205LA

How amino-acid insertions are allowed in an alpha-helix of t4 lysozyme
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
165
structure length
159
Chain Sequence
MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTAAKSAAAELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(o-glycosyl)
molecule keywords T4 LYSOZYME
publication title How amino-acid insertions are allowed in an alpha-helix of T4 lysozyme.
pubmed doi rcsb
source organism Enterobacteria phage t4
total genus 57
structure length 159
sequence length 165
ec nomenclature ec 3.2.1.17: Lysozyme.
pdb deposition date 1993-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00959 Phage_lysozyme Phage lysozyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.530.40 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 205lA00
1L23A 1L69A 1L61A 3C7WA 1L73A 1DYFA 2F32A 1L27A 2RBOA 233LA 1LYEA 183LA 209LA 3SB7A 1L30A 1L76A 2CUUA 1P2RA 3HUKA 1C6PA 184LA 1SX7A 3C8RA 4AQNA 1LW9A 2B74A 3CDQA 3DN0A 164LA 1C6LA 1L32A 1OWZA 1DYDA 1L07A 174LA 156LA 236LA 1P64A 4DAJA 126LA 131LA 1C62A 3FADA 1G0QA 3OE0A 1C61A 103LA 1G0KA 1QSQA 2QB0B 138LA 241LA 3HT7A 3DMVA 1DYCA 1LGXA 1C6NA 1C6AA 229LA 2RB0X 211LA 3PBLA 1L82A 3DKEX 1L28A 1C6GA 112LA 1LI3A 1P5CA 190LA 3GUOA 216LA 245LA 3OE8A 1L97A 165LA 1L18A 2NTHA 152LA 1KY0A 1LLHA 1D9WA 102LA 1L70A 115LA 3SN6R 195LA 3HDEA 1KS3A 201LA 120LA 1G0GA 1OV5A 4E97A 1L34A 1L55A 1L72A 1CV0A 3UONA 182LA 123LA 260LA 3C8QA 4EPFA 4LZMA 3RUNA 1WTHA 1L66A 1QTDA 230LA 1L21A 1L83A 255LA 1C63A 4W52A 187LA 1QS9A 1PQOA 1L25A 4EPIA 1B6IA 119LA 1P3NA 142LA 1QT5A 3L2XA 4I7KA 1C6MA 139LA 1L50A 1L0KA 1QT3A 1L44A 3F8VA 167LA 114LA 215LA 1L96A 1NHBA 1C69A 1L54A 1C65A 3DMZA 2RH1A 177LA 3NY8A 1C6TA 1C68A 1L08A 3DN3A 157LA 243LA 227LA 1QSBA 4YX7C 1P56A 221LA 1L63A 4W51A 1L52A 3DN4A 3FI5A 5I14A 1QT8A 1XJTA 3HDFA 1ZYTA 232LA 1L10A 1L00A 4EKRA 166LA 1SSWA 2OE7X 3C7ZA 1G0MA 3SB8A 4ARQA 1QTVA 1LYFA 238LA 244LA 2OTZX 3HUAA 3SBBC 3GULA 1P6YA 4I7RA 1CU3A 3DNAA 1LGWA 4I7OA 1L95A 1L56A 2OEAX 1L62A 4W59A 3DMXA 1LYHA 4S0WA 2ANXA 3SBAA 180LA 1CX6A 2B72A 140LA 253LA 1L46A 4ARQB 4W56A 3DN2A 189LA 196LA 1T8AA 1L47A 181LA 127LA 2RBNA 1T8FA 1K28A 2B73A 1C6QA 3HT8A 2RAZX 3FA0A 1L71A 141LA 104LA 1L31A 1PQDA 4GBRB 161LA 1L67A 250LA 2Q9DA 148LE 3G3XA 206LA 205LA 1PQIA 1XEPA 214LA 3EMLA 150LA 1JTMA 217LA 1LYJA 198LA 1CV6A 1L81A 1DYBA 2O79A 168LA 7LZMA 1L87A 3HH5A 1L64A 1L39A 1CX7A 1G1VA 1C6JA 4ARPA 2OE4X 1D3NA 2F2QA 149LA 1I6SA 3OE6A 5LZMA 1L04A 210LA 2B6TA 1D3MA 1L36A 2O4WA 3GUIA 3ODUA 170LA 1CV4A 1L57A 2RAYX 2Z6BA 257LA 1D2YA 1G0LA 1L02A 1CVKA 4K5YA 252LA 1LI6A 226LA 4I7PA 4ARMA 1L65A 1G1WA 254LA 1XJUA 1QUOA 2HULA 248LA 185LA 186LA 1L90A 1L38A 1QT4A 1PQJA 108LA 1C6IA 2RB2X 4YXCA 1EPYA 1L12A 143LA 2IGCA 4ARLA 163LA 261LA 2HUMA 162LA 1KW7A 1QTZA 3DN1A 1L79A 1L60A 1G0PA 3HH6A 4ARMB 1T97A 1L24A 1CU0A 1LGUA 1L48A 1ZWNA 188LA 1L16A 146LA 1LI2A 1P7SA 128LA 2B6XA 3GUJA 4I7SA 1L41A 4W58A 1C6KA 1KW5A 1T6HA 1P2LA 212LA 240LA 1L05A 1L51A 234LA 4DJHA 1L19A 1D3JA 1C6HA 231LA 6LZMA 1L59A 4I7TA 1L43A 3C82A 220LA 228LA 3SB6A 1L03A 1LWGA 3HUQA 1C6DA 1L93A 3CDTA 3V2WA 151LA 129LA 1SWZA 171LA 1CU6A 1LYGA 1L33A 2OTYX 4I7JA 173LA 122LA 1SSYA 1C6CA 3HT9A 1OV7A 4YXAC 169LA 256LA 4ARJA 1D2WA 1L11A 3HU9A 1SWYA 155LA 4PK0A 1PQKA 2RBPA 1OVKA 3HWLA 2RBRA 1CUPA 1L29A 1L58A 2OU8A 175LA 3PDSA 2Q9EA 2ANVA 3QAKA 1CTWA 1DYAA 4I7NA 1L40A 1QUGA 144LA 197LA 1L91A 1PQMA 3HTDA 3VW7A 3DN8A 225LA 1L13A 3HTFA 1C64A 1ZURA 213LA 199LA 1OVHA 3SB9A 1L84A 4W55A 1SX2A 1CV3A 3DN6A 1L15A 2B6ZA 3C7YA 3GUMA 1L88A 4I7LA 191LA 1C67A 178LA 259LA 130LA 1L99A 1L94A 3NYAA 1CU2A 1C6EA 1L89A 2L78A 4IAPA 1L86A 1CV5A 1LYDA 1C60A 1P37A 1L0JA 4EJ4A 3C81A 1KNIA 3GUNA 1LWKA 176LA 3V2YA 3CDRA 1T8GA 2OU9A 1L20A 249LA 2F47A 107LA 1L92A 1QS5A 1L06A 2B6YA 1L85A 2OE9X 4PJZA 1TLAA 1L80A 160LA 3F9LA 1L22A 1L37A 1L14A 2RBQA 1DYEA 1QT6A 4OO9A 1G0JA 219LA 147LA 258LA 1L42A 1L98A 3HTBA 2NTGA 172LA 3HU8A 4EKPA 1LPYA 137LA 4GRVA 3CDOA 4I7QA 3HT6A 145LA 159LA 1JTNA 3G3WA 3HH3A 4LDEA 1QUHA 3HH4A 1QTCA 1L35A 3HTGA 1QUDA 218LA 224LA 2HUKA 110LA 235LA 4EKQA 200LA 246LA 2LZMA 247LA 1QT7A 1L75A 1LYIA 1P36A 3G3VA 4W57A 239LA 1L74A 1L77A 2B75A 3GUPA 3NY9A 262LA 3K2RA 118LA 4W54A 1CUQA 4LDLA 3D4SA 3JR6A 237LA 3C8SA 4EXMA 1JQUA 1L01A 3LZMA 3SB5A 2O7AA 251LA 1D3FA 1P46A 223LA 1OVJA 1G07A 1OWYA 113LA 4ZPUA 242LA 2LCBA 222LA 1G06A 3OE9A 2A4TA 4I7MA 2OU0X 1C6FA 1OYUA 1QTBA 2LC9A 3C83A 4DKLA 1L26A 1C66A 125LA 1QTHA 3C80A 1L09A 2B7XA 3RZEA 158LA 2RB1X 4EKSA 1L45A 2B6WA 1C6BA 1CV1A 1L49A 1DYGA 4LDOA 2B70A 3L64A 1L17A 1L53A 4W53A 1KY1A 2RBSA 1L68A 111LA 2QARC 1CU5A 3CDVA 109LA 3GUKA 192LA
chains in the Genus database with same CATH superfamily
1L23A 1L61A 1QTKA 1L73A 1QSWA 1LHLA 1LYEA 3B0KA 209LA 4KT3A 3SP3A 184LA 3C8RA 2DQHY 3DN0A 1LZ9A 3N9CA 1OWZA 5KXTA 2G4PA 1AT6A 1L07A 3FE0A 156LA 4NGLA 4YEMA 131LA 1HSWA 1G0QA 3OE0A 3QE8A 1C61A 4WM5A 1J1XY 1QSQA 1UCOA 4OOOA 1DYCA 3TMXA 1LGXA 1YAQA 2RB0X 1LJHA 1IOQA 1L82A 1LSBA 1WQRA 2D4IA 2NWDX 2EQLA 3T36A 3GUOA 216LA 245LA 1GXXA 1KY0A 1D9WA 102LA 115LA 1QDRA 1G0GA 1YQVY 4E97A 1H6MA 1LHKA 1GE4A 1LKSA 3UONA 3N9EA 4EPFA 1LSCA 2EIZC 3M18B 1GF0A 1TAYA 4OOTA 2Y8PA 4HV1A 1PQOA 4EPIA 1IP5A 1B6IA 3CT5A 142LA 1LJKA 4I7KA 2BQBA 1QT3A 215LA 1NHBA 3DMZA 3A6CY 5F9XA 5KKIA 1UA6Y 227LA 1QSBA 4WL6A 1P56A 1L63A 4WLYA 3HBHA 3HDFA 4W96A 1SQ2L 2W1LA 3EBAB 5A3EA 1L10A 5I5QA 1LSNA 5KXXA 1LSEA 4UWVA 3C7ZA 1JITA 1G0MA 4H94A 4E3UA 3WVYA 3WU9A 238LA 4YF2A 2OTZX 1XGQC 3GULA 1P6YA 4NHSA 4I7OA 2OEAX 4H9CA 4S0WA 1XGTC 1F6RA 1F0WA 1RE2A 1LSZA 2Z18A 1CX6A 1G7MC 140LA 3TXEA 1L46A 4NG1A 1C08C 2B5ZA 3DN2A 7LYZA 2F2NA 5LA8A 3A67Y 2RBNA 1T8FA 1GB0A 1GF9A 1IEEA 1HELA 4ML7A 4WOAA 1NHEA 1C43A 1UIEA 2I26L 1L67A 2Q9DA 4IASA 148LE 1VDQA 206LA 205LA 207LA 135LA 198LA 2ZWBA 1CV6A 3LYMA 1BB6A 1L81A 5IELA 1NQIA 3AZ6A 4XJHA 2ZIKA 1CX7A 1JSFA 2BLYA 1VFBC 1KXYA 2D4KA 5HLLA 1D3NA 2F2QA 1WVVA 1I6SA 5F16A 2B6TA 1L57A 2RAYX 3AGIA 257LA 4K5YA 252LA 1KIPC 4ARMA 4PJ2C 254LA 1D0MA 1CKGA 194LA 2RB2X 108LA 1EPYA 1E8LA 3LYOA 1XGUC 4QGZA 1JKDA 1KW7A 1L60A 2MECA 2DQIY 4GCBA 1G7JC 3HH6A 1HNLA 3ZVQB 188LA 1LZEA 4XJDA 3B72A 1GFTA 4ZIXA 1GB5A 1RFPA 240LA 1GB9A 1L19A 2YBLA 1NDMC 4DT3A 2MEEA 220LA 3SB6A 1L03A 1DKKA 3CDTA 2HU3A 1BB5A 151LA 1LJ4A 2DQEY 4QY9A 4ET8A 3P65A 1C6CA 1IWWA 1G7HC 4ARJA 1SWYA 155LA 2RBPA 4WM1A 1L29A 1L58A 5DM9A 2Z12A 2YBHA 1QUGA 1FLWA 197LA 1L91A 1PQMA 2BQDA 3VW7A 3DN8A 1B7NA 4G4HA 1SX2A 3K3TA 2ZQ3A 1L88A 4I7LA 5HNLA 178LA 259LA 1L99A 1L94A 1GFKA 4H93A 1L89A 1T3PA 1LYDA 1L0JA 3C81A 1ZV5L 3GUNA 4NGKA 1GDWA 1GBYA 1L20A 1JJ3A 2DQAA 1FKVA 1LZ8A 1YKZX 4I8SA 1L92A 1PS5A 1L06A 1LSGA 4LYMA 4NGWA 1HMLA 1IR8A 1OQMA 5LVHA 132LA 1BGIA 1DYEA 4OO9A 1TBYA 5HMVA 1QUSA 258LA 3ATNA 1LSAA 3BKVA 1LPIA 1NBZC 1QIOA 5KXYA 3J4GA 3LYZA 4RDSA 4H9BA 4HJYA 3P64A 4YEOA 4PRQA 3AZ5A 5LYTA 3HTGA 1QUDA 218LA 224LA 3LN2A 2LYZA 1UICA 110LA 4DQ7A 2BQIA 4B1AA 5I53A 1QT7A 6LYTA 3G3VA 1WTNA 3WULA 4NGOA 3GUPA 1B7MA 1BVKC 5K7OA 1CUQA 5L9JA 5C6JA 1YROA 1Z55A 2ZNXY 4NWHA 1IO5A 3WU7A 251LA 3WH1A 4P2EA 113LA 242LA 3OE9A 5IHGA 3RW8A 2Z2FA 5D5FA 2LC9A 1LJJA 1GE3A 2Z2EA 2HECA 1HC0A 4B4JA 1DI5A 1B5XA 1GE1A 3B0IA 4O34A 4CFOA 1QTEA 4HPIA 1L53A 2RBSA 1XGPC 1LZCA 111LA 1LJEA 1WQOA 2BQLA 2QARC 5KXMA 2B74A 1F10A 3C7WA 3J6KA 2F32A 1JWRA 2XJWA 1L27A 4NFVA 233LA 1YL0X 1IWZA 1IX0A 1OUEA 1L30A 4DDBA 3HUKA 1C6PA 2XBSA 1IOCA 1D6PA 3CDQA 2F4AA 3AGHA 164LA 1C6LA 4NGZA 5FSTA 1DPWA 1L32A 1IP6A 1EQEA 4DAJA 3FADA 5LYZA 1JUGA 1G0KA 2QB0B 2ZYPA 133LA 1FKQA 3HT7A 3DMVA 1QUTA 4DYGA 1C6AA 229LA 1NWGA 2IHLA 1GE0A 3E3DA 4DD3A 2AUBA 211LA 3CQLA 3PBLA 1L28A 1C6GA 4LGKA 1XFPL 1P5CA 190LA 2YBNA 3B0OA 5C6LA 3BKHA 165LA 4OWEA 1B5ZA 1DKJA 4GCFA 3HDEA 201LA 120LA 1BHZA 1LZGA 5KXRA 1L72A 4NGJA 1LTMA 2YSSC 3RUNA 1WTHA 4NSHA 3WYHA 1XEIA 1LZTA 1L83A 2XQOA 2HEEA 119LA 1ZVYB 4WM4A 1B5UA 1HFZA 1I56A 1L44A 4EMNA 167LA 5J7CA 114LA 1KXWA 1L54A 2YBMA 2RH1A 1B5YA 177LA 2RSCA 1GF3A 1KIRC 243LA 3TMWA 1A2YC 3VWOA 3FI5A 4GN3A 2BQFA 1WVUA 1CKHA 1ZYTA 2YBJA 2W1MA 1UIHA 3B6LA 4EKRA 1GFHA 1TEWA 166LA 3FI7A 3SB8A 4ARQA 1LYFA 244LA 3A94A 1REXA 3HUAA 3SBBC 3P66A 4W94A 1B7OA 3IWRA 4A7DA 1GDXA 1REZA 2ANXA 3SBAA 4HJZA 2EPEA 3IJVA 5LAGA 1GFGA 4B49A 1OUDA 3WW6A 189LA 3WU8A 5KY1A 1OUHA 1LYYA 4I0CA 2B73A 3CSZA 3HT8A 1N4FA 141LA 104LA 1PQDA 4AGAA 3D3DA 1O23A 3AW6A 1WQQA 2LZTA 1LZBA 4ANRA 1D6QA 3G3XA 1GB3A 214LA 3EMLA 150LA 1JTMA 1OUCA 4HTKA 1L87A 3HH5A 2ZILA 3LYTA 4RW2A 5APCA 5ILFA 2BQKA 1YKYX 1G1VA 1WTMA 1C7PA 4LZTA 1A4VA 1TCYA 149LA 1GF5A 3OK0A 1LMQA 1REYA 1GBOA 210LA 1JIYA 1CV4A 2Z6BA 4YOPA 1D2YA 4DD9A 1LJNA 226LA 2MEFA 1G1WA 2XTHA 154LA 1GBWA 3A95A 1B7LA 4DDCA 2HULA 5LA5A 3P4ZA 2YDGA 1CNSA 1QT4A 143LA 1L12A 1GAYA 4AXTA 4WLXA 5HMJA 1L79A 2F4GA 4R6CA 4NSGA 3CB7A 5EBHA 3T6UA 1L48A 1ZWNA 2DKVA 1KIQC 1GEZA 2Q0MX 2B6XA 3GUJA 4NEBA 3WXTA 4Z98A 5D5CA 1L05A 1CKDA 4M4OA 4TUNA 1IIZA 4DJHA 1AZFA 3QNGA 1LZ5A 1D3JA 1C6HA 1D9UA 3WUMA 4LFPA 1LHMA 5LVJA 4WL7A 3HUQA 4UWUA 129LA 1SWZA 3TXGA 1VAUA 4I7JA 4NHPA 122LA 1OV7A 4H91A 1AKIA 1OVKA 4GLVA 1UC0A 5KXKA 2OU8A 4MSTA 2Q9EA 1B7RA 1CTWA 5APDA 4BAPA 1L40A 1BWIA 5B06A 1G7LC 3HTDA 1BWHA 4Z3MA 1LMAA 4N8ZA 213LA 5APEA 3WPJA 199LA 1JISA 4QDNA 4W55A 5I4XA 3DN6A 2B6ZA 3GUMA 1OP9B 191LA 1IWUA 1C67A 4CFPA 2D6BA 2W1XA 4WM3A 3HFMY 4EJ4A 3QY4A 1LWKA 4HTQA 249LA 3P68A 2MEBA 5I54A 1DQJC 5JENB 3AYQA 5LVIA 3W3EA 1GE2A 2CWIA 4XJGA 1C10A 2NTGA 4EOFA 5F14A 1LPYA 1NDGC 137LA 4GRVA 3CDOA 1V7TA 2HU1A 1GBZA 145LA 159LA 1LYOA 1F6SA 3G3WA 5KXSA 3HH3A 1HFXA 3TXDA 3TMUA 2LYOA 4H8ZA 3WL2A 4Z41A 246LA 2LZMA 4N9RA 247LA 1GEVA 4DD1A 4Z46A 4W57A 2MEDA 2B75A 4W54A 4NIJA 4LDLA 4RLMA 237LA 3A34A 2Z37A 4J1AA 1IC5Y 1JQUA 1L01A 1HEPA 1UIBA 1NKHA 3SB5A 4H9HA 1HERA 4G49A 4DWXA 1B5WA 1D3FA 1LYZA 5DN5A 1OWYA 3KAMA 4ZPUA 3N9AA 4HP0A 222LA 2A4TA 3RZ4A 2OU0X 1C6FA 1ZVHL 1GBSA 5HNCA 1JTPL 1B0DA 4LT2A 4MCKA 4GCEA 3RZEA 4J7VA 4EKSA 5KXPA 1L45A 2B6WA 1C6BA 1CV1A 1DYGA 4LDOA 2B70A 1JJ1A 4M6DA 1KY1A 2IFFY 3AZ4A 4DD0A 4LYCA 1FLQA 1LJGA 4NHTA 1L69A 3TXIA 1T6VL 2RBOA 4BAFA 4LYOA 3SB7A 1L76A 4AQNA 1LW9A 3W6AA 1CJ7A 1DYDA 4NGYA 1QQYA 236LA 1P64A 126LA 1C62A 5AMYA 138LA 4H9FA 1C6NA 3TXJA 3TXFA 3TXHA 4G4BA 1UACY 1LI3A 112LA 3A92A 3MGWA 3OE8A 1VDTA 1L97A 2I6ZA 152LA 4H8YA 1GF4A 1GFUA 1L70A 3SN6R 1EQ4A 195LA 1LZDA 2D91A 1L34A 1L55A 1CV0A 1INUA 123LA 2LZ2A 3C8QA 134LA 4WM2A 1QTDA 1FN5A 1CKFA 1L21A 4MR1A 1C63A 4W52A 187LA 1LOZA 1JKAA 4N1EI 1IC4Y 1L25A 4YM8A 2MEGA 1IWYA 2HEBA 3L2XA 1C6MA 4ZEEA 1IWTA 2GV0A 1LMCA 4CJ2A 4TWSA 4ETEA 1C6TA 1C68A 157LA 1BB7A 1P2CC 1L52A 5I14A 1QT8A 1XJTA 4HSFA 1V7SA 1UBZA 4IJ4A 1SSWA 5DLAA 3GXKA 1HEMA 1QTVA 2H9JA 1BVXA 3OJPA 1J1PY 4I7RA 1CU3A 1LGWA 1L56A 1JTTL 4W59A 3DMXA 4NHIA 1GF6A 1LZYA 1B7SA 1LAAA 5FCPA 1EQ5A 2ZYCA 3WW5A 253LA 3AB6A 1RJCB 1FDLY 196LA 1B7QA 2C8OA 127LA 5FELA 1K28A 2BQCA 1QDTA 1I1ZA 2RAZX 3FA0A 1L71A 2I25L 1L31A 3A3RX 3W6CA 2Z38A 250LA 9LYZA 3G3BB 1PQIA 3ATOA 217LA 1LYJA 1EL1A 1UIFA 1CJ6A 2O79A 5B05A 1FLYA 1IP2A 1B9OA 1HEOA 1L39A 3LZ2A 4ARPA 2OE4X 5LZMA 1L04A 3ODUA 1D3MA 2O4WA 170LA 4LT3A 4XJBA 1JKBA 1G0LA 1L02A 4I7PA 1L65A 3RU5A 1XJUA 185LA 1IC7Y 5FDJA 1L90A 4B4EA 1C6IA 4YXCA 5KXNA 4ARLA 2HEFA 261LA 4XJFA 4HV2A 5ILCA 4NHQA 1QTZA 1GFRA 1NBYC 3DN1A 1YAMA 1GB2A 1LYSA 4ARMB 5F9UA 1T97A 1L24A 1CU0A 2N5ZA 1L16A 1LI2A 1P7SA 5LAFA 128LA 4I7SA 1T6HA 1P2LA 212LA 5M1YA 3WUAA 1GD6A 4NGVA 1YANA 5L3HA 1L51A 231LA 1LSPA 6LZMA 2DQDY 4I7TA 3C82A 3LZTA 1ALCA 1LWGA 1GFAA 1VDSA 4TX7A 4B0DA 3V2WA 171LA 1CU6A 5DN4A 1IWVA 1C45A 1SLYA 3HT9A 1IOTA 3W6EA 4YXAC 4H90A 3EXDA 169LA 256LA 1RCMA 1D2WA 2D4JA 3HU9A 3AZ7A 4PK0A 1PQKA 3G3AB 3HWLA 1TDYA 175LA 1DI3A 1GPQC 2ANVA 4DQJA 4ETBA 2LHMA 5I4YA 4ZFPA 1PZYA 144LA 225LA 1C64A 2BPUA 4RLNA 1OVHA 3SB9A 1OUJA 1L84A 4DD7A 1CV3A 3C7YA 4UWNA 5II3A 4H1PA 1YILA 130LA 2L78A 1LJFA 2ZNWY 1L86A 1CV5A 4LYZA 1B7PA 1VATA 1IP3A 2BQNA 2ZQ4A 208LA 1T8GA 2C8PA 2F47A 3W6DA 107LA 5I4WA 1OUAA 2B6YA 1JTOL 2OE9X 4PJZA 1IY4A 1OUBA 1YKXX 3F9LA 4WLTA 1L22A 1L37A 5B1FA 2RBQA 4NG8A 1G0JA 219LA 1L98A 1XEJA 5HQ1A 3HU8A 4EKPA 4PHIA 1HEQA 3EMSA 1LHJA 3A6BY 1JJ0A 1WQMA 5C6IA 1NF5A 1LMOA 1IP4A 1LCNA 3HH4A 4LDEA 1L35A 3IJUA 2G4QA 2HTXA 4KXIA 2FBDA 2HUKA 235LA 4EKQA 1AM7A 1WQPA 4WO9A 5KXWA 1CJ8A 4IATA 239LA 1OUIA 2MEIA 1GB6A 3NY9A 118LA 4NY5A 2F30A 4WMGA 4WG7A 3C8SA 4EXMA 3LZMA 4G9SA 4HJVA 223LA 1OVJA 2WARA 1G07A 4L41A 1OUGA 3WUNA 3W6FA 5KXLA 1OYUA 1LJIA 3WVXA 1QTBA 3C83A 2H5ZA 1C66A 125LA 1QTHA 2DQFC 1FBIX 3A93A 5KKJA 1L09A 2B7XA 1RI8B 2FYDA 5FHWA 2X0AA 1DPXA 3L64A 4W53A 1B2KA 1XSFA 1L68A 3WMKA 4FJRA 3HBDA 4GN5C 1YAOA 3A3QA 3GUKA 4XYYA 1DYFA 183LA 1YAPA 2CUUA 1P2RA 1LZ1A 1IR9A 1SX7A 4DDAA 4GN4A 2BLXA 1GXV2 4KL7A 2BQHA 1MLCE 2Z19A 174LA 2CDSA 3CT0A 1W08A 1H87A 103LA 1NMMA 2EKSC 1C46A 1GAZA 1IORA 1UIDA 241LA 1UUZC 3AW7A 4CHXA 6LYZA 4NSJA 1D0KA 3DKEX 1LHHA 4WM6A 5T3FA 1L18A 2NTHA 4XENA 4H92A 1LLHA 1JHLA 3RNXA 1KS3A 1OV5A 182LA 260LA 4LT1A 4PGJB 4LZMA 1W6ZA 1L66A 3W6BA 230LA 2G4NA 255LA 4NSIA 1XEKA 1QS9A 4DD2A 1JKCA 4X3BA 4J0LA 2DBTA 5LIOA 1P3NA 1QT5A 3TXBA 4N1CC 1IY3A 1HFYA 139LA 1L50A 1L0KA 4BADA 3F8VA 1I20A 1IP7A 2MEAA 5KJ9A 8LYZA 1L96A 1C69A 1C65A 4CGEA 3NY8A 1L08A 1BQLY 3DN3A 4DQ5A 4YX7C 221LA 4W51A 3DN4A 4XJIA 2BQMA 3D9AC 232LA 4H9EA 4H8XA 4TTDA 5APFA 1L00A 1LSMA 3GXRA 1XGRC 4OWCA 4PPOA 2OE7X 3TMVA 3WXUA 4D9ZA 4ETCA 1HEWA 3DNAA 1L95A 3A96A 2PC2A 1L62A 1LSYA 1LYHA 1REMA 2BQGA 1LJ3A 1AT5A 5B07A 1GFEA 180LA 2B72A 4GCCA 2FYCA 4H9IA 1UIGA 4ARQB 4W56A 1GF7A 1T8AA 1L47A 181LA 2HUBA 4U3XB 1ZMYL 1C6QA 3ULRA 5IDDA 1GFJA 1VEDA 5E9RA 4GBRB 161LA 4XN6A 1GWDA 2CJLA 2CGIA 1QSAA 1XEPA 1DYBA 3F6ZA 1D0LA 168LA 4NWEA 7LZMA 1IVMA 1L64A 3WPKA 4PRUA 1GFVA 1GHLA 1G7IC 193LA 3AGGG 1C6JA 5LVGA 1DZBX 2LYMA 5LVKA 1J1OY 1OUFA 4NGIA 3OE6A 3GUIA 3LHMA 1L36A 4N5RA 4XADA 1CVKA 5LXWA 4TSCA 3CSRA 1LI6A 4ET9A 1UIAA 1IR7A 3CSQA 2H9KA 3HBEX 1QUOA 248LA 5DL9A 1HF4A 186LA 4R0FA 4LYBA 5LYMA 1LSDA 1L38A 1PQJA 4LYTA 2IGCA 4QEQA 1IOSA 4OWBA 163LA 4G4CA 1LMNA 1LMTA 1LZNA 2HUMA 4DC4A 162LA 4GCDA 1BB3A 4BS7A 5A3ZA 4II8A 4ETAA 1G0PA 3EO5A 1LGUA 4ETDA 4WLDA 1GF8A 146LA 1MELL 1HHLA 1CJ9A 1HMKA 1L41A 4W58A 1C6KA 1KW5A 2HEAA 234LA 2ZIJA 1YL1X 1L59A 1L43A 2XBRA 228LA 1LMPA 1C6DA 1L93A 4HTNA 2BAAA 1LYGA 1L33A 2OTYX 173LA 1SSYA 4YENA 2BQAA 1DI4A 4H9AA 1L11A 3ZEKA 1IWXA 1FLUA 4B4IA 2RBRA 1CUPA 3PDSA 5E4PA 3QAKA 5F81A 1DYAA 4I7NA 3RT5X 1B5VA 2W1YA 1L13A 3HTFA 1ZURA 4GLAA 2VB1A 4C5FA 4WO6A 5B1GA 1L15A 1LZSA 4OW1A 2MEHA 1LZRA 3TXKA 3NYAA 1CU2A 1C6EA 3A8ZA 4IAPA 1C60A 1P37A 3WPLA 2FBBA 1KNIA 176LA 3V2YA 3CDRA 1BB4A 2OU9A 4LT0A 5LINA 1BWJA 1QS5A 1IP1A 1WQNA 1L85A 1TLAA 1L80A 4C3WA 153LA 160LA 2HEDA 4N0JA 1LKRA 1JPOA 4TSBA 5KXZA 3ZVQA 1L14A 1QT6A 3HTBA 147LA 1L42A 1GB7A 172LA 1GBXA 4I7QA 3HT6A 2YBIA 2A7DA 4KPMA 3AJNA 4WG1A 1JTNA 1JSEA 4OWHA 1QUHA 1QTCA 1GB8A 2A7FA 2BQJA 4J1BA 3A91A 200LA 1L75A 1LYIA 1P36A 1HSXA 1L74A 1YIKA 1L77A 1LHIA 1DXJA 262LA 3K2RA 5KXOA 1KXXA 3D4SA 3JR6A 1LZ4A 2Z39A 1HENA 5B59A 2O7AA 2DQJY 1P46A 2BQOA 2BQEA 2LCBA 1G06A 1LSFA 3A90A 4I7MA 1LZ6A 4OWAA 4DKLA 4FDYA 1L26A 4LFXA 3C80A 5FEKA 158LA 1JEFA 5L3IA 3M3UA 1VDPA 2RB1X 2DQGY 3CT1A 2YVBA 1L49A 4RW1A 1CKCA 4HPEA 1L17A 1CU5A 3CDVA 1LZAA 2DQCY 109LA 192LA
chains in the Genus database with same CATH topology
1L23A 1L61A 1QTKA 1L73A 1QSWA 1LHLA 1LYEA 3B0KA 209LA 4KT3A 3SP3A 184LA 3C8RA 2DQHY 3DN0A 1LZ9A 3N9CA 1OWZA 5KXTA 2G4PA 1AT6A 1L07A 3FE0A 156LA 4NGLA 4YEMA 131LA 1HSWA 1G0QA 3OE0A 3QE8A 1C61A 4WM5A 1J1XY 1QSQA 1UCOA 4OOOA 1DYCA 3TMXA 1LGXA 1YAQA 2RB0X 1LJHA 1IOQA 1L82A 1LSBA 1WQRA 2D4IA 2NWDX 2EQLA 3T36A 3GUOA 216LA 245LA 1GXXA 1KY0A 1D9WA 102LA 115LA 1QDRA 1G0GA 1YQVY 4E97A 1H6MA 1LHKA 1GE4A 1LKSA 3UONA 3N9EA 4EPFA 1LSCA 2EIZC 3M18B 1GF0A 1TAYA 4OOTA 2Y8PA 4HV1A 1PQOA 4EPIA 1IP5A 1B6IA 3CT5A 142LA 1LJKA 4I7KA 2BQBA 1QT3A 215LA 1NHBA 3DMZA 3A6CY 5F9XA 5KKIA 1UA6Y 227LA 1QSBA 4WL6A 1P56A 1L63A 4WLYA 3HBHA 3HDFA 4W96A 1SQ2L 2W1LA 3EBAB 5A3EA 1L10A 5I5QA 1LSNA 5KXXA 1LSEA 4UWVA 3C7ZA 1JITA 1G0MA 4H94A 4E3UA 3WVYA 3WU9A 238LA 4YF2A 2OTZX 1XGQC 3GULA 1P6YA 4NHSA 4I7OA 2OEAX 4H9CA 4S0WA 1XGTC 1F6RA 1F0WA 1RE2A 1LSZA 2Z18A 1CX6A 1G7MC 140LA 3TXEA 1L46A 4NG1A 1C08C 2B5ZA 3DN2A 7LYZA 2F2NA 5LA8A 3A67Y 2RBNA 1T8FA 1GB0A 1GF9A 1IEEA 1HELA 4ML7A 4WOAA 1NHEA 1C43A 1UIEA 2I26L 1L67A 2Q9DA 4IASA 148LE 1VDQA 206LA 205LA 207LA 135LA 198LA 2ZWBA 1CV6A 3LYMA 1BB6A 1L81A 5IELA 1NQIA 3AZ6A 4XJHA 2ZIKA 1CX7A 1JSFA 2BLYA 1VFBC 1KXYA 2D4KA 5HLLA 1D3NA 2F2QA 1WVVA 1I6SA 5F16A 2B6TA 1L57A 2RAYX 3AGIA 257LA 4K5YA 252LA 1KIPC 4ARMA 4PJ2C 254LA 1D0MA 1CKGA 194LA 2RB2X 108LA 1EPYA 1E8LA 3LYOA 1XGUC 4QGZA 1JKDA 1KW7A 1L60A 2MECA 2DQIY 4GCBA 1G7JC 3HH6A 1HNLA 3ZVQB 188LA 1LZEA 4XJDA 3B72A 1GFTA 4ZIXA 1GB5A 1RFPA 240LA 1GB9A 1L19A 2YBLA 1NDMC 4DT3A 2MEEA 220LA 3SB6A 1L03A 1DKKA 3CDTA 2HU3A 1BB5A 151LA 1LJ4A 2DQEY 4QY9A 4ET8A 3P65A 1C6CA 1IWWA 1G7HC 4ARJA 1SWYA 155LA 2RBPA 4WM1A 1L29A 1L58A 5DM9A 2Z12A 2YBHA 1QUGA 1FLWA 197LA 1L91A 1PQMA 2BQDA 3VW7A 3DN8A 1B7NA 4G4HA 1SX2A 3K3TA 2ZQ3A 1L88A 4I7LA 5HNLA 178LA 259LA 1L99A 1L94A 1GFKA 4H93A 1L89A 1T3PA 1LYDA 1L0JA 3C81A 1ZV5L 3GUNA 4NGKA 1GDWA 1GBYA 1L20A 1JJ3A 2DQAA 1FKVA 1LZ8A 1YKZX 4I8SA 1L92A 1PS5A 1L06A 1LSGA 4LYMA 4NGWA 1HMLA 1IR8A 1OQMA 5LVHA 132LA 1BGIA 1DYEA 4OO9A 1TBYA 5HMVA 1QUSA 258LA 3ATNA 1LSAA 3BKVA 1LPIA 1NBZC 1QIOA 5KXYA 3J4GA 3LYZA 4RDSA 4H9BA 4HJYA 3P64A 4YEOA 4PRQA 3AZ5A 5LYTA 3HTGA 1QUDA 218LA 224LA 3LN2A 2LYZA 1UICA 110LA 4DQ7A 2BQIA 4B1AA 5I53A 1QT7A 6LYTA 3G3VA 1WTNA 3WULA 4NGOA 3GUPA 1B7MA 1BVKC 5K7OA 1CUQA 5L9JA 5C6JA 1YROA 1Z55A 2ZNXY 4NWHA 1IO5A 3WU7A 251LA 3WH1A 4P2EA 113LA 242LA 3OE9A 5IHGA 3RW8A 2Z2FA 5D5FA 2LC9A 1LJJA 1GE3A 2Z2EA 2HECA 1HC0A 4B4JA 1DI5A 1B5XA 1GE1A 3B0IA 4O34A 4CFOA 1QTEA 4HPIA 1L53A 2RBSA 1XGPC 1LZCA 111LA 1LJEA 1WQOA 2BQLA 2QARC 5KXMA 2B74A 1F10A 3C7WA 3J6KA 2F32A 1JWRA 2XJWA 1L27A 4NFVA 233LA 1YL0X 1IWZA 1IX0A 1OUEA 1L30A 4DDBA 3HUKA 1C6PA 2XBSA 1IOCA 1D6PA 3CDQA 2F4AA 3AGHA 164LA 1C6LA 4NGZA 5FSTA 1DPWA 1L32A 1IP6A 1EQEA 4DAJA 3FADA 5LYZA 1JUGA 1G0KA 2QB0B 2ZYPA 133LA 1FKQA 3HT7A 3DMVA 1QUTA 4DYGA 1C6AA 229LA 1NWGA 2IHLA 1GE0A 3E3DA 4DD3A 2AUBA 211LA 3CQLA 3PBLA 1L28A 1C6GA 4LGKA 1XFPL 1P5CA 190LA 2YBNA 3B0OA 5C6LA 3BKHA 165LA 4OWEA 1B5ZA 1DKJA 4GCFA 3HDEA 201LA 120LA 1BHZA 1LZGA 5KXRA 1L72A 4NGJA 1LTMA 2YSSC 3RUNA 1WTHA 4NSHA 3WYHA 1XEIA 1LZTA 1L83A 2XQOA 2HEEA 119LA 1ZVYB 4WM4A 1B5UA 1HFZA 1I56A 1L44A 4EMNA 167LA 5J7CA 114LA 1KXWA 1L54A 2YBMA 2RH1A 1B5YA 177LA 2RSCA 1GF3A 1KIRC 243LA 3TMWA 1A2YC 3VWOA 3FI5A 4GN3A 2BQFA 1WVUA 1CKHA 1ZYTA 2YBJA 2W1MA 1UIHA 3B6LA 4EKRA 1GFHA 1TEWA 166LA 3FI7A 3SB8A 4ARQA 1LYFA 244LA 3A94A 1REXA 3HUAA 3SBBC 3P66A 4W94A 1B7OA 3IWRA 4A7DA 1GDXA 1REZA 2ANXA 3SBAA 4HJZA 2EPEA 3IJVA 5LAGA 1GFGA 4B49A 1OUDA 3WW6A 189LA 3WU8A 5KY1A 1OUHA 1LYYA 4I0CA 2B73A 3CSZA 3HT8A 1N4FA 141LA 104LA 1PQDA 4AGAA 3D3DA 1O23A 3AW6A 1WQQA 2LZTA 1LZBA 4ANRA 1D6QA 3G3XA 1GB3A 214LA 3EMLA 150LA 1JTMA 1OUCA 4HTKA 1L87A 3HH5A 2ZILA 3LYTA 4RW2A 5APCA 5ILFA 2BQKA 1YKYX 1G1VA 1WTMA 1C7PA 4LZTA 1A4VA 1TCYA 149LA 1GF5A 3OK0A 1LMQA 1REYA 1GBOA 210LA 1JIYA 1CV4A 2Z6BA 4YOPA 1D2YA 4DD9A 1LJNA 226LA 2MEFA 1G1WA 2XTHA 154LA 1GBWA 3A95A 1B7LA 4DDCA 2HULA 5LA5A 3P4ZA 2YDGA 1CNSA 1QT4A 143LA 1L12A 1GAYA 4AXTA 4WLXA 5HMJA 1L79A 2F4GA 4R6CA 4NSGA 3CB7A 5EBHA 3T6UA 1L48A 1ZWNA 2DKVA 1KIQC 1GEZA 2Q0MX 2B6XA 3GUJA 4NEBA 3WXTA 4Z98A 5D5CA 1L05A 1CKDA 4M4OA 4TUNA 1IIZA 4DJHA 1AZFA 3QNGA 1LZ5A 1D3JA 1C6HA 1D9UA 3WUMA 4LFPA 1LHMA 5LVJA 4WL7A 3HUQA 4UWUA 129LA 1SWZA 3TXGA 1VAUA 4I7JA 4NHPA 122LA 1OV7A 4H91A 1AKIA 1OVKA 4GLVA 1UC0A 5KXKA 2OU8A 4MSTA 2Q9EA 1B7RA 1CTWA 5APDA 4BAPA 1L40A 1BWIA 5B06A 1G7LC 3HTDA 1BWHA 4Z3MA 1LMAA 4N8ZA 213LA 5APEA 3WPJA 199LA 1JISA 4QDNA 4W55A 5I4XA 3DN6A 2B6ZA 3GUMA 1OP9B 191LA 1IWUA 1C67A 4CFPA 2D6BA 2W1XA 4WM3A 3HFMY 4EJ4A 3QY4A 1LWKA 4HTQA 249LA 3P68A 2MEBA 5I54A 1DQJC 5JENB 3AYQA 5LVIA 3W3EA 1GE2A 2CWIA 4XJGA 1C10A 2NTGA 4EOFA 5F14A 1LPYA 1NDGC 137LA 4GRVA 3CDOA 1V7TA 2HU1A 1GBZA 145LA 159LA 1LYOA 1F6SA 3G3WA 5KXSA 3HH3A 1HFXA 3TXDA 3TMUA 2LYOA 4H8ZA 3WL2A 4Z41A 246LA 2LZMA 4N9RA 247LA 1GEVA 4DD1A 4Z46A 4W57A 2MEDA 2B75A 4W54A 4NIJA 4LDLA 4RLMA 237LA 3A34A 2Z37A 4J1AA 1IC5Y 1JQUA 1L01A 1HEPA 1UIBA 1NKHA 3SB5A 4H9HA 1HERA 4G49A 4DWXA 1B5WA 1D3FA 1LYZA 5DN5A 1OWYA 3KAMA 4ZPUA 3N9AA 4HP0A 222LA 2A4TA 3RZ4A 2OU0X 1C6FA 1ZVHL 1GBSA 5HNCA 1JTPL 1B0DA 4LT2A 4MCKA 4GCEA 3RZEA 4J7VA 4EKSA 5KXPA 1L45A 2B6WA 1C6BA 1CV1A 1DYGA 4LDOA 2B70A 1JJ1A 4M6DA 1KY1A 2IFFY 3AZ4A 4DD0A 4LYCA 1FLQA 1LJGA 4NHTA 1L69A 3TXIA 1T6VL 2RBOA 4BAFA 4LYOA 3SB7A 1L76A 4AQNA 1LW9A 3W6AA 1CJ7A 1DYDA 4NGYA 1QQYA 236LA 1P64A 126LA 1C62A 5AMYA 138LA 4H9FA 1C6NA 3TXJA 3TXFA 3TXHA 4G4BA 1UACY 1LI3A 112LA 3A92A 3MGWA 3OE8A 1VDTA 1L97A 2I6ZA 152LA 4H8YA 1GF4A 1GFUA 1L70A 3SN6R 1EQ4A 195LA 1LZDA 2D91A 1L34A 1L55A 1CV0A 1INUA 123LA 2LZ2A 3C8QA 134LA 4WM2A 1QTDA 1FN5A 1CKFA 1L21A 4MR1A 1C63A 4W52A 187LA 1LOZA 1JKAA 4N1EI 1IC4Y 1L25A 4YM8A 2MEGA 1IWYA 2HEBA 3L2XA 1C6MA 4ZEEA 1IWTA 2GV0A 1LMCA 4CJ2A 4TWSA 4ETEA 1C6TA 1C68A 157LA 1BB7A 1P2CC 1L52A 5I14A 1QT8A 1XJTA 4HSFA 1V7SA 1UBZA 4IJ4A 1SSWA 5DLAA 3GXKA 1HEMA 1QTVA 2H9JA 1BVXA 3OJPA 1J1PY 4I7RA 1CU3A 1LGWA 1L56A 1JTTL 4W59A 3DMXA 4NHIA 1GF6A 1LZYA 1B7SA 1LAAA 5FCPA 1EQ5A 2ZYCA 3WW5A 253LA 3AB6A 1RJCB 1FDLY 196LA 1B7QA 2C8OA 127LA 5FELA 1K28A 2BQCA 1QDTA 1I1ZA 2RAZX 3FA0A 1L71A 2I25L 1L31A 3A3RX 3W6CA 2Z38A 250LA 9LYZA 3G3BB 1PQIA 3ATOA 217LA 1LYJA 1EL1A 1UIFA 1CJ6A 2O79A 5B05A 1FLYA 1IP2A 1B9OA 1HEOA 1L39A 3LZ2A 4ARPA 2OE4X 5LZMA 1L04A 3ODUA 1D3MA 2O4WA 170LA 4LT3A 4XJBA 1JKBA 1G0LA 1L02A 4I7PA 1L65A 3RU5A 1XJUA 185LA 1IC7Y 5FDJA 1L90A 4B4EA 1C6IA 4YXCA 5KXNA 4ARLA 2HEFA 261LA 4XJFA 4HV2A 5ILCA 4NHQA 1QTZA 1GFRA 1NBYC 3DN1A 1YAMA 1GB2A 1LYSA 4ARMB 5F9UA 1T97A 1L24A 1CU0A 2N5ZA 1L16A 1LI2A 1P7SA 5LAFA 128LA 4I7SA 1T6HA 1P2LA 212LA 5M1YA 3WUAA 1GD6A 4NGVA 1YANA 5L3HA 1L51A 231LA 1LSPA 6LZMA 2DQDY 4I7TA 3C82A 3LZTA 1ALCA 1LWGA 1GFAA 1VDSA 4TX7A 4B0DA 3V2WA 171LA 1CU6A 5DN4A 1IWVA 1C45A 1SLYA 3HT9A 1IOTA 3W6EA 4YXAC 4H90A 3EXDA 169LA 256LA 1RCMA 1D2WA 2D4JA 3HU9A 3AZ7A 4PK0A 1PQKA 3G3AB 3HWLA 1TDYA 175LA 1DI3A 1GPQC 2ANVA 4DQJA 4ETBA 2LHMA 5I4YA 4ZFPA 1PZYA 144LA 225LA 1C64A 2BPUA 4RLNA 1OVHA 3SB9A 1OUJA 1L84A 4DD7A 1CV3A 3C7YA 4UWNA 5II3A 4H1PA 1YILA 130LA 2L78A 1LJFA 2ZNWY 1L86A 1CV5A 4LYZA 1B7PA 1VATA 1IP3A 2BQNA 2ZQ4A 208LA 1T8GA 2C8PA 2F47A 3W6DA 107LA 5I4WA 1OUAA 2B6YA 1JTOL 2OE9X 4PJZA 1IY4A 1OUBA 1YKXX 3F9LA 4WLTA 1L22A 1L37A 5B1FA 2RBQA 4NG8A 1G0JA 219LA 1L98A 1XEJA 5HQ1A 3HU8A 4EKPA 4PHIA 1HEQA 3EMSA 1LHJA 3A6BY 1JJ0A 1WQMA 5C6IA 1NF5A 1LMOA 1IP4A 1LCNA 3HH4A 4LDEA 1L35A 3IJUA 2G4QA 2HTXA 4KXIA 2FBDA 2HUKA 235LA 4EKQA 1AM7A 1WQPA 4WO9A 5KXWA 1CJ8A 4IATA 239LA 1OUIA 2MEIA 1GB6A 3NY9A 118LA 4NY5A 2F30A 4WMGA 4WG7A 3C8SA 4EXMA 3LZMA 4G9SA 4HJVA 223LA 1OVJA 2WARA 1G07A 4L41A 1OUGA 3WUNA 3W6FA 5KXLA 1OYUA 1LJIA 3WVXA 1QTBA 3C83A 2H5ZA 1C66A 125LA 1QTHA 2DQFC 1FBIX 3A93A 5KKJA 1L09A 2B7XA 1RI8B 2FYDA 5FHWA 2X0AA 1DPXA 3L64A 4W53A 1B2KA 1XSFA 1L68A 3WMKA 4FJRA 3HBDA 4GN5C 1YAOA 3A3QA 3GUKA 4XYYA 1DYFA 183LA 1YAPA 2CUUA 1P2RA 1LZ1A 1IR9A 1SX7A 4DDAA 4GN4A 2BLXA 1GXV2 4KL7A 2BQHA 1MLCE 2Z19A 174LA 2CDSA 3CT0A 1W08A 1H87A 103LA 1NMMA 2EKSC 1C46A 1GAZA 1IORA 1UIDA 241LA 1UUZC 3AW7A 4CHXA 6LYZA 4NSJA 1D0KA 3DKEX 1LHHA 4WM6A 5T3FA 1L18A 2NTHA 4XENA 4H92A 1LLHA 1JHLA 3RNXA 1KS3A 1OV5A 182LA 260LA 4LT1A 4PGJB 4LZMA 1W6ZA 1L66A 3W6BA 230LA 2G4NA 255LA 4NSIA 1XEKA 1QS9A 4DD2A 1JKCA 4X3BA 4J0LA 2DBTA 5LIOA 1P3NA 1QT5A 3TXBA 4N1CC 1IY3A 1HFYA 139LA 1L50A 1L0KA 4BADA 3F8VA 1I20A 1IP7A 2MEAA 5KJ9A 8LYZA 1L96A 1C69A 1C65A 4CGEA 3NY8A 1L08A 1BQLY 3DN3A 4DQ5A 4YX7C 221LA 4W51A 3DN4A 4XJIA 2BQMA 3D9AC 232LA 4H9EA 4H8XA 4TTDA 5APFA 1L00A 1LSMA 3GXRA 1XGRC 4OWCA 4PPOA 2OE7X 3TMVA 3WXUA 4D9ZA 4ETCA 1HEWA 3DNAA 1L95A 3A96A 2PC2A 1L62A 1LSYA 1LYHA 1REMA 2BQGA 1LJ3A 1AT5A 5B07A 1GFEA 180LA 2B72A 4GCCA 2FYCA 4H9IA 1UIGA 4ARQB 4W56A 1GF7A 1T8AA 1L47A 181LA 2HUBA 4U3XB 1ZMYL 1C6QA 3ULRA 5IDDA 1GFJA 1VEDA 5E9RA 4GBRB 161LA 4XN6A 1GWDA 2CJLA 2CGIA 1QSAA 1XEPA 1DYBA 3F6ZA 1D0LA 168LA 4NWEA 7LZMA 1IVMA 1L64A 3WPKA 4PRUA 1GFVA 1GHLA 1G7IC 193LA 3AGGG 1C6JA 5LVGA 1DZBX 2LYMA 5LVKA 1J1OY 1OUFA 4NGIA 3OE6A 3GUIA 3LHMA 1L36A 4N5RA 4XADA 1CVKA 5LXWA 4TSCA 3CSRA 1LI6A 4ET9A 1UIAA 1IR7A 3CSQA 2H9KA 3HBEX 1QUOA 248LA 5DL9A 1HF4A 186LA 4R0FA 4LYBA 5LYMA 1LSDA 1L38A 1PQJA 4LYTA 2IGCA 4QEQA 1IOSA 4OWBA 163LA 4G4CA 1LMNA 1LMTA 1LZNA 2HUMA 4DC4A 162LA 4GCDA 1BB3A 4BS7A 5A3ZA 4II8A 4ETAA 1G0PA 3EO5A 1LGUA 4ETDA 4WLDA 1GF8A 146LA 1MELL 1HHLA 1CJ9A 1HMKA 1L41A 4W58A 1C6KA 1KW5A 2HEAA 234LA 2ZIJA 1YL1X 1L59A 1L43A 2XBRA 228LA 1LMPA 1C6DA 1L93A 4HTNA 2BAAA 1LYGA 1L33A 2OTYX 173LA 1SSYA 4YENA 2BQAA 1DI4A 4H9AA 1L11A 3ZEKA 1IWXA 1FLUA 4B4IA 2RBRA 1CUPA 3PDSA 5E4PA 3QAKA 5F81A 1DYAA 4I7NA 3RT5X 1B5VA 2W1YA 1L13A 3HTFA 1ZURA 4GLAA 2VB1A 4C5FA 4WO6A 5B1GA 1L15A 1LZSA 4OW1A 2MEHA 1LZRA 3TXKA 3NYAA 1CU2A 1C6EA 3A8ZA 4IAPA 1C60A 1P37A 3WPLA 2FBBA 1KNIA 176LA 3V2YA 3CDRA 1BB4A 2OU9A 4LT0A 5LINA 1BWJA 1QS5A 1IP1A 1WQNA 1L85A 1TLAA 1L80A 4C3WA 153LA 160LA 2HEDA 4N0JA 1LKRA 1JPOA 4TSBA 5KXZA 3ZVQA 1L14A 1QT6A 3HTBA 147LA 1L42A 1GB7A 172LA 1GBXA 4I7QA 3HT6A 2YBIA 2A7DA 4KPMA 3AJNA 4WG1A 1JTNA 1JSEA 4OWHA 1QUHA 1QTCA 1GB8A 2A7FA 2BQJA 4J1BA 3A91A 200LA 1L75A 1LYIA 1P36A 1HSXA 1L74A 1YIKA 1L77A 1LHIA 1DXJA 262LA 3K2RA 5KXOA 1KXXA 3D4SA 3JR6A 1LZ4A 2Z39A 1HENA 5B59A 2O7AA 2DQJY 1P46A 2BQOA 2BQEA 2LCBA 1G06A 1LSFA 3A90A 4I7MA 1LZ6A 4OWAA 4DKLA 4FDYA 1L26A 4LFXA 3C80A 5FEKA 158LA 1JEFA 5L3IA 3M3UA 1VDPA 2RB1X 2DQGY 3CT1A 2YVBA 1L49A 4RW1A 1CKCA 4HPEA 1L17A 1CU5A 3CDVA 1LZAA 2DQCY 109LA 192LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L23 A;  1L69 A;  1L61 A;  3C7W A;  1L73 A;  1DYF A;  2F32 A;  1L27 A;  2RBO A;  233L A;  1LYE A;  183L A;  209L A;  3SB7 A;  1L30 A;  1L76 A;  2CUU A;  1P2R A;  3HUK A;  1C6P A;  184L A;  1SX7 A;  3C8R A;  4AQN A;  1LW9 A;  2B74 A;  3CDQ A;  3DN0 A;  164L A;  1C6L A;  1L32 A;  1OWZ A;  1DYD A;  1L07 A;  174L A;  156L A;  236L A;  1P64 A;  4DAJ A;  126L A;  131L A;  1C62 A;  3FAD A;  1G0Q A;  3OE0 A;  1C61 A;  103L A;  1G0K A;  1QSQ A;  2QB0 B;  138L A;  241L A;  3HT7 A;  3DMV A;  1DYC A;  1LGX A;  1C6N A;  1C6A A;  229L A;  2RB0 X;  211L A;  3PBL A;  1L82 A;  3DKE X;  1L28 A;  1C6G A;  112L A;  1LI3 A;  1P5C A;  190L A;  3GUO A;  216L A;  245L A;  3OE8 A;  1L97 A;  165L A;  1L18 A;  2NTH A;  152L A;  1KY0 A;  1LLH A;  1D9W A;  102L A;  1L70 A;  115L A;  3SN6 R;  195L A;  3HDE A;  1KS3 A;  201L A;  120L A;  1G0G A;  1OV5 A;  4E97 A;  1L34 A;  1L55 A;  1L72 A;  1CV0 A;  3UON A;  182L A;  123L A;  260L A;  3C8Q A;  4EPF A;  4LZM A;  3RUN A;  1WTH A;  1L66 A;  1QTD A;  230L A;  1L21 A;  1L83 A;  255L A;  1C63 A;  4W52 A;  187L A;  1QS9 A;  1PQO A;  1L25 A;  4EPI A;  1B6I A;  119L A;  1P3N A;  142L A;  1QT5 A;  3L2X A;  4I7K A;  1C6M A;  139L A;  1L50 A;  1L0K A;  1QT3 A;  1L44 A;  3F8V A;  167L A;  114L A;  215L A;  1L96 A;  1NHB A;  1C69 A;  1L54 A;  1C65 A;  3DMZ A;  2RH1 A;  177L A;  3NY8 A;  1C6T A;  1C68 A;  1L08 A;  3DN3 A;  157L A;  243L A;  227L A;  1QSB A;  4YX7 C;  1P56 A;  221L A;  1L63 A;  4W51 A;  1L52 A;  3DN4 A;  3FI5 A;  5I14 A;  1QT8 A;  1XJT A;  3HDF A;  1ZYT A;  232L A;  1L10 A;  1L00 A;  4EKR A;  166L A;  1SSW A;  2OE7 X;  3C7Z A;  1G0M A;  3SB8 A;  4ARQ A;  1QTV A;  1LYF A;  238L A;  244L A;  2OTZ X;  3HUA A;  3SBB C;  3GUL A;  1P6Y A;  4I7R A;  1CU3 A;  3DNA A;  1LGW A;  4I7O A;  1L95 A;  1L56 A;  2OEA X;  1L62 A;  4W59 A;  3DMX A;  1LYH A;  4S0W A;  2ANX A;  3SBA A;  180L A;  1CX6 A;  2B72 A;  140L A;  253L A;  1L46 A;  4ARQ B;  4W56 A;  3DN2 A;  189L A;  196L A;  1T8A A;  1L47 A;  181L A;  127L A;  2RBN A;  1T8F A;  1K28 A;  2B73 A;  1C6Q A;  3HT8 A;  2RAZ X;  3FA0 A;  1L71 A;  141L A;  104L A;  1L31 A;  1PQD A;  4GBR B;  161L A;  1L67 A;  250L A;  2Q9D A;  148L E;  3G3X A;  206L A;  205L A;  1PQI A;  1XEP A;  214L A;  3EML A;  150L A;  1JTM A;  217L A;  1LYJ A;  198L A;  1CV6 A;  1L81 A;  1DYB A;  2O79 A;  168L A;  7LZM A;  1L87 A;  3HH5 A;  1L64 A;  1L39 A;  1CX7 A;  1G1V A;  1C6J A;  4ARP A;  2OE4 X;  1D3N A;  2F2Q A;  149L A;  1I6S A;  3OE6 A;  5LZM A;  1L04 A;  210L A;  2B6T A;  1D3M A;  1L36 A;  2O4W A;  3GUI A;  3ODU A;  170L A;  1CV4 A;  1L57 A;  2RAY X;  2Z6B A;  257L A;  1D2Y A;  1G0L A;  1L02 A;  1CVK A;  4K5Y A;  252L A;  1LI6 A;  226L A;  4I7P A;  4ARM A;  1L65 A;  1G1W A;  254L A;  1XJU A;  1QUO A;  2HUL A;  248L A;  185L A;  186L A;  1L90 A;  1L38 A;  1QT4 A;  1PQJ A;  108L A;  1C6I A;  2RB2 X;  4YXC A;  1EPY A;  1L12 A;  143L A;  2IGC A;  4ARL A;  163L A;  261L A;  2HUM A;  162L A;  1KW7 A;  1QTZ A;  3DN1 A;  1L79 A;  1L60 A;  1G0P A;  3HH6 A;  4ARM B;  1T97 A;  1L24 A;  1CU0 A;  1LGU A;  1L48 A;  1ZWN A;  188L A;  1L16 A;  146L A;  1LI2 A;  1P7S A;  128L A;  2B6X A;  3GUJ A;  4I7S A;  1L41 A;  4W58 A;  1C6K A;  1KW5 A;  1T6H A;  1P2L A;  212L A;  240L A;  1L05 A;  1L51 A;  234L A;  4DJH A;  1L19 A;  1D3J A;  1C6H A;  231L A;  6LZM A;  1L59 A;  4I7T A;  1L43 A;  3C82 A;  220L A;  228L A;  3SB6 A;  1L03 A;  1LWG A;  3HUQ A;  1C6D A;  1L93 A;  3CDT A;  3V2W A;  151L A;  129L A;  1SWZ A;  171L A;  1CU6 A;  1LYG A;  1L33 A;  2OTY X;  4I7J A;  173L A;  122L A;  1SSY A;  1C6C A;  3HT9 A;  1OV7 A;  4YXA C;  169L A;  256L A;  4ARJ A;  1D2W A;  1L11 A;  3HU9 A;  1SWY A;  155L A;  4PK0 A;  1PQK A;  2RBP A;  1OVK A;  3HWL A;  2RBR A;  1CUP A;  1L29 A;  1L58 A;  2OU8 A;  175L A;  3PDS A;  2Q9E A;  2ANV A;  3QAK A;  1CTW A;  1DYA A;  4I7N A;  1L40 A;  1QUG A;  144L A;  197L A;  1L91 A;  1PQM A;  3HTD A;  3VW7 A;  3DN8 A;  225L A;  1L13 A;  3HTF A;  1C64 A;  1ZUR A;  213L A;  199L A;  1OVH A;  3SB9 A;  1L84 A;  4W55 A;  1SX2 A;  1CV3 A;  3DN6 A;  1L15 A;  2B6Z A;  3C7Y A;  3GUM A;  1L88 A;  4I7L A;  191L A;  1C67 A;  178L A;  259L A;  130L A;  1L99 A;  1L94 A;  3NYA A;  1CU2 A;  1C6E A;  1L89 A;  2L78 A;  4IAP A;  1L86 A;  1CV5 A;  1LYD A;  1C60 A;  1P37 A;  1L0J A;  4EJ4 A;  3C81 A;  1KNI A;  3GUN A;  1LWK A;  176L A;  3V2Y A;  3CDR A;  1T8G A;  2OU9 A;  1L20 A;  249L A;  2F47 A;  107L A;  1L92 A;  1QS5 A;  1L06 A;  2B6Y A;  1L85 A;  2OE9 X;  4PJZ A;  1TLA A;  1L80 A;  160L A;  3F9L A;  1L22 A;  1L37 A;  1L14 A;  2RBQ A;  1DYE A;  1QT6 A;  4OO9 A;  1G0J A;  219L A;  147L A;  258L A;  1L42 A;  1L98 A;  3HTB A;  2NTG A;  172L A;  3HU8 A;  4EKP A;  1LPY A;  137L A;  4GRV A;  3CDO A;  4I7Q A;  3HT6 A;  145L A;  159L A;  1JTN A;  3G3W A;  3HH3 A;  4LDE A;  1QUH A;  3HH4 A;  1QTC A;  1L35 A;  3HTG A;  1QUD A;  218L A;  224L A;  2HUK A;  110L A;  235L A;  4EKQ A;  200L A;  246L A;  2LZM A;  247L A;  1QT7 A;  1L75 A;  1LYI A;  1P36 A;  3G3V A;  4W57 A;  239L A;  1L74 A;  1L77 A;  2B75 A;  3GUP A;  3NY9 A;  262L A;  3K2R A;  118L A;  4W54 A;  1CUQ A;  4LDL A;  3D4S A;  3JR6 A;  237L A;  3C8S A;  4EXM A;  1JQU A;  1L01 A;  3LZM A;  3SB5 A;  2O7A A;  251L A;  1D3F A;  1P46 A;  223L A;  1OVJ A;  1G07 A;  1OWY A;  113L A;  4ZPU A;  242L A;  2LCB A;  222L A;  1G06 A;  3OE9 A;  2A4T A;  4I7M A;  2OU0 X;  1C6F A;  1OYU A;  1QTB A;  2LC9 A;  3C83 A;  4DKL A;  1L26 A;  1C66 A;  125L A;  1QTH A;  3C80 A;  1L09 A;  2B7X A;  3RZE A;  158L A;  2RB1 X;  4EKS A;  1L45 A;  2B6W A;  1C6B A;  1CV1 A;  1L49 A;  1DYG A;  4LDO A;  2B70 A;  3L64 A;  1L17 A;  1L53 A;  4W53 A;  1KY1 A;  2RBS A;  1L68 A;  111L A;  2QAR C;  1CU5 A;  3CDV A;  109L A;  3GUK A;  192L A; 
#chains in the Genus database with same CATH topology
 1L23 A;  1L61 A;  1QTK A;  1L73 A;  1QSW A;  1LHL A;  1LYE A;  3B0K A;  209L A;  4KT3 A;  3SP3 A;  184L A;  3C8R A;  2DQH Y;  3DN0 A;  1LZ9 A;  3N9C A;  1OWZ A;  5KXT A;  2G4P A;  1AT6 A;  1L07 A;  3FE0 A;  156L A;  4NGL A;  4YEM A;  131L A;  1HSW A;  1G0Q A;  3OE0 A;  3QE8 A;  1C61 A;  4WM5 A;  1J1X Y;  1QSQ A;  1UCO A;  4OOO A;  1DYC A;  3TMX A;  1LGX A;  1YAQ A;  2RB0 X;  1LJH A;  1IOQ A;  1L82 A;  1LSB A;  1WQR A;  2D4I A;  2NWD X;  2EQL A;  3T36 A;  3GUO A;  216L A;  245L A;  1GXX A;  1KY0 A;  1D9W A;  102L A;  115L A;  1QDR A;  1G0G A;  1YQV Y;  4E97 A;  1H6M A;  1LHK A;  1GE4 A;  1LKS A;  3UON A;  3N9E A;  4EPF A;  1LSC A;  2EIZ C;  3M18 B;  1GF0 A;  1TAY A;  4OOT A;  2Y8P A;  4HV1 A;  1PQO A;  4EPI A;  1IP5 A;  1B6I A;  3CT5 A;  142L A;  1LJK A;  4I7K A;  2BQB A;  1QT3 A;  215L A;  1NHB A;  3DMZ A;  3A6C Y;  5F9X A;  5KKI A;  1UA6 Y;  227L A;  1QSB A;  4WL6 A;  1P56 A;  1L63 A;  4WLY A;  3HBH A;  3HDF A;  4W96 A;  1SQ2 L;  2W1L A;  3EBA B;  5A3E A;  1L10 A;  5I5Q A;  1LSN A;  5KXX A;  1LSE A;  4UWV A;  3C7Z A;  1JIT A;  1G0M A;  4H94 A;  4E3U A;  3WVY A;  3WU9 A;  238L A;  4YF2 A;  2OTZ X;  1XGQ C;  3GUL A;  1P6Y A;  4NHS A;  4I7O A;  2OEA X;  4H9C A;  4S0W A;  1XGT C;  1F6R A;  1F0W A;  1RE2 A;  1LSZ A;  2Z18 A;  1CX6 A;  1G7M C;  140L A;  3TXE A;  1L46 A;  4NG1 A;  1C08 C;  2B5Z A;  3DN2 A;  7LYZ A;  2F2N A;  5LA8 A;  3A67 Y;  2RBN A;  1T8F A;  1GB0 A;  1GF9 A;  1IEE A;  1HEL A;  4ML7 A;  4WOA A;  1NHE A;  1C43 A;  1UIE A;  2I26 L;  1L67 A;  2Q9D A;  4IAS A;  148L E;  1VDQ A;  206L A;  205L A;  207L A;  135L A;  198L A;  2ZWB A;  1CV6 A;  3LYM A;  1BB6 A;  1L81 A;  5IEL A;  1NQI A;  3AZ6 A;  4XJH A;  2ZIK A;  1CX7 A;  1JSF A;  2BLY A;  1VFB C;  1KXY A;  2D4K A;  5HLL A;  1D3N A;  2F2Q A;  1WVV A;  1I6S A;  5F16 A;  2B6T A;  1L57 A;  2RAY X;  3AGI A;  257L A;  4K5Y A;  252L A;  1KIP C;  4ARM A;  4PJ2 C;  254L A;  1D0M A;  1CKG A;  194L A;  2RB2 X;  108L A;  1EPY A;  1E8L A;  3LYO A;  1XGU C;  4QGZ A;  1JKD A;  1KW7 A;  1L60 A;  2MEC A;  2DQI Y;  4GCB A;  1G7J C;  3HH6 A;  1HNL A;  3ZVQ B;  188L A;  1LZE A;  4XJD A;  3B72 A;  1GFT A;  4ZIX A;  1GB5 A;  1RFP A;  240L A;  1GB9 A;  1L19 A;  2YBL A;  1NDM C;  4DT3 A;  2MEE A;  220L A;  3SB6 A;  1L03 A;  1DKK A;  3CDT A;  2HU3 A;  1BB5 A;  151L A;  1LJ4 A;  2DQE Y;  4QY9 A;  4ET8 A;  3P65 A;  1C6C A;  1IWW A;  1G7H C;  4ARJ A;  1SWY A;  155L A;  2RBP A;  4WM1 A;  1L29 A;  1L58 A;  5DM9 A;  2Z12 A;  2YBH A;  1QUG A;  1FLW A;  197L A;  1L91 A;  1PQM A;  2BQD A;  3VW7 A;  3DN8 A;  1B7N A;  4G4H A;  1SX2 A;  3K3T A;  2ZQ3 A;  1L88 A;  4I7L A;  5HNL A;  178L A;  259L A;  1L99 A;  1L94 A;  1GFK A;  4H93 A;  1L89 A;  1T3P A;  1LYD A;  1L0J A;  3C81 A;  1ZV5 L;  3GUN A;  4NGK A;  1GDW A;  1GBY A;  1L20 A;  1JJ3 A;  2DQA A;  1FKV A;  1LZ8 A;  1YKZ X;  4I8S A;  1L92 A;  1PS5 A;  1L06 A;  1LSG A;  4LYM A;  4NGW A;  1HML A;  1IR8 A;  1OQM A;  5LVH A;  132L A;  1BGI A;  1DYE A;  4OO9 A;  1TBY A;  5HMV A;  1QUS A;  258L A;  3ATN A;  1LSA A;  3BKV A;  1LPI A;  1NBZ C;  1QIO A;  5KXY A;  3J4G A;  3LYZ A;  4RDS A;  4H9B A;  4HJY A;  3P64 A;  4YEO A;  4PRQ A;  3AZ5 A;  5LYT A;  3HTG A;  1QUD A;  218L A;  224L A;  3LN2 A;  2LYZ A;  1UIC A;  110L A;  4DQ7 A;  2BQI A;  4B1A A;  5I53 A;  1QT7 A;  6LYT A;  3G3V A;  1WTN A;  3WUL A;  4NGO A;  3GUP A;  1B7M A;  1BVK C;  5K7O A;  1CUQ A;  5L9J A;  5C6J A;  1YRO A;  1Z55 A;  2ZNX Y;  4NWH A;  1IO5 A;  3WU7 A;  251L A;  3WH1 A;  4P2E A;  113L A;  242L A;  3OE9 A;  5IHG A;  3RW8 A;  2Z2F A;  5D5F A;  2LC9 A;  1LJJ A;  1GE3 A;  2Z2E A;  2HEC A;  1HC0 A;  4B4J A;  1DI5 A;  1B5X A;  1GE1 A;  3B0I A;  4O34 A;  4CFO A;  1QTE A;  4HPI A;  1L53 A;  2RBS A;  1XGP C;  1LZC A;  111L A;  1LJE A;  1WQO A;  2BQL A;  2QAR C;  5KXM A;  2B74 A;  1F10 A;  3C7W A;  3J6K A;  2F32 A;  1JWR A;  2XJW A;  1L27 A;  4NFV A;  233L A;  1YL0 X;  1IWZ A;  1IX0 A;  1OUE A;  1L30 A;  4DDB A;  3HUK A;  1C6P A;  2XBS A;  1IOC A;  1D6P A;  3CDQ A;  2F4A A;  3AGH A;  164L A;  1C6L A;  4NGZ A;  5FST A;  1DPW A;  1L32 A;  1IP6 A;  1EQE A;  4DAJ A;  3FAD A;  5LYZ A;  1JUG A;  1G0K A;  2QB0 B;  2ZYP A;  133L A;  1FKQ A;  3HT7 A;  3DMV A;  1QUT A;  4DYG A;  1C6A A;  229L A;  1NWG A;  2IHL A;  1GE0 A;  3E3D A;  4DD3 A;  2AUB A;  211L A;  3CQL A;  3PBL A;  1L28 A;  1C6G A;  4LGK A;  1XFP L;  1P5C A;  190L A;  2YBN A;  3B0O A;  5C6L A;  3BKH A;  165L A;  4OWE A;  1B5Z A;  1DKJ A;  4GCF A;  3HDE A;  201L A;  120L A;  1BHZ A;  1LZG A;  5KXR A;  1L72 A;  4NGJ A;  1LTM A;  2YSS C;  3RUN A;  1WTH A;  4NSH A;  3WYH A;  1XEI A;  1LZT A;  1L83 A;  2XQO A;  2HEE A;  119L A;  1ZVY B;  4WM4 A;  1B5U A;  1HFZ A;  1I56 A;  1L44 A;  4EMN A;  167L A;  5J7C A;  114L A;  1KXW A;  1L54 A;  2YBM A;  2RH1 A;  1B5Y A;  177L A;  2RSC A;  1GF3 A;  1KIR C;  243L A;  3TMW A;  1A2Y C;  3VWO A;  3FI5 A;  4GN3 A;  2BQF A;  1WVU A;  1CKH A;  1ZYT A;  2YBJ A;  2W1M A;  1UIH A;  3B6L A;  4EKR A;  1GFH A;  1TEW A;  166L A;  3FI7 A;  3SB8 A;  4ARQ A;  1LYF A;  244L A;  3A94 A;  1REX A;  3HUA A;  3SBB C;  3P66 A;  4W94 A;  1B7O A;  3IWR A;  4A7D A;  1GDX A;  1REZ A;  2ANX A;  3SBA A;  4HJZ A;  2EPE A;  3IJV A;  5LAG A;  1GFG A;  4B49 A;  1OUD A;  3WW6 A;  189L A;  3WU8 A;  5KY1 A;  1OUH A;  1LYY A;  4I0C A;  2B73 A;  3CSZ A;  3HT8 A;  1N4F A;  141L A;  104L A;  1PQD A;  4AGA A;  3D3D A;  1O23 A;  3AW6 A;  1WQQ A;  2LZT A;  1LZB A;  4ANR A;  1D6Q A;  3G3X A;  1GB3 A;  214L A;  3EML A;  150L A;  1JTM A;  1OUC A;  4HTK A;  1L87 A;  3HH5 A;  2ZIL A;  3LYT A;  4RW2 A;  5APC A;  5ILF A;  2BQK A;  1YKY X;  1G1V A;  1WTM A;  1C7P A;  4LZT A;  1A4V A;  1TCY A;  149L A;  1GF5 A;  3OK0 A;  1LMQ A;  1REY A;  1GBO A;  210L A;  1JIY A;  1CV4 A;  2Z6B A;  4YOP A;  1D2Y A;  4DD9 A;  1LJN A;  226L A;  2MEF A;  1G1W A;  2XTH A;  154L A;  1GBW A;  3A95 A;  1B7L A;  4DDC A;  2HUL A;  5LA5 A;  3P4Z A;  2YDG A;  1CNS A;  1QT4 A;  143L A;  1L12 A;  1GAY A;  4AXT A;  4WLX A;  5HMJ A;  1L79 A;  2F4G A;  4R6C A;  4NSG A;  3CB7 A;  5EBH A;  3T6U A;  1L48 A;  1ZWN A;  2DKV A;  1KIQ C;  1GEZ A;  2Q0M X;  2B6X A;  3GUJ A;  4NEB A;  3WXT A;  4Z98 A;  5D5C A;  1L05 A;  1CKD A;  4M4O A;  4TUN A;  1IIZ A;  4DJH A;  1AZF A;  3QNG A;  1LZ5 A;  1D3J A;  1C6H A;  1D9U A;  3WUM A;  4LFP A;  1LHM A;  5LVJ A;  4WL7 A;  3HUQ A;  4UWU A;  129L A;  1SWZ A;  3TXG A;  1VAU A;  4I7J A;  4NHP A;  122L A;  1OV7 A;  4H91 A;  1AKI A;  1OVK A;  4GLV A;  1UC0 A;  5KXK A;  2OU8 A;  4MST A;  2Q9E A;  1B7R A;  1CTW A;  5APD A;  4BAP A;  1L40 A;  1BWI A;  5B06 A;  1G7L C;  3HTD A;  1BWH A;  4Z3M A;  1LMA A;  4N8Z A;  213L A;  5APE A;  3WPJ A;  199L A;  1JIS A;  4QDN A;  4W55 A;  5I4X A;  3DN6 A;  2B6Z A;  3GUM A;  1OP9 B;  191L A;  1IWU A;  1C67 A;  4CFP A;  2D6B A;  2W1X A;  4WM3 A;  3HFM Y;  4EJ4 A;  3QY4 A;  1LWK A;  4HTQ A;  249L A;  3P68 A;  2MEB A;  5I54 A;  1DQJ C;  5JEN B;  3AYQ A;  5LVI A;  3W3E A;  1GE2 A;  2CWI A;  4XJG A;  1C10 A;  2NTG A;  4EOF A;  5F14 A;  1LPY A;  1NDG C;  137L A;  4GRV A;  3CDO A;  1V7T A;  2HU1 A;  1GBZ A;  145L A;  159L A;  1LYO A;  1F6S A;  3G3W A;  5KXS A;  3HH3 A;  1HFX A;  3TXD A;  3TMU A;  2LYO A;  4H8Z A;  3WL2 A;  4Z41 A;  246L A;  2LZM A;  4N9R A;  247L A;  1GEV A;  4DD1 A;  4Z46 A;  4W57 A;  2MED A;  2B75 A;  4W54 A;  4NIJ A;  4LDL A;  4RLM A;  237L A;  3A34 A;  2Z37 A;  4J1A A;  1IC5 Y;  1JQU A;  1L01 A;  1HEP A;  1UIB A;  1NKH A;  3SB5 A;  4H9H A;  1HER A;  4G49 A;  4DWX A;  1B5W A;  1D3F A;  1LYZ A;  5DN5 A;  1OWY A;  3KAM A;  4ZPU A;  3N9A A;  4HP0 A;  222L A;  2A4T A;  3RZ4 A;  2OU0 X;  1C6F A;  1ZVH L;  1GBS A;  5HNC A;  1JTP L;  1B0D A;  4LT2 A;  4MCK A;  4GCE A;  3RZE A;  4J7V A;  4EKS A;  5KXP A;  1L45 A;  2B6W A;  1C6B A;  1CV1 A;  1DYG A;  4LDO A;  2B70 A;  1JJ1 A;  4M6D A;  1KY1 A;  2IFF Y;  3AZ4 A;  4DD0 A;  4LYC A;  1FLQ A;  1LJG A;  4NHT A;  1L69 A;  3TXI A;  1T6V L;  2RBO A;  4BAF A;  4LYO A;  3SB7 A;  1L76 A;  4AQN A;  1LW9 A;  3W6A A;  1CJ7 A;  1DYD A;  4NGY A;  1QQY A;  236L A;  1P64 A;  126L A;  1C62 A;  5AMY A;  138L A;  4H9F A;  1C6N A;  3TXJ A;  3TXF A;  3TXH A;  4G4B A;  1UAC Y;  1LI3 A;  112L A;  3A92 A;  3MGW A;  3OE8 A;  1VDT A;  1L97 A;  2I6Z A;  152L A;  4H8Y A;  1GF4 A;  1GFU A;  1L70 A;  3SN6 R;  1EQ4 A;  195L A;  1LZD A;  2D91 A;  1L34 A;  1L55 A;  1CV0 A;  1INU A;  123L A;  2LZ2 A;  3C8Q A;  134L A;  4WM2 A;  1QTD A;  1FN5 A;  1CKF A;  1L21 A;  4MR1 A;  1C63 A;  4W52 A;  187L A;  1LOZ A;  1JKA A;  4N1E I;  1IC4 Y;  1L25 A;  4YM8 A;  2MEG A;  1IWY A;  2HEB A;  3L2X A;  1C6M A;  4ZEE A;  1IWT A;  2GV0 A;  1LMC A;  4CJ2 A;  4TWS A;  4ETE A;  1C6T A;  1C68 A;  157L A;  1BB7 A;  1P2C C;  1L52 A;  5I14 A;  1QT8 A;  1XJT A;  4HSF A;  1V7S A;  1UBZ A;  4IJ4 A;  1SSW A;  5DLA A;  3GXK A;  1HEM A;  1QTV A;  2H9J A;  1BVX A;  3OJP A;  1J1P Y;  4I7R A;  1CU3 A;  1LGW A;  1L56 A;  1JTT L;  4W59 A;  3DMX A;  4NHI A;  1GF6 A;  1LZY A;  1B7S A;  1LAA A;  5FCP A;  1EQ5 A;  2ZYC A;  3WW5 A;  253L A;  3AB6 A;  1RJC B;  1FDL Y;  196L A;  1B7Q A;  2C8O A;  127L A;  5FEL A;  1K28 A;  2BQC A;  1QDT A;  1I1Z A;  2RAZ X;  3FA0 A;  1L71 A;  2I25 L;  1L31 A;  3A3R X;  3W6C A;  2Z38 A;  250L A;  9LYZ A;  3G3B B;  1PQI A;  3ATO A;  217L A;  1LYJ A;  1EL1 A;  1UIF A;  1CJ6 A;  2O79 A;  5B05 A;  1FLY A;  1IP2 A;  1B9O A;  1HEO A;  1L39 A;  3LZ2 A;  4ARP A;  2OE4 X;  5LZM A;  1L04 A;  3ODU A;  1D3M A;  2O4W A;  170L A;  4LT3 A;  4XJB A;  1JKB A;  1G0L A;  1L02 A;  4I7P A;  1L65 A;  3RU5 A;  1XJU A;  185L A;  1IC7 Y;  5FDJ A;  1L90 A;  4B4E A;  1C6I A;  4YXC A;  5KXN A;  4ARL A;  2HEF A;  261L A;  4XJF A;  4HV2 A;  5ILC A;  4NHQ A;  1QTZ A;  1GFR A;  1NBY C;  3DN1 A;  1YAM A;  1GB2 A;  1LYS A;  4ARM B;  5F9U A;  1T97 A;  1L24 A;  1CU0 A;  2N5Z A;  1L16 A;  1LI2 A;  1P7S A;  5LAF A;  128L A;  4I7S A;  1T6H A;  1P2L A;  212L A;  5M1Y A;  3WUA A;  1GD6 A;  4NGV A;  1YAN A;  5L3H A;  1L51 A;  231L A;  1LSP A;  6LZM A;  2DQD Y;  4I7T A;  3C82 A;  3LZT A;  1ALC A;  1LWG A;  1GFA A;  1VDS A;  4TX7 A;  4B0D A;  3V2W A;  171L A;  1CU6 A;  5DN4 A;  1IWV A;  1C45 A;  1SLY A;  3HT9 A;  1IOT A;  3W6E A;  4YXA C;  4H90 A;  3EXD A;  169L A;  256L A;  1RCM A;  1D2W A;  2D4J A;  3HU9 A;  3AZ7 A;  4PK0 A;  1PQK A;  3G3A B;  3HWL A;  1TDY A;  175L A;  1DI3 A;  1GPQ C;  2ANV A;  4DQJ A;  4ETB A;  2LHM A;  5I4Y A;  4ZFP A;  1PZY A;  144L A;  225L A;  1C64 A;  2BPU A;  4RLN A;  1OVH A;  3SB9 A;  1OUJ A;  1L84 A;  4DD7 A;  1CV3 A;  3C7Y A;  4UWN A;  5II3 A;  4H1P A;  1YIL A;  130L A;  2L78 A;  1LJF A;  2ZNW Y;  1L86 A;  1CV5 A;  4LYZ A;  1B7P A;  1VAT A;  1IP3 A;  2BQN A;  2ZQ4 A;  208L A;  1T8G A;  2C8P A;  2F47 A;  3W6D A;  107L A;  5I4W A;  1OUA A;  2B6Y A;  1JTO L;  2OE9 X;  4PJZ A;  1IY4 A;  1OUB A;  1YKX X;  3F9L A;  4WLT A;  1L22 A;  1L37 A;  5B1F A;  2RBQ A;  4NG8 A;  1G0J A;  219L A;  1L98 A;  1XEJ A;  5HQ1 A;  3HU8 A;  4EKP A;  4PHI A;  1HEQ A;  3EMS A;  1LHJ A;  3A6B Y;  1JJ0 A;  1WQM A;  5C6I A;  1NF5 A;  1LMO A;  1IP4 A;  1LCN A;  3HH4 A;  4LDE A;  1L35 A;  3IJU A;  2G4Q A;  2HTX A;  4KXI A;  2FBD A;  2HUK A;  235L A;  4EKQ A;  1AM7 A;  1WQP A;  4WO9 A;  5KXW A;  1CJ8 A;  4IAT A;  239L A;  1OUI A;  2MEI A;  1GB6 A;  3NY9 A;  118L A;  4NY5 A;  2F30 A;  4WMG A;  4WG7 A;  3C8S A;  4EXM A;  3LZM A;  4G9S A;  4HJV A;  223L A;  1OVJ A;  2WAR A;  1G07 A;  4L41 A;  1OUG A;  3WUN A;  3W6F A;  5KXL A;  1OYU A;  1LJI A;  3WVX A;  1QTB A;  3C83 A;  2H5Z A;  1C66 A;  125L A;  1QTH A;  2DQF C;  1FBI X;  3A93 A;  5KKJ A;  1L09 A;  2B7X A;  1RI8 B;  2FYD A;  5FHW A;  2X0A A;  1DPX A;  3L64 A;  4W53 A;  1B2K A;  1XSF A;  1L68 A;  3WMK A;  4FJR A;  3HBD A;  4GN5 C;  1YAO A;  3A3Q A;  3GUK A;  4XYY A;  1DYF A;  183L A;  1YAP A;  2CUU A;  1P2R A;  1LZ1 A;  1IR9 A;  1SX7 A;  4DDA A;  4GN4 A;  2BLX A;  1GXV 2;  4KL7 A;  2BQH A;  1MLC E;  2Z19 A;  174L A;  2CDS A;  3CT0 A;  1W08 A;  1H87 A;  103L A;  1NMM A;  2EKS C;  1C46 A;  1GAZ A;  1IOR A;  1UID A;  241L A;  1UUZ C;  3AW7 A;  4CHX A;  6LYZ A;  4NSJ A;  1D0K A;  3DKE X;  1LHH A;  4WM6 A;  5T3F A;  1L18 A;  2NTH A;  4XEN A;  4H92 A;  1LLH A;  1JHL A;  3RNX A;  1KS3 A;  1OV5 A;  182L A;  260L A;  4LT1 A;  4PGJ B;  4LZM A;  1W6Z A;  1L66 A;  3W6B A;  230L A;  2G4N A;  255L A;  4NSI A;  1XEK A;  1QS9 A;  4DD2 A;  1JKC A;  4X3B A;  4J0L A;  2DBT A;  5LIO A;  1P3N A;  1QT5 A;  3TXB A;  4N1C C;  1IY3 A;  1HFY A;  139L A;  1L50 A;  1L0K A;  4BAD A;  3F8V A;  1I20 A;  1IP7 A;  2MEA A;  5KJ9 A;  8LYZ A;  1L96 A;  1C69 A;  1C65 A;  4CGE A;  3NY8 A;  1L08 A;  1BQL Y;  3DN3 A;  4DQ5 A;  4YX7 C;  221L A;  4W51 A;  3DN4 A;  4XJI A;  2BQM A;  3D9A C;  232L A;  4H9E A;  4H8X A;  4TTD A;  5APF A;  1L00 A;  1LSM A;  3GXR A;  1XGR C;  4OWC A;  4PPO A;  2OE7 X;  3TMV A;  3WXU A;  4D9Z A;  4ETC A;  1HEW A;  3DNA A;  1L95 A;  3A96 A;  2PC2 A;  1L62 A;  1LSY A;  1LYH A;  1REM A;  2BQG A;  1LJ3 A;  1AT5 A;  5B07 A;  1GFE A;  180L A;  2B72 A;  4GCC A;  2FYC A;  4H9I A;  1UIG A;  4ARQ B;  4W56 A;  1GF7 A;  1T8A A;  1L47 A;  181L A;  2HUB A;  4U3X B;  1ZMY L;  1C6Q A;  3ULR A;  5IDD A;  1GFJ A;  1VED A;  5E9R A;  4GBR B;  161L A;  4XN6 A;  1GWD A;  2CJL A;  2CGI A;  1QSA A;  1XEP A;  1DYB A;  3F6Z A;  1D0L A;  168L A;  4NWE A;  7LZM A;  1IVM A;  1L64 A;  3WPK A;  4PRU A;  1GFV A;  1GHL A;  1G7I C;  193L A;  3AGG G;  1C6J A;  5LVG A;  1DZB X;  2LYM A;  5LVK A;  1J1O Y;  1OUF A;  4NGI A;  3OE6 A;  3GUI A;  3LHM A;  1L36 A;  4N5R A;  4XAD A;  1CVK A;  5LXW A;  4TSC A;  3CSR A;  1LI6 A;  4ET9 A;  1UIA A;  1IR7 A;  3CSQ A;  2H9K A;  3HBE X;  1QUO A;  248L A;  5DL9 A;  1HF4 A;  186L A;  4R0F A;  4LYB A;  5LYM A;  1LSD A;  1L38 A;  1PQJ A;  4LYT A;  2IGC A;  4QEQ A;  1IOS A;  4OWB A;  163L A;  4G4C A;  1LMN A;  1LMT A;  1LZN A;  2HUM A;  4DC4 A;  162L A;  4GCD A;  1BB3 A;  4BS7 A;  5A3Z A;  4II8 A;  4ETA A;  1G0P A;  3EO5 A;  1LGU A;  4ETD A;  4WLD A;  1GF8 A;  146L A;  1MEL L;  1HHL A;  1CJ9 A;  1HMK A;  1L41 A;  4W58 A;  1C6K A;  1KW5 A;  2HEA A;  234L A;  2ZIJ A;  1YL1 X;  1L59 A;  1L43 A;  2XBR A;  228L A;  1LMP A;  1C6D A;  1L93 A;  4HTN A;  2BAA A;  1LYG A;  1L33 A;  2OTY X;  173L A;  1SSY A;  4YEN A;  2BQA A;  1DI4 A;  4H9A A;  1L11 A;  3ZEK A;  1IWX A;  1FLU A;  4B4I A;  2RBR A;  1CUP A;  3PDS A;  5E4P A;  3QAK A;  5F81 A;  1DYA A;  4I7N A;  3RT5 X;  1B5V A;  2W1Y A;  1L13 A;  3HTF A;  1ZUR A;  4GLA A;  2VB1 A;  4C5F A;  4WO6 A;  5B1G A;  1L15 A;  1LZS A;  4OW1 A;  2MEH A;  1LZR A;  3TXK A;  3NYA A;  1CU2 A;  1C6E A;  3A8Z A;  4IAP A;  1C60 A;  1P37 A;  3WPL A;  2FBB A;  1KNI A;  176L A;  3V2Y A;  3CDR A;  1BB4 A;  2OU9 A;  4LT0 A;  5LIN A;  1BWJ A;  1QS5 A;  1IP1 A;  1WQN A;  1L85 A;  1TLA A;  1L80 A;  4C3W A;  153L A;  160L A;  2HED A;  4N0J A;  1LKR A;  1JPO A;  4TSB A;  5KXZ A;  3ZVQ A;  1L14 A;  1QT6 A;  3HTB A;  147L A;  1L42 A;  1GB7 A;  172L A;  1GBX A;  4I7Q A;  3HT6 A;  2YBI A;  2A7D A;  4KPM A;  3AJN A;  4WG1 A;  1JTN A;  1JSE A;  4OWH A;  1QUH A;  1QTC A;  1GB8 A;  2A7F A;  2BQJ A;  4J1B A;  3A91 A;  200L A;  1L75 A;  1LYI A;  1P36 A;  1HSX A;  1L74 A;  1YIK A;  1L77 A;  1LHI A;  1DXJ A;  262L A;  3K2R A;  5KXO A;  1KXX A;  3D4S A;  3JR6 A;  1LZ4 A;  2Z39 A;  1HEN A;  5B59 A;  2O7A A;  2DQJ Y;  1P46 A;  2BQO A;  2BQE A;  2LCB A;  1G06 A;  1LSF A;  3A90 A;  4I7M A;  1LZ6 A;  4OWA A;  4DKL A;  4FDY A;  1L26 A;  4LFX A;  3C80 A;  5FEK A;  158L A;  1JEF A;  5L3I A;  3M3U A;  1VDP A;  2RB1 X;  2DQG Y;  3CT1 A;  2YVB A;  1L49 A;  4RW1 A;  1CKC A;  4HPE A;  1L17 A;  1CU5 A;  3CDV A;  1LZA A;  2DQC Y;  109L A;  192L A; 
#chains in the Genus database with same CATH homology
 1L23 A;  1L61 A;  1QTK A;  1L73 A;  1QSW A;  1LHL A;  1LYE A;  3B0K A;  209L A;  4KT3 A;  3SP3 A;  184L A;  3C8R A;  2DQH Y;  3DN0 A;  1LZ9 A;  3N9C A;  1OWZ A;  5KXT A;  2G4P A;  1AT6 A;  1L07 A;  3FE0 A;  156L A;  4NGL A;  4YEM A;  131L A;  1HSW A;  1G0Q A;  3OE0 A;  3QE8 A;  1C61 A;  4WM5 A;  1J1X Y;  1QSQ A;  1UCO A;  4OOO A;  1DYC A;  3TMX A;  1LGX A;  1YAQ A;  2RB0 X;  1LJH A;  1IOQ A;  1L82 A;  1LSB A;  1WQR A;  2D4I A;  2NWD X;  2EQL A;  3T36 A;  3GUO A;  216L A;  245L A;  1GXX A;  1KY0 A;  1D9W A;  102L A;  115L A;  1QDR A;  1G0G A;  1YQV Y;  4E97 A;  1H6M A;  1LHK A;  1GE4 A;  1LKS A;  3UON A;  3N9E A;  4EPF A;  1LSC A;  2EIZ C;  3M18 B;  1GF0 A;  1TAY A;  4OOT A;  2Y8P A;  4HV1 A;  1PQO A;  4EPI A;  1IP5 A;  1B6I A;  3CT5 A;  142L A;  1LJK A;  4I7K A;  2BQB A;  1QT3 A;  215L A;  1NHB A;  3DMZ A;  3A6C Y;  5F9X A;  5KKI A;  1UA6 Y;  227L A;  1QSB A;  4WL6 A;  1P56 A;  1L63 A;  4WLY A;  3HBH A;  3HDF A;  4W96 A;  1SQ2 L;  2W1L A;  3EBA B;  5A3E A;  1L10 A;  5I5Q A;  1LSN A;  5KXX A;  1LSE A;  4UWV A;  3C7Z A;  1JIT A;  1G0M A;  4H94 A;  4E3U A;  3WVY A;  3WU9 A;  238L A;  4YF2 A;  2OTZ X;  1XGQ C;  3GUL A;  1P6Y A;  4NHS A;  4I7O A;  2OEA X;  4H9C A;  4S0W A;  1XGT C;  1F6R A;  1F0W A;  1RE2 A;  1LSZ A;  2Z18 A;  1CX6 A;  1G7M C;  140L A;  3TXE A;  1L46 A;  4NG1 A;  1C08 C;  2B5Z A;  3DN2 A;  7LYZ A;  2F2N A;  5LA8 A;  3A67 Y;  2RBN A;  1T8F A;  1GB0 A;  1GF9 A;  1IEE A;  1HEL A;  4ML7 A;  4WOA A;  1NHE A;  1C43 A;  1UIE A;  2I26 L;  1L67 A;  2Q9D A;  4IAS A;  148L E;  1VDQ A;  206L A;  205L A;  207L A;  135L A;  198L A;  2ZWB A;  1CV6 A;  3LYM A;  1BB6 A;  1L81 A;  5IEL A;  1NQI A;  3AZ6 A;  4XJH A;  2ZIK A;  1CX7 A;  1JSF A;  2BLY A;  1VFB C;  1KXY A;  2D4K A;  5HLL A;  1D3N A;  2F2Q A;  1WVV A;  1I6S A;  5F16 A;  2B6T A;  1L57 A;  2RAY X;  3AGI A;  257L A;  4K5Y A;  252L A;  1KIP C;  4ARM A;  4PJ2 C;  254L A;  1D0M A;  1CKG A;  194L A;  2RB2 X;  108L A;  1EPY A;  1E8L A;  3LYO A;  1XGU C;  4QGZ A;  1JKD A;  1KW7 A;  1L60 A;  2MEC A;  2DQI Y;  4GCB A;  1G7J C;  3HH6 A;  1HNL A;  3ZVQ B;  188L A;  1LZE A;  4XJD A;  3B72 A;  1GFT A;  4ZIX A;  1GB5 A;  1RFP A;  240L A;  1GB9 A;  1L19 A;  2YBL A;  1NDM C;  4DT3 A;  2MEE A;  220L A;  3SB6 A;  1L03 A;  1DKK A;  3CDT A;  2HU3 A;  1BB5 A;  151L A;  1LJ4 A;  2DQE Y;  4QY9 A;  4ET8 A;  3P65 A;  1C6C A;  1IWW A;  1G7H C;  4ARJ A;  1SWY A;  155L A;  2RBP A;  4WM1 A;  1L29 A;  1L58 A;  5DM9 A;  2Z12 A;  2YBH A;  1QUG A;  1FLW A;  197L A;  1L91 A;  1PQM A;  2BQD A;  3VW7 A;  3DN8 A;  1B7N A;  4G4H A;  1SX2 A;  3K3T A;  2ZQ3 A;  1L88 A;  4I7L A;  5HNL A;  178L A;  259L A;  1L99 A;  1L94 A;  1GFK A;  4H93 A;  1L89 A;  1T3P A;  1LYD A;  1L0J A;  3C81 A;  1ZV5 L;  3GUN A;  4NGK A;  1GDW A;  1GBY A;  1L20 A;  1JJ3 A;  2DQA A;  1FKV A;  1LZ8 A;  1YKZ X;  4I8S A;  1L92 A;  1PS5 A;  1L06 A;  1LSG A;  4LYM A;  4NGW A;  1HML A;  1IR8 A;  1OQM A;  5LVH A;  132L A;  1BGI A;  1DYE A;  4OO9 A;  1TBY A;  5HMV A;  1QUS A;  258L A;  3ATN A;  1LSA A;  3BKV A;  1LPI A;  1NBZ C;  1QIO A;  5KXY A;  3J4G A;  3LYZ A;  4RDS A;  4H9B A;  4HJY A;  3P64 A;  4YEO A;  4PRQ A;  3AZ5 A;  5LYT A;  3HTG A;  1QUD A;  218L A;  224L A;  3LN2 A;  2LYZ A;  1UIC A;  110L A;  4DQ7 A;  2BQI A;  4B1A A;  5I53 A;  1QT7 A;  6LYT A;  3G3V A;  1WTN A;  3WUL A;  4NGO A;  3GUP A;  1B7M A;  1BVK C;  5K7O A;  1CUQ A;  5L9J A;  5C6J A;  1YRO A;  1Z55 A;  2ZNX Y;  4NWH A;  1IO5 A;  3WU7 A;  251L A;  3WH1 A;  4P2E A;  113L A;  242L A;  3OE9 A;  5IHG A;  3RW8 A;  2Z2F A;  5D5F A;  2LC9 A;  1LJJ A;  1GE3 A;  2Z2E A;  2HEC A;  1HC0 A;  4B4J A;  1DI5 A;  1B5X A;  1GE1 A;  3B0I A;  4O34 A;  4CFO A;  1QTE A;  4HPI A;  1L53 A;  2RBS A;  1XGP C;  1LZC A;  111L A;  1LJE A;  1WQO A;  2BQL A;  2QAR C;  5KXM A;  2B74 A;  1F10 A;  3C7W A;  3J6K A;  2F32 A;  1JWR A;  2XJW A;  1L27 A;  4NFV A;  233L A;  1YL0 X;  1IWZ A;  1IX0 A;  1OUE A;  1L30 A;  4DDB A;  3HUK A;  1C6P A;  2XBS A;  1IOC A;  1D6P A;  3CDQ A;  2F4A A;  3AGH A;  164L A;  1C6L A;  4NGZ A;  5FST A;  1DPW A;  1L32 A;  1IP6 A;  1EQE A;  4DAJ A;  3FAD A;  5LYZ A;  1JUG A;  1G0K A;  2QB0 B;  2ZYP A;  133L A;  1FKQ A;  3HT7 A;  3DMV A;  1QUT A;  4DYG A;  1C6A A;  229L A;  1NWG A;  2IHL A;  1GE0 A;  3E3D A;  4DD3 A;  2AUB A;  211L A;  3CQL A;  3PBL A;  1L28 A;  1C6G A;  4LGK A;  1XFP L;  1P5C A;  190L A;  2YBN A;  3B0O A;  5C6L A;  3BKH A;  165L A;  4OWE A;  1B5Z A;  1DKJ A;  4GCF A;  3HDE A;  201L A;  120L A;  1BHZ A;  1LZG A;  5KXR A;  1L72 A;  4NGJ A;  1LTM A;  2YSS C;  3RUN A;  1WTH A;  4NSH A;  3WYH A;  1XEI A;  1LZT A;  1L83 A;  2XQO A;  2HEE A;  119L A;  1ZVY B;  4WM4 A;  1B5U A;  1HFZ A;  1I56 A;  1L44 A;  4EMN A;  167L A;  5J7C A;  114L A;  1KXW A;  1L54 A;  2YBM A;  2RH1 A;  1B5Y A;  177L A;  2RSC A;  1GF3 A;  1KIR C;  243L A;  3TMW A;  1A2Y C;  3VWO A;  3FI5 A;  4GN3 A;  2BQF A;  1WVU A;  1CKH A;  1ZYT A;  2YBJ A;  2W1M A;  1UIH A;  3B6L A;  4EKR A;  1GFH A;  1TEW A;  166L A;  3FI7 A;  3SB8 A;  4ARQ A;  1LYF A;  244L A;  3A94 A;  1REX A;  3HUA A;  3SBB C;  3P66 A;  4W94 A;  1B7O A;  3IWR A;  4A7D A;  1GDX A;  1REZ A;  2ANX A;  3SBA A;  4HJZ A;  2EPE A;  3IJV A;  5LAG A;  1GFG A;  4B49 A;  1OUD A;  3WW6 A;  189L A;  3WU8 A;  5KY1 A;  1OUH A;  1LYY A;  4I0C A;  2B73 A;  3CSZ A;  3HT8 A;  1N4F A;  141L A;  104L A;  1PQD A;  4AGA A;  3D3D A;  1O23 A;  3AW6 A;  1WQQ A;  2LZT A;  1LZB A;  4ANR A;  1D6Q A;  3G3X A;  1GB3 A;  214L A;  3EML A;  150L A;  1JTM A;  1OUC A;  4HTK A;  1L87 A;  3HH5 A;  2ZIL A;  3LYT A;  4RW2 A;  5APC A;  5ILF A;  2BQK A;  1YKY X;  1G1V A;  1WTM A;  1C7P A;  4LZT A;  1A4V A;  1TCY A;  149L A;  1GF5 A;  3OK0 A;  1LMQ A;  1REY A;  1GBO A;  210L A;  1JIY A;  1CV4 A;  2Z6B A;  4YOP A;  1D2Y A;  4DD9 A;  1LJN A;  226L A;  2MEF A;  1G1W A;  2XTH A;  154L A;  1GBW A;  3A95 A;  1B7L A;  4DDC A;  2HUL A;  5LA5 A;  3P4Z A;  2YDG A;  1CNS A;  1QT4 A;  143L A;  1L12 A;  1GAY A;  4AXT A;  4WLX A;  5HMJ A;  1L79 A;  2F4G A;  4R6C A;  4NSG A;  3CB7 A;  5EBH A;  3T6U A;  1L48 A;  1ZWN A;  2DKV A;  1KIQ C;  1GEZ A;  2Q0M X;  2B6X A;  3GUJ A;  4NEB A;  3WXT A;  4Z98 A;  5D5C A;  1L05 A;  1CKD A;  4M4O A;  4TUN A;  1IIZ A;  4DJH A;  1AZF A;  3QNG A;  1LZ5 A;  1D3J A;  1C6H A;  1D9U A;  3WUM A;  4LFP A;  1LHM A;  5LVJ A;  4WL7 A;  3HUQ A;  4UWU A;  129L A;  1SWZ A;  3TXG A;  1VAU A;  4I7J A;  4NHP A;  122L A;  1OV7 A;  4H91 A;  1AKI A;  1OVK A;  4GLV A;  1UC0 A;  5KXK A;  2OU8 A;  4MST A;  2Q9E A;  1B7R A;  1CTW A;  5APD A;  4BAP A;  1L40 A;  1BWI A;  5B06 A;  1G7L C;  3HTD A;  1BWH A;  4Z3M A;  1LMA A;  4N8Z A;  213L A;  5APE A;  3WPJ A;  199L A;  1JIS A;  4QDN A;  4W55 A;  5I4X A;  3DN6 A;  2B6Z A;  3GUM A;  1OP9 B;  191L A;  1IWU A;  1C67 A;  4CFP A;  2D6B A;  2W1X A;  4WM3 A;  3HFM Y;  4EJ4 A;  3QY4 A;  1LWK A;  4HTQ A;  249L A;  3P68 A;  2MEB A;  5I54 A;  1DQJ C;  5JEN B;  3AYQ A;  5LVI A;  3W3E A;  1GE2 A;  2CWI A;  4XJG A;  1C10 A;  2NTG A;  4EOF A;  5F14 A;  1LPY A;  1NDG C;  137L A;  4GRV A;  3CDO A;  1V7T A;  2HU1 A;  1GBZ A;  145L A;  159L A;  1LYO A;  1F6S A;  3G3W A;  5KXS A;  3HH3 A;  1HFX A;  3TXD A;  3TMU A;  2LYO A;  4H8Z A;  3WL2 A;  4Z41 A;  246L A;  2LZM A;  4N9R A;  247L A;  1GEV A;  4DD1 A;  4Z46 A;  4W57 A;  2MED A;  2B75 A;  4W54 A;  4NIJ A;  4LDL A;  4RLM A;  237L A;  3A34 A;  2Z37 A;  4J1A A;  1IC5 Y;  1JQU A;  1L01 A;  1HEP A;  1UIB A;  1NKH A;  3SB5 A;  4H9H A;  1HER A;  4G49 A;  4DWX A;  1B5W A;  1D3F A;  1LYZ A;  5DN5 A;  1OWY A;  3KAM A;  4ZPU A;  3N9A A;  4HP0 A;  222L A;  2A4T A;  3RZ4 A;  2OU0 X;  1C6F A;  1ZVH L;  1GBS A;  5HNC A;  1JTP L;  1B0D A;  4LT2 A;  4MCK A;  4GCE A;  3RZE A;  4J7V A;  4EKS A;  5KXP A;  1L45 A;  2B6W A;  1C6B A;  1CV1 A;  1DYG A;  4LDO A;  2B70 A;  1JJ1 A;  4M6D A;  1KY1 A;  2IFF Y;  3AZ4 A;  4DD0 A;  4LYC A;  1FLQ A;  1LJG A;  4NHT A;  1L69 A;  3TXI A;  1T6V L;  2RBO A;  4BAF A;  4LYO A;  3SB7 A;  1L76 A;  4AQN A;  1LW9 A;  3W6A A;  1CJ7 A;  1DYD A;  4NGY A;  1QQY A;  236L A;  1P64 A;  126L A;  1C62 A;  5AMY A;  138L A;  4H9F A;  1C6N A;  3TXJ A;  3TXF A;  3TXH A;  4G4B A;  1UAC Y;  1LI3 A;  112L A;  3A92 A;  3MGW A;  3OE8 A;  1VDT A;  1L97 A;  2I6Z A;  152L A;  4H8Y A;  1GF4 A;  1GFU A;  1L70 A;  3SN6 R;  1EQ4 A;  195L A;  1LZD A;  2D91 A;  1L34 A;  1L55 A;  1CV0 A;  1INU A;  123L A;  2LZ2 A;  3C8Q A;  134L A;  4WM2 A;  1QTD A;  1FN5 A;  1CKF A;  1L21 A;  4MR1 A;  1C63 A;  4W52 A;  187L A;  1LOZ A;  1JKA A;  4N1E I;  1IC4 Y;  1L25 A;  4YM8 A;  2MEG A;  1IWY A;  2HEB A;  3L2X A;  1C6M A;  4ZEE A;  1IWT A;  2GV0 A;  1LMC A;  4CJ2 A;  4TWS A;  4ETE A;  1C6T A;  1C68 A;  157L A;  1BB7 A;  1P2C C;  1L52 A;  5I14 A;  1QT8 A;  1XJT A;  4HSF A;  1V7S A;  1UBZ A;  4IJ4 A;  1SSW A;  5DLA A;  3GXK A;  1HEM A;  1QTV A;  2H9J A;  1BVX A;  3OJP A;  1J1P Y;  4I7R A;  1CU3 A;  1LGW A;  1L56 A;  1JTT L;  4W59 A;  3DMX A;  4NHI A;  1GF6 A;  1LZY A;  1B7S A;  1LAA A;  5FCP A;  1EQ5 A;  2ZYC A;  3WW5 A;  253L A;  3AB6 A;  1RJC B;  1FDL Y;  196L A;  1B7Q A;  2C8O A;  127L A;  5FEL A;  1K28 A;  2BQC A;  1QDT A;  1I1Z A;  2RAZ X;  3FA0 A;  1L71 A;  2I25 L;  1L31 A;  3A3R X;  3W6C A;  2Z38 A;  250L A;  9LYZ A;  3G3B B;  1PQI A;  3ATO A;  217L A;  1LYJ A;  1EL1 A;  1UIF A;  1CJ6 A;  2O79 A;  5B05 A;  1FLY A;  1IP2 A;  1B9O A;  1HEO A;  1L39 A;  3LZ2 A;  4ARP A;  2OE4 X;  5LZM A;  1L04 A;  3ODU A;  1D3M A;  2O4W A;  170L A;  4LT3 A;  4XJB A;  1JKB A;  1G0L A;  1L02 A;  4I7P A;  1L65 A;  3RU5 A;  1XJU A;  185L A;  1IC7 Y;  5FDJ A;  1L90 A;  4B4E A;  1C6I A;  4YXC A;  5KXN A;  4ARL A;  2HEF A;  261L A;  4XJF A;  4HV2 A;  5ILC A;  4NHQ A;  1QTZ A;  1GFR A;  1NBY C;  3DN1 A;  1YAM A;  1GB2 A;  1LYS A;  4ARM B;  5F9U A;  1T97 A;  1L24 A;  1CU0 A;  2N5Z A;  1L16 A;  1LI2 A;  1P7S A;  5LAF A;  128L A;  4I7S A;  1T6H A;  1P2L A;  212L A;  5M1Y A;  3WUA A;  1GD6 A;  4NGV A;  1YAN A;  5L3H A;  1L51 A;  231L A;  1LSP A;  6LZM A;  2DQD Y;  4I7T A;  3C82 A;  3LZT A;  1ALC A;  1LWG A;  1GFA A;  1VDS A;  4TX7 A;  4B0D A;  3V2W A;  171L A;  1CU6 A;  5DN4 A;  1IWV A;  1C45 A;  1SLY A;  3HT9 A;  1IOT A;  3W6E A;  4YXA C;  4H90 A;  3EXD A;  169L A;  256L A;  1RCM A;  1D2W A;  2D4J A;  3HU9 A;  3AZ7 A;  4PK0 A;  1PQK A;  3G3A B;  3HWL A;  1TDY A;  175L A;  1DI3 A;  1GPQ C;  2ANV A;  4DQJ A;  4ETB A;  2LHM A;  5I4Y A;  4ZFP A;  1PZY A;  144L A;  225L A;  1C64 A;  2BPU A;  4RLN A;  1OVH A;  3SB9 A;  1OUJ A;  1L84 A;  4DD7 A;  1CV3 A;  3C7Y A;  4UWN A;  5II3 A;  4H1P A;  1YIL A;  130L A;  2L78 A;  1LJF A;  2ZNW Y;  1L86 A;  1CV5 A;  4LYZ A;  1B7P A;  1VAT A;  1IP3 A;  2BQN A;  2ZQ4 A;  208L A;  1T8G A;  2C8P A;  2F47 A;  3W6D A;  107L A;  5I4W A;  1OUA A;  2B6Y A;  1JTO L;  2OE9 X;  4PJZ A;  1IY4 A;  1OUB A;  1YKX X;  3F9L A;  4WLT A;  1L22 A;  1L37 A;  5B1F A;  2RBQ A;  4NG8 A;  1G0J A;  219L A;  1L98 A;  1XEJ A;  5HQ1 A;  3HU8 A;  4EKP A;  4PHI A;  1HEQ A;  3EMS A;  1LHJ A;  3A6B Y;  1JJ0 A;  1WQM A;  5C6I A;  1NF5 A;  1LMO A;  1IP4 A;  1LCN A;  3HH4 A;  4LDE A;  1L35 A;  3IJU A;  2G4Q A;  2HTX A;  4KXI A;  2FBD A;  2HUK A;  235L A;  4EKQ A;  1AM7 A;  1WQP A;  4WO9 A;  5KXW A;  1CJ8 A;  4IAT A;  239L A;  1OUI A;  2MEI A;  1GB6 A;  3NY9 A;  118L A;  4NY5 A;  2F30 A;  4WMG A;  4WG7 A;  3C8S A;  4EXM A;  3LZM A;  4G9S A;  4HJV A;  223L A;  1OVJ A;  2WAR A;  1G07 A;  4L41 A;  1OUG A;  3WUN A;  3W6F A;  5KXL A;  1OYU A;  1LJI A;  3WVX A;  1QTB A;  3C83 A;  2H5Z A;  1C66 A;  125L A;  1QTH A;  2DQF C;  1FBI X;  3A93 A;  5KKJ A;  1L09 A;  2B7X A;  1RI8 B;  2FYD A;  5FHW A;  2X0A A;  1DPX A;  3L64 A;  4W53 A;  1B2K A;  1XSF A;  1L68 A;  3WMK A;  4FJR A;  3HBD A;  4GN5 C;  1YAO A;  3A3Q A;  3GUK A;  4XYY A;  1DYF A;  183L A;  1YAP A;  2CUU A;  1P2R A;  1LZ1 A;  1IR9 A;  1SX7 A;  4DDA A;  4GN4 A;  2BLX A;  1GXV 2;  4KL7 A;  2BQH A;  1MLC E;  2Z19 A;  174L A;  2CDS A;  3CT0 A;  1W08 A;  1H87 A;  103L A;  1NMM A;  2EKS C;  1C46 A;  1GAZ A;  1IOR A;  1UID A;  241L A;  1UUZ C;  3AW7 A;  4CHX A;  6LYZ A;  4NSJ A;  1D0K A;  3DKE X;  1LHH A;  4WM6 A;  5T3F A;  1L18 A;  2NTH A;  4XEN A;  4H92 A;  1LLH A;  1JHL A;  3RNX A;  1KS3 A;  1OV5 A;  182L A;  260L A;  4LT1 A;  4PGJ B;  4LZM A;  1W6Z A;  1L66 A;  3W6B A;  230L A;  2G4N A;  255L A;  4NSI A;  1XEK A;  1QS9 A;  4DD2 A;  1JKC A;  4X3B A;  4J0L A;  2DBT A;  5LIO A;  1P3N A;  1QT5 A;  3TXB A;  4N1C C;  1IY3 A;  1HFY A;  139L A;  1L50 A;  1L0K A;  4BAD A;  3F8V A;  1I20 A;  1IP7 A;  2MEA A;  5KJ9 A;  8LYZ A;  1L96 A;  1C69 A;  1C65 A;  4CGE A;  3NY8 A;  1L08 A;  1BQL Y;  3DN3 A;  4DQ5 A;  4YX7 C;  221L A;  4W51 A;  3DN4 A;  4XJI A;  2BQM A;  3D9A C;  232L A;  4H9E A;  4H8X A;  4TTD A;  5APF A;  1L00 A;  1LSM A;  3GXR A;  1XGR C;  4OWC A;  4PPO A;  2OE7 X;  3TMV A;  3WXU A;  4D9Z A;  4ETC A;  1HEW A;  3DNA A;  1L95 A;  3A96 A;  2PC2 A;  1L62 A;  1LSY A;  1LYH A;  1REM A;  2BQG A;  1LJ3 A;  1AT5 A;  5B07 A;  1GFE A;  180L A;  2B72 A;  4GCC A;  2FYC A;  4H9I A;  1UIG A;  4ARQ B;  4W56 A;  1GF7 A;  1T8A A;  1L47 A;  181L A;  2HUB A;  4U3X B;  1ZMY L;  1C6Q A;  3ULR A;  5IDD A;  1GFJ A;  1VED A;  5E9R A;  4GBR B;  161L A;  4XN6 A;  1GWD A;  2CJL A;  2CGI A;  1QSA A;  1XEP A;  1DYB A;  3F6Z A;  1D0L A;  168L A;  4NWE A;  7LZM A;  1IVM A;  1L64 A;  3WPK A;  4PRU A;  1GFV A;  1GHL A;  1G7I C;  193L A;  3AGG G;  1C6J A;  5LVG A;  1DZB X;  2LYM A;  5LVK A;  1J1O Y;  1OUF A;  4NGI A;  3OE6 A;  3GUI A;  3LHM A;  1L36 A;  4N5R A;  4XAD A;  1CVK A;  5LXW A;  4TSC A;  3CSR A;  1LI6 A;  4ET9 A;  1UIA A;  1IR7 A;  3CSQ A;  2H9K A;  3HBE X;  1QUO A;  248L A;  5DL9 A;  1HF4 A;  186L A;  4R0F A;  4LYB A;  5LYM A;  1LSD A;  1L38 A;  1PQJ A;  4LYT A;  2IGC A;  4QEQ A;  1IOS A;  4OWB A;  163L A;  4G4C A;  1LMN A;  1LMT A;  1LZN A;  2HUM A;  4DC4 A;  162L A;  4GCD A;  1BB3 A;  4BS7 A;  5A3Z A;  4II8 A;  4ETA A;  1G0P A;  3EO5 A;  1LGU A;  4ETD A;  4WLD A;  1GF8 A;  146L A;  1MEL L;  1HHL A;  1CJ9 A;  1HMK A;  1L41 A;  4W58 A;  1C6K A;  1KW5 A;  2HEA A;  234L A;  2ZIJ A;  1YL1 X;  1L59 A;  1L43 A;  2XBR A;  228L A;  1LMP A;  1C6D A;  1L93 A;  4HTN A;  2BAA A;  1LYG A;  1L33 A;  2OTY X;  173L A;  1SSY A;  4YEN A;  2BQA A;  1DI4 A;  4H9A A;  1L11 A;  3ZEK A;  1IWX A;  1FLU A;  4B4I A;  2RBR A;  1CUP A;  3PDS A;  5E4P A;  3QAK A;  5F81 A;  1DYA A;  4I7N A;  3RT5 X;  1B5V A;  2W1Y A;  1L13 A;  3HTF A;  1ZUR A;  4GLA A;  2VB1 A;  4C5F A;  4WO6 A;  5B1G A;  1L15 A;  1LZS A;  4OW1 A;  2MEH A;  1LZR A;  3TXK A;  3NYA A;  1CU2 A;  1C6E A;  3A8Z A;  4IAP A;  1C60 A;  1P37 A;  3WPL A;  2FBB A;  1KNI A;  176L A;  3V2Y A;  3CDR A;  1BB4 A;  2OU9 A;  4LT0 A;  5LIN A;  1BWJ A;  1QS5 A;  1IP1 A;  1WQN A;  1L85 A;  1TLA A;  1L80 A;  4C3W A;  153L A;  160L A;  2HED A;  4N0J A;  1LKR A;  1JPO A;  4TSB A;  5KXZ A;  3ZVQ A;  1L14 A;  1QT6 A;  3HTB A;  147L A;  1L42 A;  1GB7 A;  172L A;  1GBX A;  4I7Q A;  3HT6 A;  2YBI A;  2A7D A;  4KPM A;  3AJN A;  4WG1 A;  1JTN A;  1JSE A;  4OWH A;  1QUH A;  1QTC A;  1GB8 A;  2A7F A;  2BQJ A;  4J1B A;  3A91 A;  200L A;  1L75 A;  1LYI A;  1P36 A;  1HSX A;  1L74 A;  1YIK A;  1L77 A;  1LHI A;  1DXJ A;  262L A;  3K2R A;  5KXO A;  1KXX A;  3D4S A;  3JR6 A;  1LZ4 A;  2Z39 A;  1HEN A;  5B59 A;  2O7A A;  2DQJ Y;  1P46 A;  2BQO A;  2BQE A;  2LCB A;  1G06 A;  1LSF A;  3A90 A;  4I7M A;  1LZ6 A;  4OWA A;  4DKL A;  4FDY A;  1L26 A;  4LFX A;  3C80 A;  5FEK A;  158L A;  1JEF A;  5L3I A;  3M3U A;  1VDP A;  2RB1 X;  2DQG Y;  3CT1 A;  2YVB A;  1L49 A;  4RW1 A;  1CKC A;  4HPE A;  1L17 A;  1CU5 A;  3CDV A;  1LZA A;  2DQC Y;  109L A;  192L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...