BQDA 1LSEA 1OUHA 1Z55A 2Z2FA 5APEA 4HTQA 1L63A 1LYDA 5KXLA 1IWVA 2BQNA 3HDFA 142LA 1L29A 1QSQA 3AW7A 4LT1A 4DT3A 1DYBA 5FDJA 129LA 1UC0A 5EBHA 1C63A 1C6JA 1D0LA 2ZQ4A 2LZMA 4NHQA 4NGVA 1I6SA 5LA8A 3SP3A 4YOPA 1NWGA 1QUGA 3WVYA 2LYZA 1QDRA 1QTZA 175LA 3HUKA 206LA 1D6QA 1L94A 4CFPA 4I7KA 2Z2EA 1YAQA 134LA 1L64A 1LZSA 238LA 4NEBA 1L19A 1LPYA 4J1BA 4NGIA 1PZYA 1D3MA 1L96A 1KW5A 1YAPA 1L11A 1VATA 4AGAA 4ETDA 234LA 1GDWA 4FDYA 2H9JA 1CKGA 1VDTA 3WMKA 5LVHA 1REMA 1SWYA 4N5RA 1G1VA 1P6YA 4BAPA 1QT7A 1CKHA 4EKQA 3MGWA 1BWIA 1LZ9A 3HBHA 1G7MC 1L72A 1T8GA 1L34A 1LHJA 3CT1A 1L98A 2G4QA 1XSFA 1CX7A 4H8ZA 122LA 1YIKA 4HSFA 1SSWA 4N1CC 1GFKA 2OE4X 5LA5A 2ZWBA 1L68A 1LJFA 2A7DA 125LA 171LA 1DKKA 3W6DA 3C7ZA 2BQFA 1JJ0A 201LA 4H9IA 5DN4A 3DNAA 1DI4A 1L59A 1LKSA 2B7XA 4H9CA 4H9EA 138LA 4B1AA 4AXTA 4LYMA 132LA 1XEKA 1TAYA 1SX2A 1KS3A 1L62A 4YXAC 2A4TA 4NHIA 133LA 2BQBA 1JTNA 1HFYA 4OWHA 1TBYA 3A3RX 4GCFA 3HDEA 4UWVA 4W54A 1LZ6A 2NWDX 3LYTA 1LJNA 1L37A 1P2RA 1SX7A 250LA 1P37A 1LYZA 5I4YA 3B0OA 214LA 3FADA 1SWZA 5F9XA 1BWHA 1L77A 1LSYA 1D6PA 5KXSA 3GXRA 3A34A 2I6ZA 1B5WA 4PJ2C 4D9ZA 2I25L 1LPIA 1QT6A 4GCEA 169LA 222LA 2RBRA 1L30A 4B4EA 4LT0A 1L88A 3A8ZA 1CV0A 2EPEA 4MCKA 164LA 3SB6A 4K5YA 2MECA 2W1LA 1HENA 1L65A 123LA 4W51A 3HBEX 119LA 1NKHA 3M18B 2BQEA 4ET8A 5B07A 235LA 4PGJB 4BS7A 3GUOA 5C6JA 2B6XA 127LA 1LWKA 155LA 2BQMA 1OVJA 1L13A 1L41A 1OUFA 1GB0A 1L66A 1L0JA 3FE0A 1QDTA 3EO5A 1SLYA 1YAOA 3FI7A 4LT3A 1D9WA 262LA 5APCA 4DAJA 4G4BA 4NHTA 3HTFA 1L31A 1LZ1A 2YVBA 5F9UA 1LHHA 1C62A 3HFMY 1C6DA 1KY0A 4PPOA 4H1PA 2RBSA 1C67A 3G3BB 4YF2A 1QSBA 1QSAA 104LA 1KIRC 3AW6A 4XJIA 1GF8A 2F30A 2H9KA 1REXA 188LA 3A6BY 113LA 3NY9A 3ULRA 4RLNA 4NGLA 3B6LA 3GUIA 3CDQA 2YSSC 3F9LA 3QY4A 1UIHA 3AZ5A 3WPKA 1LYYA 3F6ZA 4DD2A 5C6LA 3A3QA 4ETAA 1J1PY 1BQLY 2PC2A 1IR7A 2QB0B 173LA 1T6VL 4I7PA 1LGUA 3EMSA 3HUAA 1GFJA 7LZMA 1IP5A 4LYBA 1IC5Y 1FLWA 3HT8A 2HEAA 3P66A 228LA 1G0QA 2X0AA 3K3TA 4IATA 1FKVA 1F10A 1HEMA 1GEZA 4EKRA 2B6WA 1PQMA 1RE2A 1GB3A 2DKVA 1YQVY 3EMLA 4ARJA 1L15A 2CWIA 3C8QA 1L14A 243LA 3WUMA 3OK0A 2YBJA 1GPQC 4YENA 2ZYCA 1DI5A 3AB6A 3B0KA 1B7PA 1T6HA 1L93A 144LA 1LJKA 1W6ZA 3GULA 5IELA 252LA 3V2YA 3AJNA 1OUCA 4WOAA 1B9OA 1LJHA 4RDSA 3WW6A 1GWDA 1LZRA 4NIJA 1IOQA 1G7LC 1TEWA 1WQRA 4WG7A 5LINA 3RZ4A 3E3DA 1JSFA 1L48A 1WVUA 2ZQ3A 219LA 4HV1A 2BQOA 1LLHA 1FLYA 3DMVA 2HULA 1IO5A 1GB6A 1LSMA 1UIBA 4LYTA 1ALCA 1HERA 4W53A 1CJ6A 1UIEA 1GFHA 4ZPUA 1L16A 1LSFA 1QQYA 237LA 3A90A 3GUKA 3G3AB 2Z38A 3BKHA 4J1AA 1GBSA 1L33A 4I7SA 4NGYA 1DKJA 3G3XA 1QTKA 2W1MA 3W6EA 1L58A 163LA 2LC9A 1L71A 1D3FA 205LA 3GUPA 2ANXA 1L50A 4WL7A 253LA 2Q9EA 1G0GA 1XEJA 3CDVA 4ML7A 103LA 4ZIXA 1YAMA 1JJ3A 3WH1A 1C6BA 1B0DA 1L07A 1CKCA 1B2KA 192LA 3SB5A 4G49A 194LA 3W3EA 1YKZX 1LMAA 3A96A 3N9EA 5KKJA 1L54A 2HTXA 5LVJA 151LA 1LYGA 1HHLA 1CUPA 1ZWNA 4CGEA 5F16A 4RW2A 1YL0X 3DKEX 1CKDA 8LYZA 5E9RA 1K28A 193LA 1L75A 2RH1A 1IC7Y 1IWZA 1VDSA 4GCDA 4H91A 3A6CY 4EXMA 4G9SA 211LA 1FBIX 1OWZA 115LA 4DDAA 2F2NA 3ZVQA 1LJEA 3FI5A 2RB1X 4XADA 1LZYA 3HH4A 254LA 110LA 4EPIA 1QUOA 4NY5A 3B72A 2MEIA 4WO9A 1UICA 3QNGA 1C64A 1WQPA 3ZEKA 4A7DA 1L26A 1IWYA 1DYDA 1GF7A 1F6RA 4H94A 5IDDA 259LA 2D4JA 4II8A 5DLAA 4WLYA 3BKVA 1LYSA 4W55A 4O34A 4G4HA 4H9AA 1C7PA 4DDBA 3DMZA 4LZMA 5HNLA 3DMXA 4ZFPA 3OE8A 3LHMA 1B5UA 3B0IA 1IWWA 216LA 3EXDA 2DQGY 4NG1A 1LZ8A 2LCBA 3L2XA 3DN1A 3HTGA 2FYCA 1BVKC 1BHZA 1LZGA 1L42A 5HMJA 2D91A 9LYZA 4H90A 4HP0A 1WQOA 3RW8A 3LYOA 208LA 3FA0A 1ZVYB 4I0CA 2B74A 2RBPA 4YEOA 5FELA 1B7NA 1D3NA 1LI3A 4ARMA 4NSGA 1JITA 1GXXA 1LZCA 5B05A 111LA 2BLYA 3WUNA 3CB7A 1UBZA 2FBDA 1L92A 240LA 1G07A 4ZEEA 4I7JA 3HTBA 1OUGA 1L44A 1LYEA 3ATOA 3QAKA 3F8VA 1A2YC 6LYTA 1C66A 4NWEA 1JEFA 4WO6A 198LA 1L04A 2BQAA 147LA 109LA 3LZMA 4HJZA 215LA 3WU9A 4WLXA 2B6ZA 3VW7A 4W56A 1AKIA 4GLVA 4BADA 2B73A 2OTZX 3HT7A 5KXXA 1OVHA 2HECA 4B4IA 140LA 2CGIA 1T3PA 4WM6A 1FLQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZUR A;  1L66 A;  1L0J A;  181L A;  1L70 A;  1P7S A;  1L45 A;  4PK0 A;  1QUH A;  1D9W A;  1L25 A;  3GUN A;  4I7Q A;  2OU8 A;  3C80 A;  262L A;  4EPF A;  178L A;  4DAJ A;  4EJ4 A;  1PQI A;  3HTF A;  1L31 A;  1G0P A;  1C62 A;  4DJH A;  1JTM A;  2B75 A;  231L A;  3OE0 A;  1QT5 A;  1C6D A;  1L56 A;  1KY0 A;  1L09 A;  2RBS A;  3DN2 A;  1C67 A;  1QSB A;  104L A;  227L A;  189L A;  4W58 A;  3C7W A;  1T8A A;  128L A;  224L A;  200L A;  188L A;  113L A;  3NY9 A;  223L A;  1L60 A;  1KW7 A;  1T8F A;  1P64 A;  1L52 A;  251L A;  1CU6 A;  3GUI A;  114L A;  3CDQ A;  1L84 A;  4LDO A;  3F9L A;  4YX7 C;  1L49 A;  1L35 A;  1XJT A;  3HUQ A;  2ANV A;  3SB8 A;  2Z6B A;  166L A;  3HH3 A;  4ARQ A;  2OTY X;  4W52 A;  1C6C A;  1LGX A;  209L A;  173L A;  2QB0 B;  4I7P A;  1XEP A;  4I7M A;  213L A;  1LGU A;  3HUA A;  162L A;  1PQJ A;  7LZM A;  1QUD A;  4W59 A;  239L A;  1QTH A;  149L A;  1KNI A;  145L A;  3HT8 A;  1QTC A;  1L86 A;  1L38 A;  228L A;  1P3N A;  1G0Q A;  3HTD A;  1L73 A;  2F2Q A;  3D4S A;  1L91 A;  4EKR A;  1C6E A;  2B6W A;  1L21 A;  1PQM A;  4YXC A;  118L A;  3GUJ A;  3SBB C;  3EML A;  4ARJ A;  1L15 A;  167L A;  2RBO A;  4ARM B;  3C8Q A;  1L14 A;  1P5C A;  243L A;  2HUM A;  1CU0 A;  2RBQ A;  4GBR B;  3HH5 A;  229L A;  1L39 A;  148L E;  157L A;  1OYU A;  3ODU A;  3SBA A;  2B70 A;  1QS9 A;  2OU0 X;  1T6H A;  159L A;  1L93 A;  4EKP A;  1L46 A;  1L12 A;  1C6P A;  144L A;  4I7N A;  1C6M A;  4S0W A;  3GUL A;  102L A;  1L08 A;  252L A;  258L A;  3SN6 R;  242L A;  3V2Y A;  1CV4 A;  1G0J A;  244L A;  1CX6 A;  4ARP A;  4LDL A;  1L03 A;  197L A;  249L A;  1EPY A;  1C6A A;  1L97 A;  1L48 A;  2IGC A;  1L83 A;  212L A;  1L17 A;  1C6K A;  1L85 A;  1OWY A;  226L A;  1L74 A;  219L A;  3G3W A;  5I14 A;  1T97 A;  4OO9 A;  170L A;  6LZM A;  255L A;  1LLH A;  1G0L A;  3NY8 A;  3DMV A;  1QTD A;  245L A;  2HUL A;  190L A;  1QTV A;  1L99 A;  210L A;  4W53 A;  1L47 A;  1LYI A;  1L67 A;  1C6F A;  1QT4 A;  4ZPU A;  1G1W A;  1L16 A;  241L A;  1L89 A;  256L A;  237L A;  2L78 A;  5LZM A;  3GUK A;  195L A;  184L A;  1WTH A;  3DN0 A;  4EKS A;  3OE9 A;  126L A;  196L A;  165L A;  1L53 A;  176L A;  1C65 A;  1L76 A;  1L33 A;  4I7S A;  4W57 A;  1CV6 A;  174L A;  1JQU A;  2B72 A;  3G3X A;  3OE6 A;  236L A;  1KY1 A;  3SB7 A;  137L A;  4E97 A;  1L02 A;  1L05 A;  1DYE A;  1L10 A;  2O79 A;  1L01 A;  1L51 A;  217L A;  220L A;  160L A;  1LGW A;  141L A;  191L A;  1LYJ A;  1L58 A;  1L22 A;  3DN6 A;  1L00 A;  4AQN A;  1DYA A;  163L A;  2LC9 A;  1L71 A;  1D3F A;  1L43 A;  1G0M A;  205L A;  1TLA A;  2ANX A;  3GUP A;  1L50 A;  3L64 A;  253L A;  2Q9E A;  1G0G A;  3CDV A;  103L A;  3G3V A;  1LYD A;  1L63 A;  1C6B A;  180L A;  1L07 A;  3HDF A;  142L A;  187L A;  1L29 A;  1QSQ A;  1QTB A;  158L A;  192L A;  1P2L A;  3SB5 A;  2OE7 X;  3DN3 A;  1L40 A;  1XJU A;  2HUK A;  1CTW A;  1DYB A;  248L A;  2CUU A;  1L23 A;  3C7Y A;  107L A;  129L A;  218L A;  1L81 A;  1C6G A;  1L54 A;  172L A;  1C63 A;  151L A;  1C6J A;  2LZM A;  1LYG A;  130L A;  1I6S A;  1CUP A;  1G06 A;  1ZWN A;  3DN4 A;  1ZYT A;  1QUG A;  1CU5 A;  3DKE X;  152L A;  1QTZ A;  175L A;  3HUK A;  206L A;  1C69 A;  1L94 A;  3PBL A;  1K28 A;  230L A;  2F32 A;  4I7K A;  1L75 A;  1L64 A;  3UON A;  2RH1 A;  4ARL A;  1C6N A;  4EXM A;  1CU2 A;  3HU8 A;  1L95 A;  238L A;  2B6Y A;  211L A;  1L19 A;  1LPY A;  150L A;  3JR6 A;  1OWZ A;  1P46 A;  3HT6 A;  3HU9 A;  115L A;  2QAR C;  1D3M A;  1L96 A;  3FI5 A;  2RB1 X;  1KW5 A;  4I7T A;  3HH4 A;  4I7O A;  3C8R A;  1L11 A;  1QT8 A;  3HWL A;  221L A;  254L A;  110L A;  1LYH A;  1QUO A;  234L A;  1PQK A;  4EPI A;  4PJZ A;  1SWY A;  1L27 A;  3DN8 A;  1G1V A;  1P6Y A;  1C64 A;  2NTG A;  1L24 A;  1QT7 A;  4I7L A;  4LDE A;  4EKQ A;  1L26 A;  1DYD A;  1L79 A;  1CVK A;  1D2W A;  257L A;  1CUQ A;  1L72 A;  2RAZ X;  1T8G A;  1L34 A;  3NYA A;  259L A;  3C81 A;  3RZE A;  1LI6 A;  1L98 A;  1PQO A;  3C83 A;  3CDO A;  1CX7 A;  122L A;  4W55 A;  1SSW A;  1L28 A;  2OE4 X;  143L A;  3SB9 A;  1L68 A;  3PDS A;  2RAY X;  4DKL A;  247L A;  3DMZ A;  260L A;  125L A;  1C6I A;  156L A;  1L69 A;  1P56 A;  112L A;  2Q9D A;  3DMX A;  4LZM A;  171L A;  3OE8 A;  1LW9 A;  1C6T A;  3C7Z A;  4I7R A;  1L55 A;  201L A;  3CDR A;  3CDT A;  3V2W A;  4IAP A;  2RB2 X;  233L A;  183L A;  1CU3 A;  216L A;  3DNA A;  2LCB A;  2NTH A;  1L59 A;  3L2X A;  3DN1 A;  2B7X A;  1L36 A;  3HTG A;  2O4W A;  2RB0 X;  1SSY A;  2OEA X;  1NHB A;  138L A;  1L42 A;  1P36 A;  1DYG A;  1L82 A;  1OV7 A;  1C61 A;  1QS5 A;  1LWG A;  1PQD A;  3GUM A;  1SX2 A;  1KS3 A;  3FA0 A;  1D2Y A;  168L A;  1G0K A;  1L62 A;  246L A;  4YXA C;  2A4T A;  2B74 A;  2RBP A;  199L A;  1JTN A;  139L A;  1L87 A;  1CV3 A;  1D3N A;  1B6I A;  1L80 A;  1LI3 A;  4ARM A;  146L A;  1C6Q A;  3HDE A;  4W54 A;  177L A;  2OE9 X;  111L A;  1L37 A;  1OV5 A;  1L06 A;  1P2R A;  1SX7 A;  1LI2 A;  250L A;  1L92 A;  1L0K A;  1C68 A;  1P37 A;  240L A;  1G07 A;  4ARQ B;  4I7J A;  3HTB A;  214L A;  1L32 A;  3FAD A;  1SWZ A;  1CV1 A;  2RBN A;  1L77 A;  261L A;  1L44 A;  1L61 A;  1LYE A;  3HT9 A;  1QT3 A;  3QAK A;  3F8V A;  2B6T A;  1C66 A;  186L A;  3C8S A;  161L A;  131L A;  2F47 A;  1L20 A;  1QT6 A;  3HH6 A;  169L A;  1C60 A;  185L A;  1L04 A;  222L A;  3RUN A;  198L A;  2RBR A;  147L A;  1L30 A;  120L A;  109L A;  1L18 A;  1L88 A;  3LZM A;  1DYC A;  1CV0 A;  215L A;  2B6Z A;  3VW7 A;  1L90 A;  164L A;  4W56 A;  1D3J A;  3SB6 A;  3C82 A;  4K5Y A;  2OU9 A;  1LYF A;  1L65 A;  123L A;  108L A;  1DYF A;  4W51 A;  119L A;  1C6H A;  182L A;  1CV5 A;  2O7A A;  225L A;  2B73 A;  2OTZ X;  3HT7 A;  235L A;  1OVH A;  3GUO A;  2B6X A;  127L A;  4GRV A;  140L A;  1LWK A;  3K2R A;  1C6L A;  155L A;  1OVJ A;  1OVK A;  232L A;  1L57 A;  1L13 A;  1L41 A; 
#chains in the Genus database with same CATH topology
 5KXW A;  1D9U A;  4PK0 A;  1LMQ A;  4NSH A;  3CSZ A;  5D5F A;  1REZ A;  5T3F A;  1PQI A;  1G0P A;  2F4G A;  4LGK A;  3P68 A;  2W1Y A;  5APD A;  1XGQ C;  1DXJ A;  231L A;  3OE0 A;  1QT5 A;  4OWB A;  227L A;  2EIZ C;  1H6M A;  1T8A A;  128L A;  2LHM A;  224L A;  2DQC Y;  3VWO A;  4J7V A;  1BWJ A;  4ETB A;  4BAF A;  4W94 A;  2GV0 A;  3AZ6 A;  251L A;  1CU6 A;  4QEQ A;  1L84 A;  5B59 A;  4YX7 C;  3RNX A;  1IOR A;  2ANV A;  1IY3 A;  1OQM A;  4WLT A;  1HFZ A;  1BB4 A;  2OTY X;  2VB1 A;  1C6C A;  1LGX A;  1INU A;  4I7M A;  1IP6 A;  1V7S A;  4LYC A;  1PQJ A;  1QUD A;  239L A;  1QTH A;  1WQQ A;  3T36 A;  145L A;  1L38 A;  1VDQ A;  4KPM A;  1IP7 A;  1L91 A;  2EQL A;  5F14 A;  1SQ2 L;  4NFV A;  118L A;  3TMW A;  4R0F A;  1V7T A;  1OUB A;  167L A;  2DQA A;  1LZ4 A;  1DZB X;  4B4J A;  1P5C A;  2HUM A;  1LSZ A;  5KY1 A;  5LAG A;  4DQ7 A;  5L3H A;  4XJB A;  1RFP A;  2BQH A;  1HNL A;  2B70 A;  5KXY A;  5APF A;  1PS5 A;  5KXZ A;  1L46 A;  3IWR A;  1C6P A;  5K7O A;  102L A;  1FN5 A;  1L08 A;  258L A;  1CV4 A;  1H87 A;  2D4I A;  5DL9 A;  1A4V A;  1B7Q A;  4ANR A;  4HTN A;  4LDL A;  249L A;  4DQJ A;  1BB5 A;  1DI3 A;  1EPY A;  1C6A A;  4WM1 A;  4YM8 A;  1L83 A;  212L A;  1IP3 A;  1CKF A;  4I8S A;  1L17 A;  1L85 A;  1OWY A;  5KXM A;  226L A;  5L9J A;  4HJV A;  1L74 A;  5C6I A;  5I14 A;  6LZM A;  170L A;  3J4G A;  5LVI A;  3WVX A;  5E4P A;  1J1O Y;  1GFT A;  1KXW A;  190L A;  1QTV A;  2Q0M X;  1L99 A;  210L A;  4OW1 A;  5HQ1 A;  4CFO A;  1QT4 A;  1C6F A;  2IHL A;  1C08 C;  1O23 A;  3DN0 A;  4TSC A;  3OE9 A;  4PHI A;  126L A;  1LZB A;  1OUE A;  5KXN A;  4H93 A;  1LYO A;  1I1Z A;  1NF5 A;  3WU8 A;  1KY1 A;  3TXJ A;  1ZVH L;  1L05 A;  1DYE A;  1G7J C;  1L10 A;  1L01 A;  1L51 A;  2Z12 A;  2D4K A;  3A92 A;  141L A;  1DQJ C;  1LYJ A;  3LZT A;  3DN6 A;  2FBB A;  4KXI A;  4XJF A;  1G0M A;  2HU1 A;  3G3V A;  5KKI A;  4H8Y A;  4LYO A;  187L A;  1P2L A;  2OE7 X;  4B0D A;  1L40 A;  2ZNX Y;  2CUU A;  248L A;  3C7Y A;  1IR8 A;  2ZIJ A;  4Z41 A;  172L A;  130L A;  5LIO A;  1G06 A;  3TXI A;  3DN4 A;  1GB8 A;  1ZYT A;  1GBX A;  2HU3 A;  4RLM A;  5I4X A;  152L A;  1LHM A;  1C69 A;  1JHL A;  230L A;  2F32 A;  1XGR C;  3UON A;  4ET9 A;  1BVX A;  4YEM A;  1WVV A;  3TMX A;  1HEW A;  1L95 A;  150L A;  1AT5 A;  3JR6 A;  5D5C A;  1F6S A;  1GF0 A;  4CHX A;  1B5X A;  1GB7 A;  5KJ9 A;  2YBH A;  3LYM A;  4I7O A;  3C8R A;  1QT8 A;  2BQG A;  3M3U A;  1IIZ A;  1QSW A;  1ZV5 L;  1HEO A;  1L27 A;  1RCM A;  2AUB A;  1L24 A;  4LDE A;  3WU7 A;  2BQJ A;  5LVG A;  1CVK A;  1D2W A;  1CUQ A;  2RAZ X;  3C81 A;  1TDY A;  4QDN A;  3RZE A;  1KXX A;  1KXY A;  1B7L A;  5LXW A;  3CDO A;  2C8O A;  4TWS A;  2HEE A;  5I53 A;  1LHI A;  3PDS A;  2RAY X;  1WQN A;  4TSB A;  1WTN A;  156L A;  1L69 A;  112L A;  4WG1 A;  4NG8 A;  4I7R A;  1L55 A;  3CDR A;  3IJV A;  4IAP A;  183L A;  1CU3 A;  1LJ4 A;  1GBO A;  2FYD A;  2MEF A;  4WM2 A;  2NTH A;  4QGZ A;  1L36 A;  1QUS A;  3AYQ A;  2RB0 X;  1SSY A;  5LYZ A;  1NHB A;  1P36 A;  1LJJ A;  1L82 A;  1B7M A;  2DQH Y;  4HTK A;  1UID A;  1LWG A;  1GE2 A;  3GUM A;  168L A;  1G0K A;  1BB6 A;  199L A;  1LSC A;  1UIG A;  1GXV 2;  4HV2 A;  5KXP A;  1L80 A;  1YRO A;  2HEB A;  177L A;  1LI2 A;  1L0K A;  2BAA A;  5LAF A;  1B5V A;  3W6C A;  1BB7 A;  1L32 A;  2B5Z A;  2IFF Y;  4NGO A;  4LYZ A;  1C45 A;  3CSR A;  3D3D A;  3WL2 A;  3TMV A;  1E8L A;  1WQM A;  3GXK A;  4KL7 A;  5I5Q A;  5LYT A;  1UIF A;  186L A;  4B49 A;  5L3I A;  1DPX A;  131L A;  1LTM A;  1GF3 A;  1L20 A;  1G7H C;  2BLX A;  5B1G A;  1VFB C;  185L A;  1LHL A;  3QE8 A;  1GDX A;  120L A;  2XTH A;  4H9F A;  3T6U A;  1L90 A;  1D3J A;  2W1X A;  3C82 A;  2OU9 A;  1LYF A;  1DYF A;  108L A;  1LSP A;  1QTE A;  4NGK A;  1CV5 A;  225L A;  135L A;  2MEG A;  2MEE A;  4EOF A;  3K2R A;  1C6L A;  1GFG A;  4M4O A;  4N0J A;  1OVK A;  232L A;  1L57 A;  7LYZ A;  3J6K A;  2XQO A;  3OJP A;  181L A;  5B1F A;  1L45 A;  5HMV A;  1QUH A;  4FJR A;  1L25 A;  3GUN A;  4I7Q A;  4WLD A;  2HED A;  2OU8 A;  3C80 A;  4EPF A;  4U3X B;  2G4N A;  4EJ4 A;  1JKD A;  4NSI A;  4OOO A;  2HUB A;  4DJH A;  5IHG A;  1GB2 A;  1JTM A;  4N9R A;  2H5Z A;  1IY4 A;  4NGJ A;  1L56 A;  1L09 A;  3WPL A;  5I4W A;  3A67 Y;  4NHS A;  189L A;  4W58 A;  1HC0 A;  3C7W A;  2DBT A;  5LVK A;  1JWR A;  200L A;  4PRQ A;  6LYZ A;  1L52 A;  4WM3 A;  1D0M A;  114L A;  1KIQ C;  4LDO A;  2ZNW Y;  3RU5 A;  1L35 A;  4IAS A;  4NGZ A;  1OUA A;  4NWH A;  1FDL Y;  5KXT A;  3N9C A;  166L A;  1LCN A;  3HH3 A;  1I20 A;  1HFX A;  3TXD A;  4W52 A;  209L A;  1XEP A;  1OUD A;  1GHL A;  162L A;  1LKR A;  4GN5 C;  4QY9 A;  5KXR A;  1C10 A;  4W96 A;  3AGH A;  149L A;  1KNI A;  1RJC B;  1QTC A;  1L86 A;  3HTD A;  1MEL L;  4XJD A;  1BGI A;  2F2Q A;  1IP2 A;  3D4S A;  1JIS A;  153L A;  1C6E A;  3SBB C;  3TMU A;  1B5Z A;  1TCY A;  1GEV A;  2C8P A;  1EQE A;  2LZT A;  3HH5 A;  229L A;  1OYU A;  157L A;  3ODU A;  3LYZ A;  4OOT A;  1NDM C;  1QS9 A;  2XBR A;  4X3B A;  159L A;  1BB3 A;  1D0K A;  1OUJ A;  4I7N A;  3AZ7 A;  4Z3M A;  4E3U A;  1GFA A;  4OWE A;  242L A;  1N4F A;  2YBM A;  1G0J A;  3A93 A;  3AGG G;  5A3Z A;  4Z46 A;  4N1E I;  1B7O A;  1L03 A;  2LYM A;  2CJL A;  4WM5 A;  1WTM A;  1LSB A;  3CQL A;  1L97 A;  3TXG A;  3A94 A;  4NSJ A;  3D9A C;  2YDG A;  4DD9 A;  5KXO A;  5II3 A;  1GFR A;  1T97 A;  255L A;  1YAN A;  3NY8 A;  1RI8 B;  3LZ2 A;  4PRU A;  3W6A A;  4EMN A;  1AM7 A;  2Z18 A;  1XGT C;  1LYI A;  4KT3 A;  241L A;  1L89 A;  5LZM A;  1G7I C;  2XBS A;  2XJW A;  196L A;  165L A;  2MEB A;  1C65 A;  2ZYP A;  4W57 A;  174L A;  3TXF A;  1JQU A;  1NHE A;  4TX7 A;  137L A;  1XGU C;  1L02 A;  1NQI A;  1GAY A;  5F81 A;  2O79 A;  2DQJ Y;  217L A;  4H9B A;  1HML A;  1HSW A;  1QIO A;  1L22 A;  1DYA A;  1YKX X;  1IWX A;  1LMN A;  1LZT A;  3RT5 X;  1GB5 A;  1LAA A;  3WUL A;  3TXE A;  4LT2 A;  3W6B A;  5J7C A;  1VDP A;  4WL6 A;  180L A;  1LMT A;  1LZN A;  2YBI A;  1GF9 A;  2YBN A;  1QTB A;  158L A;  207L A;  3DN3 A;  1HEP A;  1XJU A;  2HUK A;  2F4A A;  1CTW A;  1L23 A;  4GN3 A;  107L A;  218L A;  1L81 A;  1C6G A;  1EQ4 A;  1JKA A;  1IWU A;  4DD0 A;  1C46 A;  1LZE A;  4H92 A;  1B5Y A;  1GE4 A;  1CU5 A;  1MLC E;  4UWN A;  1GAZ A;  1IWT A;  2BQI A;  3PBL A;  3CSQ A;  1EQ5 A;  3A91 A;  3TXB A;  4ARL A;  1UAC Y;  1C6N A;  1GB9 A;  1HF4 A;  1CU2 A;  3HU8 A;  1LSN A;  1AT6 A;  2B6Y A;  3AGI A;  4GN4 A;  4XEN A;  1CJ9 A;  4C3W A;  1P46 A;  3HT6 A;  3HU9 A;  1LZA A;  2QAR C;  4DD7 A;  4I7T A;  4HPI A;  3WPJ A;  3HWL A;  221L A;  1LYH A;  2DQE Y;  1PQK A;  3ATN A;  2Y8P A;  4PJZ A;  1XEI A;  1GF4 A;  4WM4 A;  3DN8 A;  4I7L A;  2NTG A;  3TXH A;  1LJ3 A;  1L79 A;  2BQC A;  1NBZ C;  257L A;  2LYO A;  3CT0 A;  1LMP A;  3NYA A;  1LI6 A;  1PQO A;  3C83 A;  4HPE A;  2DQD Y;  1FLU A;  1JTP L;  1P2C C;  1L28 A;  5AMY A;  143L A;  3SB9 A;  5M1Y A;  2Z39 A;  4DKL A;  1QUT A;  247L A;  260L A;  5DM9 A;  1C6I A;  1GE3 A;  2Q9D A;  1P56 A;  4J0L A;  1LW9 A;  1C6T A;  4NHP A;  3WXT A;  3CDT A;  3V2W A;  1CJ7 A;  1LJI A;  2RB2 X;  233L A;  4C5F A;  4UWU A;  4DC4 A;  2O4W A;  4MR1 A;  4OWA A;  1YIL A;  2OEA X;  1LJG A;  1UIA A;  1DYG A;  1OV7 A;  1C61 A;  1LZ5 A;  154L A;  1QS5 A;  1IOT A;  1LMC A;  1PQD A;  1FKQ A;  1GE0 A;  1LZD A;  1D2Y A;  246L A;  5FCP A;  4N8Z A;  1VAU A;  139L A;  1F0W A;  1L87 A;  4M6D A;  1CV3 A;  1JKB A;  1B6I A;  1XGP C;  5I54 A;  146L A;  1C43 A;  1C6Q A;  1EL1 A;  2I26 L;  2OE9 X;  1OV5 A;  1L06 A;  2A7F A;  1LHK A;  4DWX A;  1JTT L;  1C68 A;  4ARQ B;  1NDG C;  3P64 A;  1CV1 A;  4GCB A;  1LSG A;  2RBN A;  261L A;  4Z98 A;  1L61 A;  3HT9 A;  1QT3 A;  2MEA A;  1AZF A;  2B6T A;  3LN2 A;  3HBD A;  3C8S A;  161L A;  1GF5 A;  1IX0 A;  1VED A;  2G4P A;  2ZIL A;  5B06 A;  2F47 A;  3HH6 A;  1C60 A;  3RUN A;  1OP9 B;  2LZ2 A;  4P2E A;  1L18 A;  1DYC A;  1LSA A;  1YKY X;  1C6H A;  1OUI A;  182L A;  1UA6 Y;  2O7A A;  1YL1 X;  4WMG A;  3WYH A;  1IOC A;  4GRV A;  1HEL A;  3CT5 A;  1LMO A;  1ZUR A;  4DYG A;  1L70 A;  1P7S A;  1IVM A;  5HNC A;  1UUZ C;  1GBW A;  1CNS A;  3ZVQ B;  178L A;  4TUN A;  4DD1 A;  4HJY A;  5DN5 A;  2DQI Y;  2HEF A;  1I56 A;  2B75 A;  5LYM A;  1GBY A;  3DN2 A;  1GD6 A;  1JSE A;  3AZ4 A;  1REY A;  4LFP A;  2MEH A;  4ETE A;  1J1X Y;  4RW1 A;  223L A;  1L60 A;  1KW7 A;  1T8F A;  1P64 A;  1JJ1 A;  4XN6 A;  4DD3 A;  5ILC A;  1LSD A;  1L49 A;  1ZMY L;  1XJT A;  4MST A;  2BQL A;  3HUQ A;  4LZT A;  3SB8 A;  2Z6B A;  1KIP C;  4IJ4 A;  4ARQ A;  1B7R A;  2ZIK A;  213L A;  2Z19 A;  3IJU A;  4H8X A;  4LFX A;  4W59 A;  1IP1 A;  5ILF A;  4DDC A;  5HLL A;  3W6F A;  1JKC A;  1P3N A;  5FST A;  1HEQ A;  1L73 A;  1IOS A;  3KAM A;  1NMM A;  4DQ5 A;  1JPO A;  3EBA B;  1LOZ A;  1L21 A;  1CJ8 A;  4YXC A;  4G4C A;  3GUJ A;  1HMK A;  4GLA A;  1XFP L;  2RBO A;  4ARM B;  5A3E A;  1GFU A;  4ETC A;  1CU0 A;  2RBQ A;  4GBR B;  4CJ2 A;  1L39 A;  148L E;  1GFE A;  4TTD A;  5JEN B;  3SBA A;  2RSC A;  1HSX A;  2D6B A;  2OU0 X;  2WAR A;  4EKP A;  2BPU A;  1L12 A;  1UCO A;  1C6M A;  4S0W A;  3SN6 R;  2CDS A;  244L A;  3P4Z A;  4L41 A;  5KXK A;  4XJH A;  1CX6 A;  2N5Z A;  4ARP A;  197L A;  4GCC A;  3TXK A;  3WUA A;  2IGC A;  2EKS C;  1IR9 A;  1C6K A;  2BQK A;  3G3W A;  1GF6 A;  4OO9 A;  4H9H A;  1G0L A;  3A95 A;  1QTD A;  245L A;  4OWC A;  2DQF C;  1L47 A;  1JIY A;  1GBZ A;  2YBL A;  1L67 A;  1B7S A;  1G1W A;  256L A;  2L78 A;  1IEE A;  5FEK A;  195L A;  184L A;  1WTH A;  4EKS A;  1IC4 Y;  3WXU A;  3N9A A;  1L53 A;  176L A;  1L76 A;  1NBY C;  1JUG A;  1CV6 A;  4NGW A;  1DPW A;  2B72 A;  3OE6 A;  236L A;  3SB7 A;  1GFV A;  4E97 A;  3P65 A;  4R6C A;  220L A;  2MED A;  160L A;  1LGW A;  1GE1 A;  4XYY A;  3WW5 A;  191L A;  1W08 A;  1L00 A;  4AQN A;  5FHW A;  1IP4 A;  4XJG A;  2Z37 A;  1L43 A;  1TLA A;  3L64 A;  1JTO L;  2BQD A;  1LSE A;  1OUH A;  1Z55 A;  2Z2F A;  5APE A;  4HTQ A;  1L63 A;  1LYD A;  5KXL A;  1IWV A;  2BQN A;  3HDF A;  142L A;  1L29 A;  1QSQ A;  3AW7 A;  4LT1 A;  4DT3 A;  1DYB A;  5FDJ A;  129L A;  1UC0 A;  5EBH A;  1C63 A;  1C6J A;  1D0L A;  2ZQ4 A;  2LZM A;  4NHQ A;  4NGV A;  1I6S A;  5LA8 A;  3SP3 A;  4YOP A;  1NWG A;  1QUG A;  3WVY A;  2LYZ A;  1QDR A;  1QTZ A;  175L A;  3HUK A;  206L A;  1D6Q A;  1L94 A;  4CFP A;  4I7K A;  2Z2E A;  1YAQ A;  134L A;  1L64 A;  1LZS A;  238L A;  4NEB A;  1L19 A;  1LPY A;  4J1B A;  4NGI A;  1PZY A;  1D3M A;  1L96 A;  1KW5 A;  1YAP A;  1L11 A;  1VAT A;  4AGA A;  4ETD A;  234L A;  1GDW A;  4FDY A;  2H9J A;  1CKG A;  1VDT A;  3WMK A;  5LVH A;  1REM A;  1SWY A;  4N5R A;  1G1V A;  1P6Y A;  4BAP A;  1QT7 A;  1CKH A;  4EKQ A;  3MGW A;  1BWI A;  1LZ9 A;  3HBH A;  1G7M C;  1L72 A;  1T8G A;  1L34 A;  1LHJ A;  3CT1 A;  1L98 A;  2G4Q A;  1XSF A;  1CX7 A;  4H8Z A;  122L A;  1YIK A;  4HSF A;  1SSW A;  4N1C C;  1GFK A;  2OE4 X;  5LA5 A;  2ZWB A;  1L68 A;  1LJF A;  2A7D A;  125L A;  171L A;  1DKK A;  3W6D A;  3C7Z A;  2BQF A;  1JJ0 A;  201L A;  4H9I A;  5DN4 A;  3DNA A;  1DI4 A;  1L59 A;  1LKS A;  2B7X A;  4H9C A;  4H9E A;  138L A;  4B1A A;  4AXT A;  4LYM A;  132L A;  1XEK A;  1TAY A;  1SX2 A;  1KS3 A;  1L62 A;  4YXA C;  2A4T A;  4NHI A;  133L A;  2BQB A;  1JTN A;  1HFY A;  4OWH A;  1TBY A;  3A3R X;  4GCF A;  3HDE A;  4UWV A;  4W54 A;  1LZ6 A;  2NWD X;  3LYT A;  1LJN A;  1L37 A;  1P2R A;  1SX7 A;  250L A;  1P37 A;  1LYZ A;  5I4Y A;  3B0O A;  214L A;  3FAD A;  1SWZ A;  5F9X A;  1BWH A;  1L77 A;  1LSY A;  1D6P A;  5KXS A;  3GXR A;  3A34 A;  2I6Z A;  1B5W A;  4PJ2 C;  4D9Z A;  2I25 L;  1LPI A;  1QT6 A;  4GCE A;  169L A;  222L A;  2RBR A;  1L30 A;  4B4E A;  4LT0 A;  1L88 A;  3A8Z A;  1CV0 A;  2EPE A;  4MCK A;  164L A;  3SB6 A;  4K5Y A;  2MEC A;  2W1L A;  1HEN A;  1L65 A;  123L A;  4W51 A;  3HBE X;  119L A;  1NKH A;  3M18 B;  2BQE A;  4ET8 A;  5B07 A;  235L A;  4PGJ B;  4BS7 A;  3GUO A;  5C6J A;  2B6X A;  127L A;  1LWK A;  155L A;  2BQM A;  1OVJ A;  1L13 A;  1L41 A;  1OUF A;  1GB0 A;  1L66 A;  1L0J A;  3FE0 A;  1QDT A;  3EO5 A;  1SLY A;  1YAO A;  3FI7 A;  4LT3 A;  1D9W A;  262L A;  5APC A;  4DAJ A;  4G4B A;  4NHT A;  3HTF A;  1L31 A;  1LZ1 A;  2YVB A;  5F9U A;  1LHH A;  1C62 A;  3HFM Y;  1C6D A;  1KY0 A;  4PPO A;  4H1P A;  2RBS A;  1C67 A;  3G3B B;  4YF2 A;  1QSB A;  1QSA A;  104L A;  1KIR C;  3AW6 A;  4XJI A;  1GF8 A;  2F30 A;  2H9K A;  1REX A;  188L A;  3A6B Y;  113L A;  3NY9 A;  3ULR A;  4RLN A;  4NGL A;  3B6L A;  3GUI A;  3CDQ A;  2YSS C;  3F9L A;  3QY4 A;  1UIH A;  3AZ5 A;  3WPK A;  1LYY A;  3F6Z A;  4DD2 A;  5C6L A;  3A3Q A;  4ETA A;  1J1P Y;  1BQL Y;  2PC2 A;  1IR7 A;  2QB0 B;  173L A;  1T6V L;  4I7P A;  1LGU A;  3EMS A;  3HUA A;  1GFJ A;  7LZM A;  1IP5 A;  4LYB A;  1IC5 Y;  1FLW A;  3HT8 A;  2HEA A;  3P66 A;  228L A;  1G0Q A;  2X0A A;  3K3T A;  4IAT A;  1FKV A;  1F10 A;  1HEM A;  1GEZ A;  4EKR A;  2B6W A;  1PQM A;  1RE2 A;  1GB3 A;  2DKV A;  1YQV Y;  3EML A;  4ARJ A;  1L15 A;  2CWI A;  3C8Q A;  1L14 A;  243L A;  3WUM A;  3OK0 A;  2YBJ A;  1GPQ C;  4YEN A;  2ZYC A;  1DI5 A;  3AB6 A;  3B0K A;  1B7P A;  1T6H A;  1L93 A;  144L A;  1LJK A;  1W6Z A;  3GUL A;  5IEL A;  252L A;  3V2Y A;  3AJN A;  1OUC A;  4WOA A;  1B9O A;  1LJH A;  4RDS A;  3WW6 A;  1GWD A;  1LZR A;  4NIJ A;  1IOQ A;  1G7L C;  1TEW A;  1WQR A;  4WG7 A;  5LIN A;  3RZ4 A;  3E3D A;  1JSF A;  1L48 A;  1WVU A;  2ZQ3 A;  219L A;  4HV1 A;  2BQO A;  1LLH A;  1FLY A;  3DMV A;  2HUL A;  1IO5 A;  1GB6 A;  1LSM A;  1UIB A;  4LYT A;  1ALC A;  1HER A;  4W53 A;  1CJ6 A;  1UIE A;  1GFH A;  4ZPU A;  1L16 A;  1LSF A;  1QQY A;  237L A;  3A90 A;  3GUK A;  3G3A B;  2Z38 A;  3BKH A;  4J1A A;  1GBS A;  1L33 A;  4I7S A;  4NGY A;  1DKJ A;  3G3X A;  1QTK A;  2W1M A;  3W6E A;  1L58 A;  163L A;  2LC9 A;  1L71 A;  1D3F A;  205L A;  3GUP A;  2ANX A;  1L50 A;  4WL7 A;  253L A;  2Q9E A;  1G0G A;  1XEJ A;  3CDV A;  4ML7 A;  103L A;  4ZIX A;  1YAM A;  1JJ3 A;  3WH1 A;  1C6B A;  1B0D A;  1L07 A;  1CKC A;  1B2K A;  192L A;  3SB5 A;  4G49 A;  194L A;  3W3E A;  1YKZ X;  1LMA A;  3A96 A;  3N9E A;  5KKJ A;  1L54 A;  2HTX A;  5LVJ A;  151L A;  1LYG A;  1HHL A;  1CUP A;  1ZWN A;  4CGE A;  5F16 A;  4RW2 A;  1YL0 X;  3DKE X;  1CKD A;  8LYZ A;  5E9R A;  1K28 A;  193L A;  1L75 A;  2RH1 A;  1IC7 Y;  1IWZ A;  1VDS A;  4GCD A;  4H91 A;  3A6C Y;  4EXM A;  4G9S A;  211L A;  1FBI X;  1OWZ A;  115L A;  4DDA A;  2F2N A;  3ZVQ A;  1LJE A;  3FI5 A;  2RB1 X;  4XAD A;  1LZY A;  3HH4 A;  254L A;  110L A;  4EPI A;  1QUO A;  4NY5 A;  3B72 A;  2MEI A;  4WO9 A;  1UIC A;  3QNG A;  1C64 A;  1WQP A;  3ZEK A;  4A7D A;  1L26 A;  1IWY A;  1DYD A;  1GF7 A;  1F6R A;  4H94 A;  5IDD A;  259L A;  2D4J A;  4II8 A;  5DLA A;  4WLY A;  3BKV A;  1LYS A;  4W55 A;  4O34 A;  4G4H A;  4H9A A;  1C7P A;  4DDB A;  3DMZ A;  4LZM A;  5HNL A;  3DMX A;  4ZFP A;  3OE8 A;  3LHM A;  1B5U A;  3B0I A;  1IWW A;  216L A;  3EXD A;  2DQG Y;  4NG1 A;  1LZ8 A;  2LCB A;  3L2X A;  3DN1 A;  3HTG A;  2FYC A;  1BVK C;  1BHZ A;  1LZG A;  1L42 A;  5HMJ A;  2D91 A;  9LYZ A;  4H90 A;  4HP0 A;  1WQO A;  3RW8 A;  3LYO A;  208L A;  3FA0 A;  1ZVY B;  4I0C A;  2B74 A;  2RBP A;  4YEO A;  5FEL A;  1B7N A;  1D3N A;  1LI3 A;  4ARM A;  4NSG A;  1JIT A;  1GXX A;  1LZC A;  5B05 A;  111L A;  2BLY A;  3WUN A;  3CB7 A;  1UBZ A;  2FBD A;  1L92 A;  240L A;  1G07 A;  4ZEE A;  4I7J A;  3HTB A;  1OUG A;  1L44 A;  1LYE A;  3ATO A;  3QAK A;  3F8V A;  1A2Y C;  6LYT A;  1C66 A;  4NWE A;  1JEF A;  4WO6 A;  198L A;  1L04 A;  2BQA A;  147L A;  109L A;  3LZM A;  4HJZ A;  215L A;  3WU9 A;  4WLX A;  2B6Z A;  3VW7 A;  4W56 A;  1AKI A;  4GLV A;  4BAD A;  2B73 A;  2OTZ X;  3HT7 A;  5KXX A;  1OVH A;  2HEC A;  4B4I A;  140L A;  2CGI A;  1T3P A;  4WM6 A;  1FLQ A; 
#chains in the Genus database with same CATH homology
 5KXW A;  1D9U A;  4PK0 A;  1LMQ A;  4NSH A;  3CSZ A;  5D5F A;  1REZ A;  5T3F A;  1PQI A;  1G0P A;  2F4G A;  4LGK A;  3P68 A;  2W1Y A;  5APD A;  1XGQ C;  1DXJ A;  231L A;  3OE0 A;  1QT5 A;  4OWB A;  227L A;  2EIZ C;  1H6M A;  1T8A A;  128L A;  2LHM A;  224L A;  2DQC Y;  3VWO A;  4J7V A;  1BWJ A;  4ETB A;  4BAF A;  4W94 A;  2GV0 A;  3AZ6 A;  251L A;  1CU6 A;  4QEQ A;  1L84 A;  5B59 A;  4YX7 C;  3RNX A;  1IOR A;  2ANV A;  1IY3 A;  1OQM A;  4WLT A;  1HFZ A;  1BB4 A;  2OTY X;  2VB1 A;  1C6C A;  1LGX A;  1INU A;  4I7M A;  1IP6 A;  1V7S A;  4LYC A;  1PQJ A;  1QUD A;  239L A;  1QTH A;  1WQQ A;  3T36 A;  145L A;  1L38 A;  1VDQ A;  4KPM A;  1IP7 A;  1L91 A;  2EQL A;  5F14 A;  1SQ2 L;  4NFV A;  118L A;  3TMW A;  4R0F A;  1V7T A;  1OUB A;  167L A;  2DQA A;  1LZ4 A;  1DZB X;  4B4J A;  1P5C A;  2HUM A;  1LSZ A;  5KY1 A;  5LAG A;  4DQ7 A;  5L3H A;  4XJB A;  1RFP A;  2BQH A;  1HNL A;  2B70 A;  5KXY A;  5APF A;  1PS5 A;  5KXZ A;  1L46 A;  3IWR A;  1C6P A;  5K7O A;  102L A;  1FN5 A;  1L08 A;  258L A;  1CV4 A;  1H87 A;  2D4I A;  5DL9 A;  1A4V A;  1B7Q A;  4ANR A;  4HTN A;  4LDL A;  249L A;  4DQJ A;  1BB5 A;  1DI3 A;  1EPY A;  1C6A A;  4WM1 A;  4YM8 A;  1L83 A;  212L A;  1IP3 A;  1CKF A;  4I8S A;  1L17 A;  1L85 A;  1OWY A;  5KXM A;  226L A;  5L9J A;  4HJV A;  1L74 A;  5C6I A;  5I14 A;  6LZM A;  170L A;  3J4G A;  5LVI A;  3WVX A;  5E4P A;  1J1O Y;  1GFT A;  1KXW A;  190L A;  1QTV A;  2Q0M X;  1L99 A;  210L A;  4OW1 A;  5HQ1 A;  4CFO A;  1QT4 A;  1C6F A;  2IHL A;  1C08 C;  1O23 A;  3DN0 A;  4TSC A;  3OE9 A;  4PHI A;  126L A;  1LZB A;  1OUE A;  5KXN A;  4H93 A;  1LYO A;  1I1Z A;  1NF5 A;  3WU8 A;  1KY1 A;  3TXJ A;  1ZVH L;  1L05 A;  1DYE A;  1G7J C;  1L10 A;  1L01 A;  1L51 A;  2Z12 A;  2D4K A;  3A92 A;  141L A;  1DQJ C;  1LYJ A;  3LZT A;  3DN6 A;  2FBB A;  4KXI A;  4XJF A;  1G0M A;  2HU1 A;  3G3V A;  5KKI A;  4H8Y A;  4LYO A;  187L A;  1P2L A;  2OE7 X;  4B0D A;  1L40 A;  2ZNX Y;  2CUU A;  248L A;  3C7Y A;  1IR8 A;  2ZIJ A;  4Z41 A;  172L A;  130L A;  5LIO A;  1G06 A;  3TXI A;  3DN4 A;  1GB8 A;  1ZYT A;  1GBX A;  2HU3 A;  4RLM A;  5I4X A;  152L A;  1LHM A;  1C69 A;  1JHL A;  230L A;  2F32 A;  1XGR C;  3UON A;  4ET9 A;  1BVX A;  4YEM A;  1WVV A;  3TMX A;  1HEW A;  1L95 A;  150L A;  1AT5 A;  3JR6 A;  5D5C A;  1F6S A;  1GF0 A;  4CHX A;  1B5X A;  1GB7 A;  5KJ9 A;  2YBH A;  3LYM A;  4I7O A;  3C8R A;  1QT8 A;  2BQG A;  3M3U A;  1IIZ A;  1QSW A;  1ZV5 L;  1HEO A;  1L27 A;  1RCM A;  2AUB A;  1L24 A;  4LDE A;  3WU7 A;  2BQJ A;  5LVG A;  1CVK A;  1D2W A;  1CUQ A;  2RAZ X;  3C81 A;  1TDY A;  4QDN A;  3RZE A;  1KXX A;  1KXY A;  1B7L A;  5LXW A;  3CDO A;  2C8O A;  4TWS A;  2HEE A;  5I53 A;  1LHI A;  3PDS A;  2RAY X;  1WQN A;  4TSB A;  1WTN A;  156L A;  1L69 A;  112L A;  4WG1 A;  4NG8 A;  4I7R A;  1L55 A;  3CDR A;  3IJV A;  4IAP A;  183L A;  1CU3 A;  1LJ4 A;  1GBO A;  2FYD A;  2MEF A;  4WM2 A;  2NTH A;  4QGZ A;  1L36 A;  1QUS A;  3AYQ A;  2RB0 X;  1SSY A;  5LYZ A;  1NHB A;  1P36 A;  1LJJ A;  1L82 A;  1B7M A;  2DQH Y;  4HTK A;  1UID A;  1LWG A;  1GE2 A;  3GUM A;  168L A;  1G0K A;  1BB6 A;  199L A;  1LSC A;  1UIG A;  1GXV 2;  4HV2 A;  5KXP A;  1L80 A;  1YRO A;  2HEB A;  177L A;  1LI2 A;  1L0K A;  2BAA A;  5LAF A;  1B5V A;  3W6C A;  1BB7 A;  1L32 A;  2B5Z A;  2IFF Y;  4NGO A;  4LYZ A;  1C45 A;  3CSR A;  3D3D A;  3WL2 A;  3TMV A;  1E8L A;  1WQM A;  3GXK A;  4KL7 A;  5I5Q A;  5LYT A;  1UIF A;  186L A;  4B49 A;  5L3I A;  1DPX A;  131L A;  1LTM A;  1GF3 A;  1L20 A;  1G7H C;  2BLX A;  5B1G A;  1VFB C;  185L A;  1LHL A;  3QE8 A;  1GDX A;  120L A;  2XTH A;  4H9F A;  3T6U A;  1L90 A;  1D3J A;  2W1X A;  3C82 A;  2OU9 A;  1LYF A;  1DYF A;  108L A;  1LSP A;  1QTE A;  4NGK A;  1CV5 A;  225L A;  135L A;  2MEG A;  2MEE A;  4EOF A;  3K2R A;  1C6L A;  1GFG A;  4M4O A;  4N0J A;  1OVK A;  232L A;  1L57 A;  7LYZ A;  3J6K A;  2XQO A;  3OJP A;  181L A;  5B1F A;  1L45 A;  5HMV A;  1QUH A;  4FJR A;  1L25 A;  3GUN A;  4I7Q A;  4WLD A;  2HED A;  2OU8 A;  3C80 A;  4EPF A;  4U3X B;  2G4N A;  4EJ4 A;  1JKD A;  4NSI A;  4OOO A;  2HUB A;  4DJH A;  5IHG A;  1GB2 A;  1JTM A;  4N9R A;  2H5Z A;  1IY4 A;  4NGJ A;  1L56 A;  1L09 A;  3WPL A;  5I4W A;  3A67 Y;  4NHS A;  189L A;  4W58 A;  1HC0 A;  3C7W A;  2DBT A;  5LVK A;  1JWR A;  200L A;  4PRQ A;  6LYZ A;  1L52 A;  4WM3 A;  1D0M A;  114L A;  1KIQ C;  4LDO A;  2ZNW Y;  3RU5 A;  1L35 A;  4IAS A;  4NGZ A;  1OUA A;  4NWH A;  1FDL Y;  5KXT A;  3N9C A;  166L A;  1LCN A;  3HH3 A;  1I20 A;  1HFX A;  3TXD A;  4W52 A;  209L A;  1XEP A;  1OUD A;  1GHL A;  162L A;  1LKR A;  4GN5 C;  4QY9 A;  5KXR A;  1C10 A;  4W96 A;  3AGH A;  149L A;  1KNI A;  1RJC B;  1QTC A;  1L86 A;  3HTD A;  1MEL L;  4XJD A;  1BGI A;  2F2Q A;  1IP2 A;  3D4S A;  1JIS A;  153L A;  1C6E A;  3SBB C;  3TMU A;  1B5Z A;  1TCY A;  1GEV A;  2C8P A;  1EQE A;  2LZT A;  3HH5 A;  229L A;  1OYU A;  157L A;  3ODU A;  3LYZ A;  4OOT A;  1NDM C;  1QS9 A;  2XBR A;  4X3B A;  159L A;  1BB3 A;  1D0K A;  1OUJ A;  4I7N A;  3AZ7 A;  4Z3M A;  4E3U A;  1GFA A;  4OWE A;  242L A;  1N4F A;  2YBM A;  1G0J A;  3A93 A;  3AGG G;  5A3Z A;  4Z46 A;  4N1E I;  1B7O A;  1L03 A;  2LYM A;  2CJL A;  4WM5 A;  1WTM A;  1LSB A;  3CQL A;  1L97 A;  3TXG A;  3A94 A;  4NSJ A;  3D9A C;  2YDG A;  4DD9 A;  5KXO A;  5II3 A;  1GFR A;  1T97 A;  255L A;  1YAN A;  3NY8 A;  1RI8 B;  3LZ2 A;  4PRU A;  3W6A A;  4EMN A;  1AM7 A;  2Z18 A;  1XGT C;  1LYI A;  4KT3 A;  241L A;  1L89 A;  5LZM A;  1G7I C;  2XBS A;  2XJW A;  196L A;  165L A;  2MEB A;  1C65 A;  2ZYP A;  4W57 A;  174L A;  3TXF A;  1JQU A;  1NHE A;  4TX7 A;  137L A;  1XGU C;  1L02 A;  1NQI A;  1GAY A;  5F81 A;  2O79 A;  2DQJ Y;  217L A;  4H9B A;  1HML A;  1HSW A;  1QIO A;  1L22 A;  1DYA A;  1YKX X;  1IWX A;  1LMN A;  1LZT A;  3RT5 X;  1GB5 A;  1LAA A;  3WUL A;  3TXE A;  4LT2 A;  3W6B A;  5J7C A;  1VDP A;  4WL6 A;  180L A;  1LMT A;  1LZN A;  2YBI A;  1GF9 A;  2YBN A;  1QTB A;  158L A;  207L A;  3DN3 A;  1HEP A;  1XJU A;  2HUK A;  2F4A A;  1CTW A;  1L23 A;  4GN3 A;  107L A;  218L A;  1L81 A;  1C6G A;  1EQ4 A;  1JKA A;  1IWU A;  4DD0 A;  1C46 A;  1LZE A;  4H92 A;  1B5Y A;  1GE4 A;  1CU5 A;  1MLC E;  4UWN A;  1GAZ A;  1IWT A;  2BQI A;  3PBL A;  3CSQ A;  1EQ5 A;  3A91 A;  3TXB A;  4ARL A;  1UAC Y;  1C6N A;  1GB9 A;  1HF4 A;  1CU2 A;  3HU8 A;  1LSN A;  1AT6 A;  2B6Y A;  3AGI A;  4GN4 A;  4XEN A;  1CJ9 A;  4C3W A;  1P46 A;  3HT6 A;  3HU9 A;  1LZA A;  2QAR C;  4DD7 A;  4I7T A;  4HPI A;  3WPJ A;  3HWL A;  221L A;  1LYH A;  2DQE Y;  1PQK A;  3ATN A;  2Y8P A;  4PJZ A;  1XEI A;  1GF4 A;  4WM4 A;  3DN8 A;  4I7L A;  2NTG A;  3TXH A;  1LJ3 A;  1L79 A;  2BQC A;  1NBZ C;  257L A;  2LYO A;  3CT0 A;  1LMP A;  3NYA A;  1LI6 A;  1PQO A;  3C83 A;  4HPE A;  2DQD Y;  1FLU A;  1JTP L;  1P2C C;  1L28 A;  5AMY A;  143L A;  3SB9 A;  5M1Y A;  2Z39 A;  4DKL A;  1QUT A;  247L A;  260L A;  5DM9 A;  1C6I A;  1GE3 A;  2Q9D A;  1P56 A;  4J0L A;  1LW9 A;  1C6T A;  4NHP A;  3WXT A;  3CDT A;  3V2W A;  1CJ7 A;  1LJI A;  2RB2 X;  233L A;  4C5F A;  4UWU A;  4DC4 A;  2O4W A;  4MR1 A;  4OWA A;  1YIL A;  2OEA X;  1LJG A;  1UIA A;  1DYG A;  1OV7 A;  1C61 A;  1LZ5 A;  154L A;  1QS5 A;  1IOT A;  1LMC A;  1PQD A;  1FKQ A;  1GE0 A;  1LZD A;  1D2Y A;  246L A;  5FCP A;  4N8Z A;  1VAU A;  139L A;  1F0W A;  1L87 A;  4M6D A;  1CV3 A;  1JKB A;  1B6I A;  1XGP C;  5I54 A;  146L A;  1C43 A;  1C6Q A;  1EL1 A;  2I26 L;  2OE9 X;  1OV5 A;  1L06 A;  2A7F A;  1LHK A;  4DWX A;  1JTT L;  1C68 A;  4ARQ B;  1NDG C;  3P64 A;  1CV1 A;  4GCB A;  1LSG A;  2RBN A;  261L A;  4Z98 A;  1L61 A;  3HT9 A;  1QT3 A;  2MEA A;  1AZF A;  2B6T A;  3LN2 A;  3HBD A;  3C8S A;  161L A;  1GF5 A;  1IX0 A;  1VED A;  2G4P A;  2ZIL A;  5B06 A;  2F47 A;  3HH6 A;  1C60 A;  3RUN A;  1OP9 B;  2LZ2 A;  4P2E A;  1L18 A;  1DYC A;  1LSA A;  1YKY X;  1C6H A;  1OUI A;  182L A;  1UA6 Y;  2O7A A;  1YL1 X;  4WMG A;  3WYH A;  1IOC A;  4GRV A;  1HEL A;  3CT5 A;  1LMO A;  1ZUR A;  4DYG A;  1L70 A;  1P7S A;  1IVM A;  5HNC A;  1UUZ C;  1GBW A;  1CNS A;  3ZVQ B;  178L A;  4TUN A;  4DD1 A;  4HJY A;  5DN5 A;  2DQI Y;  2HEF A;  1I56 A;  2B75 A;  5LYM A;  1GBY A;  3DN2 A;  1GD6 A;  1JSE A;  3AZ4 A;  1REY A;  4LFP A;  2MEH A;  4ETE A;  1J1X Y;  4RW1 A;  223L A;  1L60 A;  1KW7 A;  1T8F A;  1P64 A;  1JJ1 A;  4XN6 A;  4DD3 A;  5ILC A;  1LSD A;  1L49 A;  1ZMY L;  1XJT A;  4MST A;  2BQL A;  3HUQ A;  4LZT A;  3SB8 A;  2Z6B A;  1KIP C;  4IJ4 A;  4ARQ A;  1B7R A;  2ZIK A;  213L A;  2Z19 A;  3IJU A;  4H8X A;  4LFX A;  4W59 A;  1IP1 A;  5ILF A;  4DDC A;  5HLL A;  3W6F A;  1JKC A;  1P3N A;  5FST A;  1HEQ A;  1L73 A;  1IOS A;  3KAM A;  1NMM A;  4DQ5 A;  1JPO A;  3EBA B;  1LOZ A;  1L21 A;  1CJ8 A;  4YXC A;  4G4C A;  3GUJ A;  1HMK A;  4GLA A;  1XFP L;  2RBO A;  4ARM B;  5A3E A;  1GFU A;  4ETC A;  1CU0 A;  2RBQ A;  4GBR B;  4CJ2 A;  1L39 A;  148L E;  1GFE A;  4TTD A;  5JEN B;  3SBA A;  2RSC A;  1HSX A;  2D6B A;  2OU0 X;  2WAR A;  4EKP A;  2BPU A;  1L12 A;  1UCO A;  1C6M A;  4S0W A;  3SN6 R;  2CDS A;  244L A;  3P4Z A;  4L41 A;  5KXK A;  4XJH A;  1CX6 A;  2N5Z A;  4ARP A;  197L A;  4GCC A;  3TXK A;  3WUA A;  2IGC A;  2EKS C;  1IR9 A;  1C6K A;  2BQK A;  3G3W A;  1GF6 A;  4OO9 A;  4H9H A;  1G0L A;  3A95 A;  1QTD A;  245L A;  4OWC A;  2DQF C;  1L47 A;  1JIY A;  1GBZ A;  2YBL A;  1L67 A;  1B7S A;  1G1W A;  256L A;  2L78 A;  1IEE A;  5FEK A;  195L A;  184L A;  1WTH A;  4EKS A;  1IC4 Y;  3WXU A;  3N9A A;  1L53 A;  176L A;  1L76 A;  1NBY C;  1JUG A;  1CV6 A;  4NGW A;  1DPW A;  2B72 A;  3OE6 A;  236L A;  3SB7 A;  1GFV A;  4E97 A;  3P65 A;  4R6C A;  220L A;  2MED A;  160L A;  1LGW A;  1GE1 A;  4XYY A;  3WW5 A;  191L A;  1W08 A;  1L00 A;  4AQN A;  5FHW A;  1IP4 A;  4XJG A;  2Z37 A;  1L43 A;  1TLA A;  3L64 A;  1JTO L;  2BQD A;  1LSE A;  1OUH A;  1Z55 A;  2Z2F A;  5APE A;  4HTQ A;  1L63 A;  1LYD A;  5KXL A;  1IWV A;  2BQN A;  3HDF A;  142L A;  1L29 A;  1QSQ A;  3AW7 A;  4LT1 A;  4DT3 A;  1DYB A;  5FDJ A;  129L A;  1UC0 A;  5EBH A;  1C63 A;  1C6J A;  1D0L A;  2ZQ4 A;  2LZM A;  4NHQ A;  4NGV A;  1I6S A;  5LA8 A;  3SP3 A;  4YOP A;  1NWG A;  1QUG A;  3WVY A;  2LYZ A;  1QDR A;  1QTZ A;  175L A;  3HUK A;  206L A;  1D6Q A;  1L94 A;  4CFP A;  4I7K A;  2Z2E A;  1YAQ A;  134L A;  1L64 A;  1LZS A;  238L A;  4NEB A;  1L19 A;  1LPY A;  4J1B A;  4NGI A;  1PZY A;  1D3M A;  1L96 A;  1KW5 A;  1YAP A;  1L11 A;  1VAT A;  4AGA A;  4ETD A;  234L A;  1GDW A;  4FDY A;  2H9J A;  1CKG A;  1VDT A;  3WMK A;  5LVH A;  1REM A;  1SWY A;  4N5R A;  1G1V A;  1P6Y A;  4BAP A;  1QT7 A;  1CKH A;  4EKQ A;  3MGW A;  1BWI A;  1LZ9 A;  3HBH A;  1G7M C;  1L72 A;  1T8G A;  1L34 A;  1LHJ A;  3CT1 A;  1L98 A;  2G4Q A;  1XSF A;  1CX7 A;  4H8Z A;  122L A;  1YIK A;  4HSF A;  1SSW A;  4N1C C;  1GFK A;  2OE4 X;  5LA5 A;  2ZWB A;  1L68 A;  1LJF A;  2A7D A;  125L A;  171L A;  1DKK A;  3W6D A;  3C7Z A;  2BQF A;  1JJ0 A;  201L A;  4H9I A;  5DN4 A;  3DNA A;  1DI4 A;  1L59 A;  1LKS A;  2B7X A;  4H9C A;  4H9E A;  138L A;  4B1A A;  4AXT A;  4LYM A;  132L A;  1XEK A;  1TAY A;  1SX2 A;  1KS3 A;  1L62 A;  4YXA C;  2A4T A;  4NHI A;  133L A;  2BQB A;  1JTN A;  1HFY A;  4OWH A;  1TBY A;  3A3R X;  4GCF A;  3HDE A;  4UWV A;  4W54 A;  1LZ6 A;  2NWD X;  3LYT A;  1LJN A;  1L37 A;  1P2R A;  1SX7 A;  250L A;  1P37 A;  1LYZ A;  5I4Y A;  3B0O A;  214L A;  3FAD A;  1SWZ A;  5F9X A;  1BWH A;  1L77 A;  1LSY A;  1D6P A;  5KXS A;  3GXR A;  3A34 A;  2I6Z A;  1B5W A;  4PJ2 C;  4D9Z A;  2I25 L;  1LPI A;  1QT6 A;  4GCE A;  169L A;  222L A;  2RBR A;  1L30 A;  4B4E A;  4LT0 A;  1L88 A;  3A8Z A;  1CV0 A;  2EPE A;  4MCK A;  164L A;  3SB6 A;  4K5Y A;  2MEC A;  2W1L A;  1HEN A;  1L65 A;  123L A;  4W51 A;  3HBE X;  119L A;  1NKH A;  3M18 B;  2BQE A;  4ET8 A;  5B07 A;  235L A;  4PGJ B;  4BS7 A;  3GUO A;  5C6J A;  2B6X A;  127L A;  1LWK A;  155L A;  2BQM A;  1OVJ A;  1L13 A;  1L41 A;  1OUF A;  1GB0 A;  1L66 A;  1L0J A;  3FE0 A;  1QDT A;  3EO5 A;  1SLY A;  1YAO A;  3FI7 A;  4LT3 A;  1D9W A;  262L A;  5APC A;  4DAJ A;  4G4B A;  4NHT A;  3HTF A;  1L31 A;  1LZ1 A;  2YVB A;  5F9U A;  1LHH A;  1C62 A;  3HFM Y;  1C6D A;  1KY0 A;  4PPO A;  4H1P A;  2RBS A;  1C67 A;  3G3B B;  4YF2 A;  1QSB A;  1QSA A;  104L A;  1KIR C;  3AW6 A;  4XJI A;  1GF8 A;  2F30 A;  2H9K A;  1REX A;  188L A;  3A6B Y;  113L A;  3NY9 A;  3ULR A;  4RLN A;  4NGL A;  3B6L A;  3GUI A;  3CDQ A;  2YSS C;  3F9L A;  3QY4 A;  1UIH A;  3AZ5 A;  3WPK A;  1LYY A;  3F6Z A;  4DD2 A;  5C6L A;  3A3Q A;  4ETA A;  1J1P Y;  1BQL Y;  2PC2 A;  1IR7 A;  2QB0 B;  173L A;  1T6V L;  4I7P A;  1LGU A;  3EMS A;  3HUA A;  1GFJ A;  7LZM A;  1IP5 A;  4LYB A;  1IC5 Y;  1FLW A;  3HT8 A;  2HEA A;  3P66 A;  228L A;  1G0Q A;  2X0A A;  3K3T A;  4IAT A;  1FKV A;  1F10 A;  1HEM A;  1GEZ A;  4EKR A;  2B6W A;  1PQM A;  1RE2 A;  1GB3 A;  2DKV A;  1YQV Y;  3EML A;  4ARJ A;  1L15 A;  2CWI A;  3C8Q A;  1L14 A;  243L A;  3WUM A;  3OK0 A;  2YBJ A;  1GPQ C;  4YEN A;  2ZYC A;  1DI5 A;  3AB6 A;  3B0K A;  1B7P A;  1T6H A;  1L93 A;  144L A;  1LJK A;  1W6Z A;  3GUL A;  5IEL A;  252L A;  3V2Y A;  3AJN A;  1OUC A;  4WOA A;  1B9O A;  1LJH A;  4RDS A;  3WW6 A;  1GWD A;  1LZR A;  4NIJ A;  1IOQ A;  1G7L C;  1TEW A;  1WQR A;  4WG7 A;  5LIN A;  3RZ4 A;  3E3D A;  1JSF A;  1L48 A;  1WVU A;  2ZQ3 A;  219L A;  4HV1 A;  2BQO A;  1LLH A;  1FLY A;  3DMV A;  2HUL A;  1IO5 A;  1GB6 A;  1LSM A;  1UIB A;  4LYT A;  1ALC A;  1HER A;  4W53 A;  1CJ6 A;  1UIE A;  1GFH A;  4ZPU A;  1L16 A;  1LSF A;  1QQY A;  237L A;  3A90 A;  3GUK A;  3G3A B;  2Z38 A;  3BKH A;  4J1A A;  1GBS A;  1L33 A;  4I7S A;  4NGY A;  1DKJ A;  3G3X A;  1QTK A;  2W1M A;  3W6E A;  1L58 A;  163L A;  2LC9 A;  1L71 A;  1D3F A;  205L A;  3GUP A;  2ANX A;  1L50 A;  4WL7 A;  253L A;  2Q9E A;  1G0G A;  1XEJ A;  3CDV A;  4ML7 A;  103L A;  4ZIX A;  1YAM A;  1JJ3 A;  3WH1 A;  1C6B A;  1B0D A;  1L07 A;  1CKC A;  1B2K A;  192L A;  3SB5 A;  4G49 A;  194L A;  3W3E A;  1YKZ X;  1LMA A;  3A96 A;  3N9E A;  5KKJ A;  1L54 A;  2HTX A;  5LVJ A;  151L A;  1LYG A;  1HHL A;  1CUP A;  1ZWN A;  4CGE A;  5F16 A;  4RW2 A;  1YL0 X;  3DKE X;  1CKD A;  8LYZ A;  5E9R A;  1K28 A;  193L A;  1L75 A;  2RH1 A;  1IC7 Y;  1IWZ A;  1VDS A;  4GCD A;  4H91 A;  3A6C Y;  4EXM A;  4G9S A;  211L A;  1FBI X;  1OWZ A;  115L A;  4DDA A;  2F2N A;  3ZVQ A;  1LJE A;  3FI5 A;  2RB1 X;  4XAD A;  1LZY A;  3HH4 A;  254L A;  110L A;  4EPI A;  1QUO A;  4NY5 A;  3B72 A;  2MEI A;  4WO9 A;  1UIC A;  3QNG A;  1C64 A;  1WQP A;  3ZEK A;  4A7D A;  1L26 A;  1IWY A;  1DYD A;  1GF7 A;  1F6R A;  4H94 A;  5IDD A;  259L A;  2D4J A;  4II8 A;  5DLA A;  4WLY A;  3BKV A;  1LYS A;  4W55 A;  4O34 A;  4G4H A;  4H9A A;  1C7P A;  4DDB A;  3DMZ A;  4LZM A;  5HNL A;  3DMX A;  4ZFP A;  3OE8 A;  3LHM A;  1B5U A;  3B0I A;  1IWW A;  216L A;  3EXD A;  2DQG Y;  4NG1 A;  1LZ8 A;  2LCB A;  3L2X A;  3DN1 A;  3HTG A;  2FYC A;  1BVK C;  1BHZ A;  1LZG A;  1L42 A;  5HMJ A;  2D91 A;  9LYZ A;  4H90 A;  4HP0 A;  1WQO A;  3RW8 A;  3LYO A;  208L A;  3FA0 A;  1ZVY B;  4I0C A;  2B74 A;  2RBP A;  4YEO A;  5FEL A;  1B7N A;  1D3N A;  1LI3 A;  4ARM A;  4NSG A;  1JIT A;  1GXX A;  1LZC A;  5B05 A;  111L A;  2BLY A;  3WUN A;  3CB7 A;  1UBZ A;  2FBD A;  1L92 A;  240L A;  1G07 A;  4ZEE A;  4I7J A;  3HTB A;  1OUG A;  1L44 A;  1LYE A;  3ATO A;  3QAK A;  3F8V A;  1A2Y C;  6LYT A;  1C66 A;  4NWE A;  1JEF A;  4WO6 A;  198L A;  1L04 A;  2BQA A;  147L A;  109L A;  3LZM A;  4HJZ A;  215L A;  3WU9 A;  4WLX A;  2B6Z A;  3VW7 A;  4W56 A;  1AKI A;  4GLV A;  4BAD A;  2B73 A;  2OTZ X;  3HT7 A;  5KXX A;  1OVH A;  2HEC A;  4B4I A;  140L A;  2CGI A;  1T3P A;  4WM6 A;  1FLQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...