216LA

Structural basis of alpha-helix propensity at two sites in t4 lysozyme
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
162
structure length
162
Chain Sequence
MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKWELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(o-glycosyl)
molecule keywords T4 LYSOZYME
publication title Structural basis of amino acid alpha helix propensity.
pubmed rcsb
source organism Enterobacteria phage t4
total genus 52
structure length 162
sequence length 162
chains with identical sequence B
ec nomenclature ec 3.2.1.17: Lysozyme.
pdb deposition date 1994-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00959 Phage_lysozyme Phage lysozyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.530.40 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 216lA00
1L49A 164LA 4ARLA 2F32A 1L13A 2RBOA 232LA 1C68A 169LA 3F8VA 4I7SA 107LA 4EKQA 3C7ZA 1D2YA 1QS9A 229LA 1L93A 1QTCA 3GULA 3V2YA 235LA 1L25A 1L60A 1XEPA 1L29A 186LA 1L04A 182LA 1L23A 2HULA 3C82A 1KW5A 4I7KA 1L69A 1L85A 3DN4A 3NY8A 1L76A 1L39A 1PQIA 3CDRA 1L50A 4AQNA 1CV6A 217LA 1L18A 3DN2A 260LA 2OTYX 192LA 1G0PA 1L70A 1L86A 246LA 3LZMA 1ZWNA 3DN1A 1DYAA 3HTGA 1K28A 1L89A 1P5CA 3SB6A 6LZMA 1L35A 239LA 3OE9A 1LYDA 2B6TA 3GUOA 3NY9A 1L59A 187LA 1L97A 221LA 108LA 1L74A 3C8SA 1P64A 4ZPUA 3L64A 237LA 247LA 2RBQA 200LA 2ANXA 2Q9DA 146LA 245LA 119LA 1CTWA 1LYFA 126LA 3HDFA 3HTBA 127LA 1L75A 4I7LA 148LE 1D3FA 1L82A 238LA 2RBRA 1L79A 1L0JA 1L63A 1QT3A 226LA 2ANVA 3DNAA 1C60A 5I14A 1JTNA 201LA 261LA 1QUOA 1L96A 1L20A 1DYFA 1OVHA 1KW7A 248LA 1L27A 1L02A 1L52A 4PJZA 1LGUA 2NTGA 1KY1A 3HUKA 3DMZA 4EKPA 4S0WA 4EKSA 3JR6A 1L98A 1L14A 171LA 1CV4A 1T8GA 1L90A 4GBRB 111LA 3HH3A 2OE7X 4LDOA 125LA 120LA 1D3MA 1L67A 1C6BA 118LA 183LA 1NHBA 1CV5A 3C8RA 137LA 3HUAA 1L06A 4W54A 4W56A 114LA 3G3WA 190LA 4EJ4A 1C62A 233LA 1LPYA 172LA 205LA 1DYEA 1DYGA 1G0JA 4DJHA 158LA 2OE4X 3DMXA 1C69A 1L77A 1SWZA 2B6YA 210LA 230LA 1SSWA 195LA 241LA 3HWLA 2B6WA 1KY0A 1OVKA 1EPYA 3CDTA 1C6EA 3G3XA 2OE9X 223LA 180LA 3HT8A 3DN0A 231LA 188LA 242LA 3ODUA 3PBLA 1CV1A 3HT7A 1QT4A 1KS3A 161LA 3EMLA 1P56A 1T8FA 1L42A 2LC9A 2RAYX 3SB5A 170LA 1P6YA 2RBPA 1LI6A 216LA 1L31A 1LWGA 4I7PA 1QUHA 1TLAA 102LA 1CU0A 168LA 1PQJA 253LA 2RB0X 3F9LA 4YX7C 3OE8A 144LA 1CU3A 1SWYA 1QTZA 3GUJA 3CDVA 162LA 3C8QA 2B7XA 2O79A 234LA 104LA 1L11A 1QT7A 113LA 1L99A 3FADA 4ARQB 1L26A 115LA 4I7JA 1LGXA 1QT6A 4DKLA 3HT6A 3HU8A 1L30A 3L2XA 1L53A 1C65A 1LYJA 4I7MA 1DYDA 1P36A 1C63A 1QTBA 2F47A 1C6NA 3C80A 1OV5A 1LYIA 1CX7A 3SB9A 249LA 1G1WA 220LA 3OE6A 1C6QA 199LA 1G0QA 1L01A 4ARJA 138LA 1LI3A 227LA 3HH6A 131LA 2O4WA 198LA 1L56A 1L62A 1L57A 1D2WA 1XJUA 1L03A 1L80A 214LA 1L19A 1CV0A 3FA0A 250LA 5LZMA 3HDEA 197LA 122LA 1QS5A 3C7WA 1G07A 143LA 1C67A 178LA 4W59A 3FI5A 128LA 1C6IA 4LDEA 4ARMB 1L47A 2LCBA 1D9WA 3HH5A 2OU8A 2CUUA 3DMVA 251LA 1QTHA 2L78A 1G06A 159LA 1C6PA 224LA 3DKEX 2B70A 1LLHA 1L40A 219LA 259LA 2RAZX 2F2QA 4LDLA 4ARQA 1CU5A 1LW9A 1C6CA 1G0GA 1L88A 1L21A 3CDOA 1L45A 1L94A 4I7QA 1L61A 1L34A 1D3JA 2O7AA 2RB2X 4GRVA 3HTDA 1SX2A 1L22A 109LA 2B74A 3HTFA 3VW7A 1L05A 3D4SA 2B6XA 1L73A 1CU6A 4EKRA 3OE0A 1ZYTA 1XJTA 1C6GA 1T8AA 4OO9A 1P3NA 252LA 1QUGA 1QT5A 1C64A 1I6SA 173LA 4YXAC 3NYAA 3SBBC 243LA 1PQKA 177LA 123LA 1C6AA 1L84A 2RB1X 1L17A 191LA 218LA 147LA 1L46A 2OTZX 1L64A 1L81A 1L12A 1C6HA 1OWZA 157LA 2RH1A 1KNIA 222LA 1DYCA 3SN6R 1G0MA 1LYHA 1SX7A 1L55A 175LA 1L09A 3RZEA 1L65A 3DN3A 1L83A 1LGWA 3DN6A 1OVJA 4I7TA 1CUPA 228LA 3G3VA 1PQDA 1L44A 1C6MA 103LA 4W57A 1QUDA 1P7SA 2B6ZA 4LZMA 189LA 2B72A 7LZMA 4YXCA 236LA 1QSQA 3GUIA 1L91A 1L38A 2QB0B 1L41A 256LA 1ZURA 4W53A 140LA 4I7NA 4I7RA 130LA 4W52A 1C61A 3PDSA 206LA 184LA 1CUQA 1L54A 1L72A 167LA 3K2RA 254LA 3CDQA 149LA 1L66A 1SSYA 139LA 225LA 1L33A 1L28A 1P2RA 4DAJA 2OU0X 2RBNA 1L32A 3HT9A 2NTHA 1L87A 213LA 215LA 163LA 1QTDA 4W51A 1CX6A 257LA 1LWKA 3RUNA 1L43A 2OEAX 1L08A 1L51A 110LA 174LA 1L68A 2LZMA 209LA 3UONA 4EXMA 2RBSA 1T6HA 1P46A 4E97A 1L24A 1L36A 1C6JA 2B75A 3GUKA 2HUMA 1PQOA 3C83A 2HUKA 1WTHA 129LA 1LI2A 1OYUA 1P2LA 3DN8A 1L92A 3SBAA 1B6IA 3HH4A 4EPIA 1OWYA 151LA 141LA 1L15A 185LA 240LA 112LA 150LA 1C6DA 1QT8A 4IAPA 1CVKA 1OV7A 262LA 1L95A 152LA 4ARPA 2Q9EA 1C6FA 1C66A 1L0KA 3GUNA 1L37A 1P37A 4W58A 4W55A 258LA 255LA 142LA 3SB8A 244LA 211LA 4I7OA 1G0LA 3V2WA 1L71A 1D3NA 2B73A 2Z6BA 1L58A 1DYBA 1L16A 3SB7A 2QARC 1C6LA 145LA 4PK0A 3GUMA 1C6TA 2OU9A 1JTMA 2IGCA 1LYEA 1T97A 4EPFA 1LYGA 1PQMA 3GUPA 1G1VA 1L00A 2A4TA 1QSBA 3C7YA 3QAKA 156LA 3C81A 1QTVA 1C6KA 3HUQA 155LA 165LA 1CU2A 1CV3A 4ARMA 1JQUA 4K5YA 212LA 1L10A 176LA 181LA 1L07A 160LA 3HU9A 196LA 166LA 1G0KA 1L48A
chains in the Genus database with same CATH superfamily
3TMWA 164LA 1CJ8A 2F32A 1JHLA 4N1CC 4NY5A 1C68A 3F8VA 4EKQA 107LA 5LYTA 1LHHA 1QTCA 1L25A 1L60A 1GXV2 182LA 1L23A 4NGJA 1L85A 3NY8A 1OUGA 2BQEA 4UWNA 4AQNA 3TXJA 1OUIA 1LJ3A 1CV6A 5HQ1A 3DN2A 1G0PA 1HERA 4NHTA 4ETEA 246LA 4ZEEA 4CJ2A 1GF9A 3DN1A 1YL1X 1O23A 1WTMA 3HTGA 1GFTA 1LJNA 3WH1A 1OUFA 1CJ9A 1GPQC 3GUOA 1NBYC 1LZ6A 1L59A 1LHLA 134LA 1LOZA 3L64A 2DKVA 1SQ2L 200LA 2Q9DA 1TCYA 1B0DA 1CTWA 4TTDA 126LA 1GBSA 1L75A 2Y8PA 148LE 4WL7A 1L82A 4ZIXA 1CNSA 1L63A 1IORA 3DNAA 1NF5A 4PHIA 5I14A 3N9AA 3M18B 261LA 1LYOA 1BWIA 3HBEX 4RW1A 1L27A 4ET8A 4GCCA 3FE0A 4EKPA 2BLYA 4S0WA 1LSFA 1IOSA 1YAPA 1WQRA 111LA 3WPJA 6LYZA 3HH3A 4LDOA 1D3MA 183LA 3C8RA 1IP6A 4A7DA 5C6JA 4M6DA 4NWHA 1XGRC 3HFMY 4EJ4A 4LGKA 1WQMA 4TSCA 4B4JA 3TMXA 5B59A 5KXSA 2W1LA 2XJWA 3RU5A 205LA 1DYGA 4YF2A 1HNLA 2OE4X 4OOOA 2W1XA 4HPIA 1GDWA 1AZFA 2B6YA 4HP0A 3ZEKA 1J1PY 1QDRA 2B6WA 1J1OY 1UICA 5KY1A 1EPYA 3CDTA 3G3XA 2OE9X 1UACY 180LA 3VWOA 242LA 5LIOA 1LZGA 1UIEA 1CV1A 1CJ7A 2N5ZA 1FKQA 4CFPA 2BQMA 1T8FA 2LC9A 1ALCA 3GXKA 1Z55A 1JTOL 1OP9B 2RBPA 3A67Y 3GXRA 2BPUA 1L31A 4FJRA 1DKKA 4IASA 1KIQC 253LA 2VB1A 144LA 1JTTL 1JITA 1LSMA 2W1YA 1AM7A 5D5CA 1D6PA 1QTZA 1YAMA 2ZYPA 4NFVA 3AGIA 1VDPA 2F30A 113LA 115LA 1NMMA 4H9EA 1GE1A 2LYOA 3L2XA 1L53A 1LYJA 1GXXA 1QTBA 1C45A 2YBHA 1OV5A 1CX7A 249LA 1FLWA 3OE6A 1C6QA 3WUMA 4ARJA 3HH6A 1JIYA 2FYDA 1G7IC 1L56A 1L62A 1L57A 214LA 4EMNA 1TEWA 1MELL 4N8ZA 250LA 4H94A 5LZMA 197LA 2XBSA 1QS5A 4TSBA 3C7WA 1HMLA 128LA 4WG1A 1VFBC 3HH5A 1CKCA 251LA 4B4EA 2L78A 1G06A 1QTKA 3WUAA 3DKEX 2B70A 1DPWA 1LLHA 4E3UA 1L40A 2PC2A 2F4GA 4NGYA 4MSTA 2F2QA 4LDLA 1LZCA 3CDOA 3WXUA 4ETDA 5IHGA 4IATA 2O7AA 4GRVA 4H92A 1NDMC 3HTDA 4G9SA 3A34A 1SX2A 5APCA 3WXTA 109LA 3HTFA 5FEKA 1QIOA 3LYOA 1GWDA 1L05A 2B6XA 4EKRA 3IJVA 1WVVA 3W6FA 2XQOA 1GEVA 4I8SA 1T8AA 4DWXA 2DBTA 2ZWBA 4FDYA 4HSFA 3SBBC 5A3EA 4B0DA 2OTZX 1LSPA 4DD0A 4TUNA 1C6HA 5J7CA 157LA 2RH1A 2MEEA 175LA 4XJIA 4NGKA 3DN6A 5I4YA 3HBDA 4LYOA 1B5UA 4BADA 1OUDA 1P7SA 1NHEA 3AW7A 1OUHA 3GUIA 1SLYA 1L38A 1LHIA 2QB0B 4HJVA 1L41A 5B05A 140LA 1WVUA 2BQHA 1C08C 3AZ5A 4W52A 1C43A 1IWTA 1L54A 2G4QA 1UIAA 149LA 1P2RA 4DAJA 1GD6A 1IVMA 1L32A 5K7OA 2NTHA 4ZFPA 213LA 4MR1A 1IWXA 1CX6A 1D0MA 1LHMA 1HFZA 3RUNA 1HEPA 4HJZA 110LA 5LA5A 2Z39A 4NIJA 4WMGA 3WYHA 3ATNA 1OQMA 2HECA 1FDLY 2B75A 5LYMA 3C83A 2HUKA 129LA 3DN8A 1LI2A 1L92A 2HU3A 2D4JA 3HH4A 1IP2A 1DZBX 2YVBA 4LT2A 1LKRA 1GBZA 1B7RA 1OV7A 2F4AA 1IX0A 2NWDX 1GAZA 2Q9EA 1C6FA 4L41A 4UWVA 1P37A 5DM9A 5C6LA 142LA 1QSAA 1GBYA 4I7OA 1B7PA 5KXLA 4YOPA 4BS7A 1DQJC 3SB7A 1LYSA 1C6LA 4PK0A 1G7LC 3GUMA 1LYEA 4EPFA 1KIRC 1GF0A 1L00A 1QSBA 3QAKA 156LA 1C6KA 2EQLA 4ARMA 2CWIA 1L10A 176LA 5APFA 3W6AA 4PGJB 1GAYA 166LA 5I53A 2RBOA 1B7OA 232LA 1GHLA 4OW1A 1PZYA 169LA 1UIGA 4OWEA 2YBNA 2D91A 3GULA 1L29A 186LA 3HBHA 1YQVY 3C82A 1L69A 3CT5A 3DN4A 5KJ9A 1LSCA 1L76A 1L39A 3CDRA 7LYZA 2WARA 3SP3A 4J1BA 1QUSA 1DYAA 1L89A 1T3PA 5I4WA 239LA 3OE9A 2B6TA 2W1MA 3P65A 3NY9A 1L97A 221LA 4N9RA 3TXIA 4ZPUA 4MCKA 153LA 4XADA 2ANXA 245LA 1BB6A 1IOQA 4XENA 3CSRA 2FBBA 3RW8A 127LA 1HELA 1D3FA 2RBRA 1L79A 1GB0A 1DXJA 4WLDA 3ZVQA 2MEBA 2MEFA 1GB9A 4RDSA 1L52A 3AJNA 3CT0A 2NTGA 3HUKA 3DMZA 3AYQA 1G7JC 4NG8A 3JR6A 4H9HA 1L98A 1KXWA 5IDDA 1CV4A 2HEDA 1L90A 4GBRB 1EQ4A 125LA 4II8A 2ZQ3A 2I26L 1IP4A 3B0KA 1V7TA 3B72A 1OUEA 1AT6A 4U3XB 3G3WA 1GF5A 3LHMA 1HMKA 1LSZA 1C10A 172LA 2B5ZA 1JJ0A 1G0JA 1D0LA 1BQLY 158LA 1B7MA 1UA6Y 1GF4A 210LA 1SSWA 4N5RA 241LA 1IWWA 5B1FA 2EPEA 1C6EA 1RI8B 3HT8A 1G7HC 3DN0A 1B5YA 3ODUA 3PBLA 1QT4A 1KS3A 1REYA 1WQQA 161LA 3EMLA 5HLLA 1FKVA 1HEMA 4RLNA 1LYZA 170LA 1P6YA 1LI6A 1CKHA 1LWGA 1UCOA 1YL0X 2RB0X 1LZ8A 3OE8A 3IJUA 5L3HA 1LZAA 1NDGC 1LKSA 1L11A 1LMOA 2BQGA 4B1AA 3FADA 8LYZA 4ARQB 3WW5A 1LGXA 1BHZA 4DKLA 4XJHA 1IP5A 4I7MA 1P36A 154LA 4H91A 1C63A 1GBOA 1C6NA 1LYIA 2YBJA 1G1WA 220LA 3WU9A 5LXWA 1EQEA 1L01A 5KXZA 131LA 2O4WA 198LA 4DDAA 4XJFA 1B9OA 1JISA 4WO6A 1L19A 1CV0A 1GF3A 3HDEA 122LA 5ILCA 143LA 1XEJA 1F6SA 178LA 4W59A 4KXIA 3FI5A 4NGLA 4ARMB 1L47A 5FELA 5F14A 159LA 1HSWA 2BQNA 219LA 259LA 2RAZX 1ZVHL 5C6IA 1CU5A 1LW9A 1C6CA 4XYYA 2DQEY 1L21A 1L45A 4I7QA 5LINA 1QTEA 1L34A 2RB2X 3WVXA 4H9CA 2B74A 4NHSA 4HPEA 1IR9A 1CU6A 3J6KA 1ZYTA 1C6GA 1P3NA 1QT5A 1I6SA 1PQKA 2RB1X 1C6AA 5LVJA 218LA 147LA 1L64A 1L12A 1OWZA 222LA 1G0MA 1L55A 1L09A 1WQOA 3RZEA 1L83A 3F6ZA 1OVJA 4NEBA 2RSCA 3G3AB 1UIDA 4W57A 2B6ZA 1LJFA 2B72A 5HNCA 1WQPA 3ZVQB 2Z18A 1I1ZA 2C8PA 1B5ZA 1JJ1A 3AZ7A 1D9UA 130LA 4I7RA 1C61A 4TX7A 1GE0A 4CHXA 1CUQA 2ZIJA 4G49A 1L72A 3AGHA 2BQAA 2YBLA 1HEWA 254LA 5KKIA 4DD9A 139LA 1AT5A 225LA 1UIBA 1FBIX 2OU0X 193LA 1V7SA 4DC4A 3A90A 1NBZC 3A91A 3RNXA 4NG1A 4NHQA 2YSSC 5D5FA 209LA 4WM3A 2YBIA 2HEEA 1BB4A 3D3DA 1GFVA 1L24A 2HUMA 1XEKA 1WTHA 2Z38A 4EPIA 3BKVA 112LA 1JJ3A 1C6DA 1JSEA 3QNGA 4IAPA 1CVKA 262LA 1H6MA 1L95A 4ARPA 4OOTA 4H93A 1INUA 1B2KA 1LSAA 1YIKA 258LA 1C46A 1LAAA 4WLTA 3D9AC 1F10A 1G0LA 4IJ4A 1D3NA 1LMNA 1DYBA 4GLVA 1JSFA 1GFJA 145LA 1LJJA 5LVHA 1B5XA 1WQNA 3TXFA 1LYGA 1IO5A 1I56A 2A4TA 2ZNWY 1GFHA 1HEQA 1OUAA 3C81A 1IR8A 1LZTA 3WULA 1LZSA 1GE2A 4K5YA 1YILA 1QUTA 181LA 1L07A 4HTQA 160LA 3HU9A 4X3BA 1L48A 1B7LA 4GN5C 1BWHA 1L13A 4ET9A 4I7SA 1LSNA 1D2YA 1QS9A 1L93A 1FN5A 235LA 4Z46A 4WO9A 2IFFY 4PRQA 1HC0A 1XEIA 2ZQ4A 2F2NA 4B49A 217LA 1IWUA 260LA 2OTYX 3B6LA 1L70A 1L86A 1LZ5A 1UBZA 4QDNA 5LYZA 5ILFA 1P5CA 5KXRA 1IY3A 3SB6A 6LZMA 1L35A 2HU1A 4HJYA 3OK0A 2Q0MX 4NSIA 4LYCA 108LA 1L74A 3C8SA 1P64A 5E9RA 1FLUA 2RBQA 3TXKA 3EO5A 4DD2A 146LA 1XFPL 1RFPA 3P68A 4I7LA 238LA 1BB5A 226LA 1IC4Y 5DL9A 1C60A 1GB5A 1JEFA 1L96A 1CKFA 2G4NA 1L20A 1DYFA 1KW7A 4PJZA 1KY1A 4AXTA 1FLQA 2ZILA 3N9EA 3AB6A 4WOAA 3TMUA 1WTNA 1L14A 3AZ6A 4LT1A 2H9JA 1T8GA 1UIFA 1LJ4A 2OE7X 120LA 1C6BA 118LA 1GB6A 1RE2A 1P2CC 4H90A 1RCMA 3HUAA 1LSYA 1IC7Y 4W56A 3CT1A 114LA 3WMKA 190LA 2BQCA 1LCNA 4BAPA 1GF6A 3RT5X 1OUJA 1LPYA 4OWCA 4Z3MA 1GB7A 4DJHA 4DYGA 1L77A 1SWZA 4GLAA 1FLYA 2LZTA 4GCEA 5E4PA 1TBYA 1KY0A 1OVKA 5FDJA 1UC0A 1VEDA 1B5WA 3P64A 3A93A 208LA 4YM8A 1A2YC 1VAUA 2DQHY 4PJ2C 1H87A 5LAGA 5KXOA 1IC5Y 4DQJA 1YAOA 3T36A 4AGAA 216LA 4J0LA 1GB8A 1TAYA 4C5FA 1IWVA 4DT3A 1TLAA 2BLXA 4H8YA 2MEAA 4WG7A 2Z19A 1B5VA 2MECA 4Z41A 1YANA 3N9CA 5II3A 3GUJA 1LZNA 2BQLA 3TMVA 2B7XA 2O79A 3J4GA 2HEFA 234LA 104LA 1IWYA 3W3EA 3CQLA 1IOTA 1GFRA 4J7VA 1L30A 1C65A 5KXPA 1ZV5L 1BVKC 4WM6A 4LFPA 1GDXA 4LYBA 3SB9A 199LA 4WM5A 1HF4A 4B4IA 138LA 1KXXA 1LI3A 2LYZA 3AZ4A 1L03A 1IR7A 1LTMA 1BWJA 1LJKA 1QDTA 4R6CA 4QGZA 2XBRA 4WM4A 2BQKA 1G07A 2DQAA 1LMTA 4KT3A 4LDEA 1D9WA 5LAFA 2CUUA 1VATA 2DQCY 4YEMA 2FBDA 3WL2A 3IWRA 1LMQA 5LVKA 1LZEA 1YKXX 3AW6A 4DDCA 4CFOA 1VDTA 1D3JA 4RLMA 1F0WA 3WUNA 1L22A 1VDSA 3D4SA 4H9FA 1L73A 1IWZA 4G4BA 252LA 2CDSA 1C64A 173LA 3A3QA 3LN2A 1L84A 1L17A 191LA 3WU7A 1L46A 1GFEA 2LYMA 1L81A 1KNIA 5JENB 3SN6R 1LYHA 3A94A 2BQJA 1L65A 1CUPA 228LA 3G3VA 1L44A 1LZ4A 4NSGA 4R0FA 4LYZA 1QUDA 4LZMA 189LA 236LA 4DDBA 1L91A 5KXMA 4NGIA 133LA 207LA 4H9BA 2HEAA 256LA 1ZURA 2BQIA 1JTPL 2LHMA 4H9IA 132LA 1LZBA 4I7NA 1D6QA 184LA 1I20A 2HUBA 2DQGY 1SSYA 2IHLA 1L28A 1AKIA 2RBNA 3HT9A 1HEOA 5KXTA 1LJIA 215LA 1QTDA 4KL7A 1LWKA 1LMPA 1L51A 4HTKA 3WPLA 1IP1A 3A6BY 3AGGG 3BKHA 1RJCB 1L68A 3UONA 4H9AA 5IELA 2RBSA 1T6HA 5DN5A 1P46A 1DI4A 1W6ZA 4E97A 1L36A 1C6JA 3WU8A 1JPOA 2DQJY 1XGTC 3GUKA 3A92A 5LA8A 3WVYA 1DI3A 1LZYA 151LA 4NHPA 1L15A 185LA 3QY4A 4G4CA 2X0AA 3KAMA 4XN6A 152LA 3LYTA 1QSWA 1LSEA 1C66A 1TDYA 1L37A 3T6UA 1IOCA 1UUZC 3P66A 1N4FA 255LA 2CGIA 4NSJA 3SB8A 3ATOA 244LA 211LA 1LHKA 4LT0A 3V2WA 1L71A 2B73A 1L58A 1L16A 4NSHA 4DD7A 1YROA 1C6TA 2OU9A 5AMYA 3EXDA 5T3FA 5DN4A 4DD1A 3LYZA 1REZA 1PQMA 3GUPA 3WPKA 2YBMA 5FHWA 1B7NA 3C7YA 5I4XA 1QTVA 3HUQA 155LA 3A6CY 1HENA 1CU2A 1CV3A 1YAQA 1JQUA 2DQIY 212LA 1LZ9A 4WM1A 4HV2A 1L49A 4ARLA 1GBWA 4XJDA 4DQ7A 2C8OA 3C7ZA 229LA 3V2YA 1LZDA 1XEPA 1L04A 1KXYA 3QE8A 5HNLA 2HULA 1KW5A 4I7KA 1PQIA 1CKDA 1L50A 4HTNA 4LFXA 1L18A 2DQDY 5HMJA 4P2EA 3W6BA 192LA 2MEDA 1LJHA 3LZMA 4NWEA 1ZWNA 2MEHA 1GB2A 1K28A 4C3WA 1LYDA 2XTHA 1LZRA 187LA 1MLCE 5F9UA 237LA 1EQ5A 247LA 2EKSC 2BQOA 119LA 1LPIA 1LYFA 3HDFA 3HTBA 2I6ZA 1L0JA 1QT3A 3A8ZA 2ANVA 4OWHA 1GFKA 3A96A 1HFYA 1JTNA 201LA 4DD3A 1QUOA 3LYMA 3CSZA 9LYZA 1OVHA 248LA 1L02A 4LYMA 135LA 1W08A 2EIZC 1D0KA 1LGUA 4GCDA 5FSTA 3RZ4A 1XGUC 1OUBA 4W94A 5KXYA 1NWGA 4GCBA 1GFGA 4EKSA 5B06A 171LA 4M4OA 2DQFC 1GBXA 3B0IA 3K3TA 1L67A 3TXEA 1LMCA 1NHBA 1CV5A 5KKJA 1IEEA 137LA 3TXDA 1L06A 5KXXA 4W54A 2BQBA 1JUGA 4WL6A 1YKYX 3M3UA 1C62A 233LA 2A7FA 4GN3A 3W6DA 4YEOA 4ANRA 1DYEA 3DMXA 1C69A 4LYTA 1LSGA 230LA 195LA 2FYCA 5LVIA 3HWLA 1JKDA 2HEBA 3LZ2A 1GFAA 223LA 194LA 1J1XY 5LVGA 231LA 188LA 1UIHA 3HT7A 3A95A 5B07A 3W6EA 2ZYCA 1P56A 3W6CA 4H8ZA 1L42A 2RAYX 3SB5A 4WM2A 1JKAA 2Z12A 4QY9A 1XGQC 4I7PA 1ZVYB 1QUHA 3G3BB 102LA 4NGWA 6LYTA 4EOFA 1NKHA 1CU0A 168LA 1PQJA 4YX7C 3F9LA 4RW2A 1CU3A 1SWYA 4YENA 4OWAA 1LMAA 1GFUA 4PPOA 5KXWA 3CDVA 162LA 3C8QA 1EL1A 4DQ5A 3EMSA 1OUCA 1QT7A 1L99A 4KPMA 4NGOA 1L26A 1NQIA 4I7JA 1QT6A 2Z2FA 4H8XA 1E8LA 1CKGA 3HT6A 3HU8A 2ZNXY 2Z37A 1DYDA 2CJLA 2F47A 4ETBA 3C80A 1QQYA 2H9KA 3LZTA 1G0QA 3MGWA 227LA 4UWUA 3TXHA 5F16A 1D2WA 1XJUA 3CSQA 1L80A 2MEGA 3ULRA 1B7SA 3FA0A 5F81A 4ETCA 5EBHA 1GF8A 1C67A 1C6IA 5HMVA 2LCBA 2OU8A 1BB7A 3DMVA 4ML7A 2G4PA 1IP3A 1QTHA 1C6PA 1LYYA 224LA 1YKZX 4GCFA 4ARQA 5F9XA 1G0GA 1L88A 1L94A 1BVXA 1HSXA 2HTXA 1L61A 5KXNA 5L9JA 1VDQA 1C7PA 1LJGA 3VW7A 4QEQA 5APEA 3OE0A 2AUBA 1XJTA 1REMA 4I0CA 4OO9A 5DLAA 1QUGA 1BGIA 1LJEA 4YXAC 3NYAA 243LA 177LA 123LA 4NGZA 1F6RA 1LSDA 1REXA 2A7DA 1XGPC 4G4HA 2YDGA 4D9ZA 1HHLA 1DYCA 1SX7A 1GF7A 5M1YA 4N1EI 3DN3A 1LGWA 1JWRA 3TXGA 1DPXA 4ETAA 4I7TA 4NHIA 1PQDA 4W96A 2D4KA 1C6MA 103LA 7LZMA 4GN4A 4YXCA 1QSQA 1LZ1A 2H5ZA 1JKCA 2BAAA 5FCPA 4TWSA 4W53A 2ZIKA 2D4IA 5L3IA 2Z2EA 1CJ6A 3PDSA 1LHJA 206LA 1HFXA 1LSBA 4WLXA 5I5QA 3B0OA 1G7MC 4CGEA 167LA 3K2RA 3CDQA 1GE3A 1GB3A 1L66A 4LT3A 1L33A 1T6VL 1XSFA 4H1PA 1L87A 2GV0A 4LZTA 163LA 4O34A 4W51A 3TXBA 257LA 4BAFA 1L43A 2LZ2A 2OEAX 1L08A 174LA 3FI7A 2LZMA 4EXMA 1A4VA 4HV1A 4N0JA 5APDA 1PQOA 2BQDA 3OJPA 1OYUA 1P2LA 3SBAA 1B6IA 1OWYA 141LA 240LA 150LA 1QT8A 1GEZA 1JKBA 3WW6A 1GE4A 1L0KA 1IY4A 4Z98A 3GUNA 5A3ZA 4W58A 4W55A 1KIPC 4XJBA 2I25L 1PS5A 1BB3A 3CB7A 3EBAB 1IIZA 2BQFA 2MEIA 1IP7A 3A3RX 4XJGA 3P4ZA 4OWBA 2Z6BA 2QARC 4PRUA 1JTMA 2IGCA 5KXKA 1T97A 3E3DA 1B7QA 4WLYA 1G1VA 1DKJA 4NGVA 2D6BA 5I54A 165LA 1ZMYL 5B1GA 196LA 1G0KA 1DI5A 4J1AA
chains in the Genus database with same CATH topology
3TMWA 164LA 1CJ8A 2F32A 1JHLA 4N1CC 4NY5A 1C68A 3F8VA 4EKQA 107LA 5LYTA 1LHHA 1QTCA 1L25A 1L60A 1GXV2 182LA 1L23A 4NGJA 1L85A 3NY8A 1OUGA 2BQEA 4UWNA 4AQNA 3TXJA 1OUIA 1LJ3A 1CV6A 5HQ1A 3DN2A 1G0PA 1HERA 4NHTA 4ETEA 246LA 4ZEEA 4CJ2A 1GF9A 3DN1A 1YL1X 1O23A 1WTMA 3HTGA 1GFTA 1LJNA 3WH1A 1OUFA 1CJ9A 1GPQC 3GUOA 1NBYC 1LZ6A 1L59A 1LHLA 134LA 1LOZA 3L64A 2DKVA 1SQ2L 200LA 2Q9DA 1TCYA 1B0DA 1CTWA 4TTDA 126LA 1GBSA 1L75A 2Y8PA 148LE 4WL7A 1L82A 4ZIXA 1CNSA 1L63A 1IORA 3DNAA 1NF5A 4PHIA 5I14A 3N9AA 3M18B 261LA 1LYOA 1BWIA 3HBEX 4RW1A 1L27A 4ET8A 4GCCA 3FE0A 4EKPA 2BLYA 4S0WA 1LSFA 1IOSA 1YAPA 1WQRA 111LA 3WPJA 6LYZA 3HH3A 4LDOA 1D3MA 183LA 3C8RA 1IP6A 4A7DA 5C6JA 4M6DA 4NWHA 1XGRC 3HFMY 4EJ4A 4LGKA 1WQMA 4TSCA 4B4JA 3TMXA 5B59A 5KXSA 2W1LA 2XJWA 3RU5A 205LA 1DYGA 4YF2A 1HNLA 2OE4X 4OOOA 2W1XA 4HPIA 1GDWA 1AZFA 2B6YA 4HP0A 3ZEKA 1J1PY 1QDRA 2B6WA 1J1OY 1UICA 5KY1A 1EPYA 3CDTA 3G3XA 2OE9X 1UACY 180LA 3VWOA 242LA 5LIOA 1LZGA 1UIEA 1CV1A 1CJ7A 2N5ZA 1FKQA 4CFPA 2BQMA 1T8FA 2LC9A 1ALCA 3GXKA 1Z55A 1JTOL 1OP9B 2RBPA 3A67Y 3GXRA 2BPUA 1L31A 4FJRA 1DKKA 4IASA 1KIQC 253LA 2VB1A 144LA 1JTTL 1JITA 1LSMA 2W1YA 1AM7A 5D5CA 1D6PA 1QTZA 1YAMA 2ZYPA 4NFVA 3AGIA 1VDPA 2F30A 113LA 115LA 1NMMA 4H9EA 1GE1A 2LYOA 3L2XA 1L53A 1LYJA 1GXXA 1QTBA 1C45A 2YBHA 1OV5A 1CX7A 249LA 1FLWA 3OE6A 1C6QA 3WUMA 4ARJA 3HH6A 1JIYA 2FYDA 1G7IC 1L56A 1L62A 1L57A 214LA 4EMNA 1TEWA 1MELL 4N8ZA 250LA 4H94A 5LZMA 197LA 2XBSA 1QS5A 4TSBA 3C7WA 1HMLA 128LA 4WG1A 1VFBC 3HH5A 1CKCA 251LA 4B4EA 2L78A 1G06A 1QTKA 3WUAA 3DKEX 2B70A 1DPWA 1LLHA 4E3UA 1L40A 2PC2A 2F4GA 4NGYA 4MSTA 2F2QA 4LDLA 1LZCA 3CDOA 3WXUA 4ETDA 5IHGA 4IATA 2O7AA 4GRVA 4H92A 1NDMC 3HTDA 4G9SA 3A34A 1SX2A 5APCA 3WXTA 109LA 3HTFA 5FEKA 1QIOA 3LYOA 1GWDA 1L05A 2B6XA 4EKRA 3IJVA 1WVVA 3W6FA 2XQOA 1GEVA 4I8SA 1T8AA 4DWXA 2DBTA 2ZWBA 4FDYA 4HSFA 3SBBC 5A3EA 4B0DA 2OTZX 1LSPA 4DD0A 4TUNA 1C6HA 5J7CA 157LA 2RH1A 2MEEA 175LA 4XJIA 4NGKA 3DN6A 5I4YA 3HBDA 4LYOA 1B5UA 4BADA 1OUDA 1P7SA 1NHEA 3AW7A 1OUHA 3GUIA 1SLYA 1L38A 1LHIA 2QB0B 4HJVA 1L41A 5B05A 140LA 1WVUA 2BQHA 1C08C 3AZ5A 4W52A 1C43A 1IWTA 1L54A 2G4QA 1UIAA 149LA 1P2RA 4DAJA 1GD6A 1IVMA 1L32A 5K7OA 2NTHA 4ZFPA 213LA 4MR1A 1IWXA 1CX6A 1D0MA 1LHMA 1HFZA 3RUNA 1HEPA 4HJZA 110LA 5LA5A 2Z39A 4NIJA 4WMGA 3WYHA 3ATNA 1OQMA 2HECA 1FDLY 2B75A 5LYMA 3C83A 2HUKA 129LA 3DN8A 1LI2A 1L92A 2HU3A 2D4JA 3HH4A 1IP2A 1DZBX 2YVBA 4LT2A 1LKRA 1GBZA 1B7RA 1OV7A 2F4AA 1IX0A 2NWDX 1GAZA 2Q9EA 1C6FA 4L41A 4UWVA 1P37A 5DM9A 5C6LA 142LA 1QSAA 1GBYA 4I7OA 1B7PA 5KXLA 4YOPA 4BS7A 1DQJC 3SB7A 1LYSA 1C6LA 4PK0A 1G7LC 3GUMA 1LYEA 4EPFA 1KIRC 1GF0A 1L00A 1QSBA 3QAKA 156LA 1C6KA 2EQLA 4ARMA 2CWIA 1L10A 176LA 5APFA 3W6AA 4PGJB 1GAYA 166LA 5I53A 2RBOA 1B7OA 232LA 1GHLA 4OW1A 1PZYA 169LA 1UIGA 4OWEA 2YBNA 2D91A 3GULA 1L29A 186LA 3HBHA 1YQVY 3C82A 1L69A 3CT5A 3DN4A 5KJ9A 1LSCA 1L76A 1L39A 3CDRA 7LYZA 2WARA 3SP3A 4J1BA 1QUSA 1DYAA 1L89A 1T3PA 5I4WA 239LA 3OE9A 2B6TA 2W1MA 3P65A 3NY9A 1L97A 221LA 4N9RA 3TXIA 4ZPUA 4MCKA 153LA 4XADA 2ANXA 245LA 1BB6A 1IOQA 4XENA 3CSRA 2FBBA 3RW8A 127LA 1HELA 1D3FA 2RBRA 1L79A 1GB0A 1DXJA 4WLDA 3ZVQA 2MEBA 2MEFA 1GB9A 4RDSA 1L52A 3AJNA 3CT0A 2NTGA 3HUKA 3DMZA 3AYQA 1G7JC 4NG8A 3JR6A 4H9HA 1L98A 1KXWA 5IDDA 1CV4A 2HEDA 1L90A 4GBRB 1EQ4A 125LA 4II8A 2ZQ3A 2I26L 1IP4A 3B0KA 1V7TA 3B72A 1OUEA 1AT6A 4U3XB 3G3WA 1GF5A 3LHMA 1HMKA 1LSZA 1C10A 172LA 2B5ZA 1JJ0A 1G0JA 1D0LA 1BQLY 158LA 1B7MA 1UA6Y 1GF4A 210LA 1SSWA 4N5RA 241LA 1IWWA 5B1FA 2EPEA 1C6EA 1RI8B 3HT8A 1G7HC 3DN0A 1B5YA 3ODUA 3PBLA 1QT4A 1KS3A 1REYA 1WQQA 161LA 3EMLA 5HLLA 1FKVA 1HEMA 4RLNA 1LYZA 170LA 1P6YA 1LI6A 1CKHA 1LWGA 1UCOA 1YL0X 2RB0X 1LZ8A 3OE8A 3IJUA 5L3HA 1LZAA 1NDGC 1LKSA 1L11A 1LMOA 2BQGA 4B1AA 3FADA 8LYZA 4ARQB 3WW5A 1LGXA 1BHZA 4DKLA 4XJHA 1IP5A 4I7MA 1P36A 154LA 4H91A 1C63A 1GBOA 1C6NA 1LYIA 2YBJA 1G1WA 220LA 3WU9A 5LXWA 1EQEA 1L01A 5KXZA 131LA 2O4WA 198LA 4DDAA 4XJFA 1B9OA 1JISA 4WO6A 1L19A 1CV0A 1GF3A 3HDEA 122LA 5ILCA 143LA 1XEJA 1F6SA 178LA 4W59A 4KXIA 3FI5A 4NGLA 4ARMB 1L47A 5FELA 5F14A 159LA 1HSWA 2BQNA 219LA 259LA 2RAZX 1ZVHL 5C6IA 1CU5A 1LW9A 1C6CA 4XYYA 2DQEY 1L21A 1L45A 4I7QA 5LINA 1QTEA 1L34A 2RB2X 3WVXA 4H9CA 2B74A 4NHSA 4HPEA 1IR9A 1CU6A 3J6KA 1ZYTA 1C6GA 1P3NA 1QT5A 1I6SA 1PQKA 2RB1X 1C6AA 5LVJA 218LA 147LA 1L64A 1L12A 1OWZA 222LA 1G0MA 1L55A 1L09A 1WQOA 3RZEA 1L83A 3F6ZA 1OVJA 4NEBA 2RSCA 3G3AB 1UIDA 4W57A 2B6ZA 1LJFA 2B72A 5HNCA 1WQPA 3ZVQB 2Z18A 1I1ZA 2C8PA 1B5ZA 1JJ1A 3AZ7A 1D9UA 130LA 4I7RA 1C61A 4TX7A 1GE0A 4CHXA 1CUQA 2ZIJA 4G49A 1L72A 3AGHA 2BQAA 2YBLA 1HEWA 254LA 5KKIA 4DD9A 139LA 1AT5A 225LA 1UIBA 1FBIX 2OU0X 193LA 1V7SA 4DC4A 3A90A 1NBZC 3A91A 3RNXA 4NG1A 4NHQA 2YSSC 5D5FA 209LA 4WM3A 2YBIA 2HEEA 1BB4A 3D3DA 1GFVA 1L24A 2HUMA 1XEKA 1WTHA 2Z38A 4EPIA 3BKVA 112LA 1JJ3A 1C6DA 1JSEA 3QNGA 4IAPA 1CVKA 262LA 1H6MA 1L95A 4ARPA 4OOTA 4H93A 1INUA 1B2KA 1LSAA 1YIKA 258LA 1C46A 1LAAA 4WLTA 3D9AC 1F10A 1G0LA 4IJ4A 1D3NA 1LMNA 1DYBA 4GLVA 1JSFA 1GFJA 145LA 1LJJA 5LVHA 1B5XA 1WQNA 3TXFA 1LYGA 1IO5A 1I56A 2A4TA 2ZNWY 1GFHA 1HEQA 1OUAA 3C81A 1IR8A 1LZTA 3WULA 1LZSA 1GE2A 4K5YA 1YILA 1QUTA 181LA 1L07A 4HTQA 160LA 3HU9A 4X3BA 1L48A 1B7LA 4GN5C 1BWHA 1L13A 4ET9A 4I7SA 1LSNA 1D2YA 1QS9A 1L93A 1FN5A 235LA 4Z46A 4WO9A 2IFFY 4PRQA 1HC0A 1XEIA 2ZQ4A 2F2NA 4B49A 217LA 1IWUA 260LA 2OTYX 3B6LA 1L70A 1L86A 1LZ5A 1UBZA 4QDNA 5LYZA 5ILFA 1P5CA 5KXRA 1IY3A 3SB6A 6LZMA 1L35A 2HU1A 4HJYA 3OK0A 2Q0MX 4NSIA 4LYCA 108LA 1L74A 3C8SA 1P64A 5E9RA 1FLUA 2RBQA 3TXKA 3EO5A 4DD2A 146LA 1XFPL 1RFPA 3P68A 4I7LA 238LA 1BB5A 226LA 1IC4Y 5DL9A 1C60A 1GB5A 1JEFA 1L96A 1CKFA 2G4NA 1L20A 1DYFA 1KW7A 4PJZA 1KY1A 4AXTA 1FLQA 2ZILA 3N9EA 3AB6A 4WOAA 3TMUA 1WTNA 1L14A 3AZ6A 4LT1A 2H9JA 1T8GA 1UIFA 1LJ4A 2OE7X 120LA 1C6BA 118LA 1GB6A 1RE2A 1P2CC 4H90A 1RCMA 3HUAA 1LSYA 1IC7Y 4W56A 3CT1A 114LA 3WMKA 190LA 2BQCA 1LCNA 4BAPA 1GF6A 3RT5X 1OUJA 1LPYA 4OWCA 4Z3MA 1GB7A 4DJHA 4DYGA 1L77A 1SWZA 4GLAA 1FLYA 2LZTA 4GCEA 5E4PA 1TBYA 1KY0A 1OVKA 5FDJA 1UC0A 1VEDA 1B5WA 3P64A 3A93A 208LA 4YM8A 1A2YC 1VAUA 2DQHY 4PJ2C 1H87A 5LAGA 5KXOA 1IC5Y 4DQJA 1YAOA 3T36A 4AGAA 216LA 4J0LA 1GB8A 1TAYA 4C5FA 1IWVA 4DT3A 1TLAA 2BLXA 4H8YA 2MEAA 4WG7A 2Z19A 1B5VA 2MECA 4Z41A 1YANA 3N9CA 5II3A 3GUJA 1LZNA 2BQLA 3TMVA 2B7XA 2O79A 3J4GA 2HEFA 234LA 104LA 1IWYA 3W3EA 3CQLA 1IOTA 1GFRA 4J7VA 1L30A 1C65A 5KXPA 1ZV5L 1BVKC 4WM6A 4LFPA 1GDXA 4LYBA 3SB9A 199LA 4WM5A 1HF4A 4B4IA 138LA 1KXXA 1LI3A 2LYZA 3AZ4A 1L03A 1IR7A 1LTMA 1BWJA 1LJKA 1QDTA 4R6CA 4QGZA 2XBRA 4WM4A 2BQKA 1G07A 2DQAA 1LMTA 4KT3A 4LDEA 1D9WA 5LAFA 2CUUA 1VATA 2DQCY 4YEMA 2FBDA 3WL2A 3IWRA 1LMQA 5LVKA 1LZEA 1YKXX 3AW6A 4DDCA 4CFOA 1VDTA 1D3JA 4RLMA 1F0WA 3WUNA 1L22A 1VDSA 3D4SA 4H9FA 1L73A 1IWZA 4G4BA 252LA 2CDSA 1C64A 173LA 3A3QA 3LN2A 1L84A 1L17A 191LA 3WU7A 1L46A 1GFEA 2LYMA 1L81A 1KNIA 5JENB 3SN6R 1LYHA 3A94A 2BQJA 1L65A 1CUPA 228LA 3G3VA 1L44A 1LZ4A 4NSGA 4R0FA 4LYZA 1QUDA 4LZMA 189LA 236LA 4DDBA 1L91A 5KXMA 4NGIA 133LA 207LA 4H9BA 2HEAA 256LA 1ZURA 2BQIA 1JTPL 2LHMA 4H9IA 132LA 1LZBA 4I7NA 1D6QA 184LA 1I20A 2HUBA 2DQGY 1SSYA 2IHLA 1L28A 1AKIA 2RBNA 3HT9A 1HEOA 5KXTA 1LJIA 215LA 1QTDA 4KL7A 1LWKA 1LMPA 1L51A 4HTKA 3WPLA 1IP1A 3A6BY 3AGGG 3BKHA 1RJCB 1L68A 3UONA 4H9AA 5IELA 2RBSA 1T6HA 5DN5A 1P46A 1DI4A 1W6ZA 4E97A 1L36A 1C6JA 3WU8A 1JPOA 2DQJY 1XGTC 3GUKA 3A92A 5LA8A 3WVYA 1DI3A 1LZYA 151LA 4NHPA 1L15A 185LA 3QY4A 4G4CA 2X0AA 3KAMA 4XN6A 152LA 3LYTA 1QSWA 1LSEA 1C66A 1TDYA 1L37A 3T6UA 1IOCA 1UUZC 3P66A 1N4FA 255LA 2CGIA 4NSJA 3SB8A 3ATOA 244LA 211LA 1LHKA 4LT0A 3V2WA 1L71A 2B73A 1L58A 1L16A 4NSHA 4DD7A 1YROA 1C6TA 2OU9A 5AMYA 3EXDA 5T3FA 5DN4A 4DD1A 3LYZA 1REZA 1PQMA 3GUPA 3WPKA 2YBMA 5FHWA 1B7NA 3C7YA 5I4XA 1QTVA 3HUQA 155LA 3A6CY 1HENA 1CU2A 1CV3A 1YAQA 1JQUA 2DQIY 212LA 1LZ9A 4WM1A 4HV2A 1L49A 4ARLA 1GBWA 4XJDA 4DQ7A 2C8OA 3C7ZA 229LA 3V2YA 1LZDA 1XEPA 1L04A 1KXYA 3QE8A 5HNLA 2HULA 1KW5A 4I7KA 1PQIA 1CKDA 1L50A 4HTNA 4LFXA 1L18A 2DQDY 5HMJA 4P2EA 3W6BA 192LA 2MEDA 1LJHA 3LZMA 4NWEA 1ZWNA 2MEHA 1GB2A 1K28A 4C3WA 1LYDA 2XTHA 1LZRA 187LA 1MLCE 5F9UA 237LA 1EQ5A 247LA 2EKSC 2BQOA 119LA 1LPIA 1LYFA 3HDFA 3HTBA 2I6ZA 1L0JA 1QT3A 3A8ZA 2ANVA 4OWHA 1GFKA 3A96A 1HFYA 1JTNA 201LA 4DD3A 1QUOA 3LYMA 3CSZA 9LYZA 1OVHA 248LA 1L02A 4LYMA 135LA 1W08A 2EIZC 1D0KA 1LGUA 4GCDA 5FSTA 3RZ4A 1XGUC 1OUBA 4W94A 5KXYA 1NWGA 4GCBA 1GFGA 4EKSA 5B06A 171LA 4M4OA 2DQFC 1GBXA 3B0IA 3K3TA 1L67A 3TXEA 1LMCA 1NHBA 1CV5A 5KKJA 1IEEA 137LA 3TXDA 1L06A 5KXXA 4W54A 2BQBA 1JUGA 4WL6A 1YKYX 3M3UA 1C62A 233LA 2A7FA 4GN3A 3W6DA 4YEOA 4ANRA 1DYEA 3DMXA 1C69A 4LYTA 1LSGA 230LA 195LA 2FYCA 5LVIA 3HWLA 1JKDA 2HEBA 3LZ2A 1GFAA 223LA 194LA 1J1XY 5LVGA 231LA 188LA 1UIHA 3HT7A 3A95A 5B07A 3W6EA 2ZYCA 1P56A 3W6CA 4H8ZA 1L42A 2RAYX 3SB5A 4WM2A 1JKAA 2Z12A 4QY9A 1XGQC 4I7PA 1ZVYB 1QUHA 3G3BB 102LA 4NGWA 6LYTA 4EOFA 1NKHA 1CU0A 168LA 1PQJA 4YX7C 3F9LA 4RW2A 1CU3A 1SWYA 4YENA 4OWAA 1LMAA 1GFUA 4PPOA 5KXWA 3CDVA 162LA 3C8QA 1EL1A 4DQ5A 3EMSA 1OUCA 1QT7A 1L99A 4KPMA 4NGOA 1L26A 1NQIA 4I7JA 1QT6A 2Z2FA 4H8XA 1E8LA 1CKGA 3HT6A 3HU8A 2ZNXY 2Z37A 1DYDA 2CJLA 2F47A 4ETBA 3C80A 1QQYA 2H9KA 3LZTA 1G0QA 3MGWA 227LA 4UWUA 3TXHA 5F16A 1D2WA 1XJUA 3CSQA 1L80A 2MEGA 3ULRA 1B7SA 3FA0A 5F81A 4ETCA 5EBHA 1GF8A 1C67A 1C6IA 5HMVA 2LCBA 2OU8A 1BB7A 3DMVA 4ML7A 2G4PA 1IP3A 1QTHA 1C6PA 1LYYA 224LA 1YKZX 4GCFA 4ARQA 5F9XA 1G0GA 1L88A 1L94A 1BVXA 1HSXA 2HTXA 1L61A 5KXNA 5L9JA 1VDQA 1C7PA 1LJGA 3VW7A 4QEQA 5APEA 3OE0A 2AUBA 1XJTA 1REMA 4I0CA 4OO9A 5DLAA 1QUGA 1BGIA 1LJEA 4YXAC 3NYAA 243LA 177LA 123LA 4NGZA 1F6RA 1LSDA 1REXA 2A7DA 1XGPC 4G4HA 2YDGA 4D9ZA 1HHLA 1DYCA 1SX7A 1GF7A 5M1YA 4N1EI 3DN3A 1LGWA 1JWRA 3TXGA 1DPXA 4ETAA 4I7TA 4NHIA 1PQDA 4W96A 2D4KA 1C6MA 103LA 7LZMA 4GN4A 4YXCA 1QSQA 1LZ1A 2H5ZA 1JKCA 2BAAA 5FCPA 4TWSA 4W53A 2ZIKA 2D4IA 5L3IA 2Z2EA 1CJ6A 3PDSA 1LHJA 206LA 1HFXA 1LSBA 4WLXA 5I5QA 3B0OA 1G7MC 4CGEA 167LA 3K2RA 3CDQA 1GE3A 1GB3A 1L66A 4LT3A 1L33A 1T6VL 1XSFA 4H1PA 1L87A 2GV0A 4LZTA 163LA 4O34A 4W51A 3TXBA 257LA 4BAFA 1L43A 2LZ2A 2OEAX 1L08A 174LA 3FI7A 2LZMA 4EXMA 1A4VA 4HV1A 4N0JA 5APDA 1PQOA 2BQDA 3OJPA 1OYUA 1P2LA 3SBAA 1B6IA 1OWYA 141LA 240LA 150LA 1QT8A 1GEZA 1JKBA 3WW6A 1GE4A 1L0KA 1IY4A 4Z98A 3GUNA 5A3ZA 4W58A 4W55A 1KIPC 4XJBA 2I25L 1PS5A 1BB3A 3CB7A 3EBAB 1IIZA 2BQFA 2MEIA 1IP7A 3A3RX 4XJGA 3P4ZA 4OWBA 2Z6BA 2QARC 4PRUA 1JTMA 2IGCA 5KXKA 1T97A 3E3DA 1B7QA 4WLYA 1G1VA 1DKJA 4NGVA 2D6BA 5I54A 165LA 1ZMYL 5B1GA 196LA 1G0KA 1DI5A 4J1AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L49 A;  164L A;  4ARL A;  2F32 A;  1L13 A;  2RBO A;  232L A;  1C68 A;  169L A;  3F8V A;  4I7S A;  107L A;  4EKQ A;  3C7Z A;  1D2Y A;  1QS9 A;  229L A;  1L93 A;  1QTC A;  3GUL A;  3V2Y A;  235L A;  1L25 A;  1L60 A;  1XEP A;  1L29 A;  186L A;  1L04 A;  182L A;  1L23 A;  2HUL A;  3C82 A;  1KW5 A;  4I7K A;  1L69 A;  1L85 A;  3DN4 A;  3NY8 A;  1L76 A;  1L39 A;  1PQI A;  3CDR A;  1L50 A;  4AQN A;  1CV6 A;  217L A;  1L18 A;  3DN2 A;  260L A;  2OTY X;  192L A;  1G0P A;  1L70 A;  1L86 A;  246L A;  3LZM A;  1ZWN A;  3DN1 A;  1DYA A;  3HTG A;  1K28 A;  1L89 A;  1P5C A;  3SB6 A;  6LZM A;  1L35 A;  239L A;  3OE9 A;  1LYD A;  2B6T A;  3GUO A;  3NY9 A;  1L59 A;  187L A;  1L97 A;  221L A;  108L A;  1L74 A;  3C8S A;  1P64 A;  4ZPU A;  3L64 A;  237L A;  247L A;  2RBQ A;  200L A;  2ANX A;  2Q9D A;  146L A;  245L A;  119L A;  1CTW A;  1LYF A;  126L A;  3HDF A;  3HTB A;  127L A;  1L75 A;  4I7L A;  148L E;  1D3F A;  1L82 A;  238L A;  2RBR A;  1L79 A;  1L0J A;  1L63 A;  1QT3 A;  226L A;  2ANV A;  3DNA A;  1C60 A;  5I14 A;  1JTN A;  201L A;  261L A;  1QUO A;  1L96 A;  1L20 A;  1DYF A;  1OVH A;  1KW7 A;  248L A;  1L27 A;  1L02 A;  1L52 A;  4PJZ A;  1LGU A;  2NTG A;  1KY1 A;  3HUK A;  3DMZ A;  4EKP A;  4S0W A;  4EKS A;  3JR6 A;  1L98 A;  1L14 A;  171L A;  1CV4 A;  1T8G A;  1L90 A;  4GBR B;  111L A;  3HH3 A;  2OE7 X;  4LDO A;  125L A;  120L A;  1D3M A;  1L67 A;  1C6B A;  118L A;  183L A;  1NHB A;  1CV5 A;  3C8R A;  137L A;  3HUA A;  1L06 A;  4W54 A;  4W56 A;  114L A;  3G3W A;  190L A;  4EJ4 A;  1C62 A;  233L A;  1LPY A;  172L A;  205L A;  1DYE A;  1DYG A;  1G0J A;  4DJH A;  158L A;  2OE4 X;  3DMX A;  1C69 A;  1L77 A;  1SWZ A;  2B6Y A;  210L A;  230L A;  1SSW A;  195L A;  241L A;  3HWL A;  2B6W A;  1KY0 A;  1OVK A;  1EPY A;  3CDT A;  1C6E A;  3G3X A;  2OE9 X;  223L A;  180L A;  3HT8 A;  3DN0 A;  231L A;  188L A;  242L A;  3ODU A;  3PBL A;  1CV1 A;  3HT7 A;  1QT4 A;  1KS3 A;  161L A;  3EML A;  1P56 A;  1T8F A;  1L42 A;  2LC9 A;  2RAY X;  3SB5 A;  170L A;  1P6Y A;  2RBP A;  1LI6 A;  216L A;  1L31 A;  1LWG A;  4I7P A;  1QUH A;  1TLA A;  102L A;  1CU0 A;  168L A;  1PQJ A;  253L A;  2RB0 X;  3F9L A;  4YX7 C;  3OE8 A;  144L A;  1CU3 A;  1SWY A;  1QTZ A;  3GUJ A;  3CDV A;  162L A;  3C8Q A;  2B7X A;  2O79 A;  234L A;  104L A;  1L11 A;  1QT7 A;  113L A;  1L99 A;  3FAD A;  4ARQ B;  1L26 A;  115L A;  4I7J A;  1LGX A;  1QT6 A;  4DKL A;  3HT6 A;  3HU8 A;  1L30 A;  3L2X A;  1L53 A;  1C65 A;  1LYJ A;  4I7M A;  1DYD A;  1P36 A;  1C63 A;  1QTB A;  2F47 A;  1C6N A;  3C80 A;  1OV5 A;  1LYI A;  1CX7 A;  3SB9 A;  249L A;  1G1W A;  220L A;  3OE6 A;  1C6Q A;  199L A;  1G0Q A;  1L01 A;  4ARJ A;  138L A;  1LI3 A;  227L A;  3HH6 A;  131L A;  2O4W A;  198L A;  1L56 A;  1L62 A;  1L57 A;  1D2W A;  1XJU A;  1L03 A;  1L80 A;  214L A;  1L19 A;  1CV0 A;  3FA0 A;  250L A;  5LZM A;  3HDE A;  197L A;  122L A;  1QS5 A;  3C7W A;  1G07 A;  143L A;  1C67 A;  178L A;  4W59 A;  3FI5 A;  128L A;  1C6I A;  4LDE A;  4ARM B;  1L47 A;  2LCB A;  1D9W A;  3HH5 A;  2OU8 A;  2CUU A;  3DMV A;  251L A;  1QTH A;  2L78 A;  1G06 A;  159L A;  1C6P A;  224L A;  3DKE X;  2B70 A;  1LLH A;  1L40 A;  219L A;  259L A;  2RAZ X;  2F2Q A;  4LDL A;  4ARQ A;  1CU5 A;  1LW9 A;  1C6C A;  1G0G A;  1L88 A;  1L21 A;  3CDO A;  1L45 A;  1L94 A;  4I7Q A;  1L61 A;  1L34 A;  1D3J A;  2O7A A;  2RB2 X;  4GRV A;  3HTD A;  1SX2 A;  1L22 A;  109L A;  2B74 A;  3HTF A;  3VW7 A;  1L05 A;  3D4S A;  2B6X A;  1L73 A;  1CU6 A;  4EKR A;  3OE0 A;  1ZYT A;  1XJT A;  1C6G A;  1T8A A;  4OO9 A;  1P3N A;  252L A;  1QUG A;  1QT5 A;  1C64 A;  1I6S A;  173L A;  4YXA C;  3NYA A;  3SBB C;  243L A;  1PQK A;  177L A;  123L A;  1C6A A;  1L84 A;  2RB1 X;  1L17 A;  191L A;  218L A;  147L A;  1L46 A;  2OTZ X;  1L64 A;  1L81 A;  1L12 A;  1C6H A;  1OWZ A;  157L A;  2RH1 A;  1KNI A;  222L A;  1DYC A;  3SN6 R;  1G0M A;  1LYH A;  1SX7 A;  1L55 A;  175L A;  1L09 A;  3RZE A;  1L65 A;  3DN3 A;  1L83 A;  1LGW A;  3DN6 A;  1OVJ A;  4I7T A;  1CUP A;  228L A;  3G3V A;  1PQD A;  1L44 A;  1C6M A;  103L A;  4W57 A;  1QUD A;  1P7S A;  2B6Z A;  4LZM A;  189L A;  2B72 A;  7LZM A;  4YXC A;  236L A;  1QSQ A;  3GUI A;  1L91 A;  1L38 A;  2QB0 B;  1L41 A;  256L A;  1ZUR A;  4W53 A;  140L A;  4I7N A;  4I7R A;  130L A;  4W52 A;  1C61 A;  3PDS A;  206L A;  184L A;  1CUQ A;  1L54 A;  1L72 A;  167L A;  3K2R A;  254L A;  3CDQ A;  149L A;  1L66 A;  1SSY A;  139L A;  225L A;  1L33 A;  1L28 A;  1P2R A;  4DAJ A;  2OU0 X;  2RBN A;  1L32 A;  3HT9 A;  2NTH A;  1L87 A;  213L A;  215L A;  163L A;  1QTD A;  4W51 A;  1CX6 A;  257L A;  1LWK A;  3RUN A;  1L43 A;  2OEA X;  1L08 A;  1L51 A;  110L A;  174L A;  1L68 A;  2LZM A;  209L A;  3UON A;  4EXM A;  2RBS A;  1T6H A;  1P46 A;  4E97 A;  1L24 A;  1L36 A;  1C6J A;  2B75 A;  3GUK A;  2HUM A;  1PQO A;  3C83 A;  2HUK A;  1WTH A;  129L A;  1LI2 A;  1OYU A;  1P2L A;  3DN8 A;  1L92 A;  3SBA A;  1B6I A;  3HH4 A;  4EPI A;  1OWY A;  151L A;  141L A;  1L15 A;  185L A;  240L A;  112L A;  150L A;  1C6D A;  1QT8 A;  4IAP A;  1CVK A;  1OV7 A;  262L A;  1L95 A;  152L A;  4ARP A;  2Q9E A;  1C6F A;  1C66 A;  1L0K A;  3GUN A;  1L37 A;  1P37 A;  4W58 A;  4W55 A;  258L A;  255L A;  142L A;  3SB8 A;  244L A;  211L A;  4I7O A;  1G0L A;  3V2W A;  1L71 A;  1D3N A;  2B73 A;  2Z6B A;  1L58 A;  1DYB A;  1L16 A;  3SB7 A;  2QAR C;  1C6L A;  145L A;  4PK0 A;  3GUM A;  1C6T A;  2OU9 A;  1JTM A;  2IGC A;  1LYE A;  1T97 A;  4EPF A;  1LYG A;  1PQM A;  3GUP A;  1G1V A;  1L00 A;  2A4T A;  1QSB A;  3C7Y A;  3QAK A;  156L A;  3C81 A;  1QTV A;  1C6K A;  3HUQ A;  155L A;  165L A;  1CU2 A;  1CV3 A;  4ARM A;  1JQU A;  4K5Y A;  212L A;  1L10 A;  176L A;  181L A;  1L07 A;  160L A;  3HU9 A;  196L A;  166L A;  1G0K A;  1L48 A; 
#chains in the Genus database with same CATH topology
 3TMW A;  164L A;  1CJ8 A;  2F32 A;  1JHL A;  4N1C C;  4NY5 A;  1C68 A;  3F8V A;  4EKQ A;  107L A;  5LYT A;  1LHH A;  1QTC A;  1L25 A;  1L60 A;  1GXV 2;  182L A;  1L23 A;  4NGJ A;  1L85 A;  3NY8 A;  1OUG A;  2BQE A;  4UWN A;  4AQN A;  3TXJ A;  1OUI A;  1LJ3 A;  1CV6 A;  5HQ1 A;  3DN2 A;  1G0P A;  1HER A;  4NHT A;  4ETE A;  246L A;  4ZEE A;  4CJ2 A;  1GF9 A;  3DN1 A;  1YL1 X;  1O23 A;  1WTM A;  3HTG A;  1GFT A;  1LJN A;  3WH1 A;  1OUF A;  1CJ9 A;  1GPQ C;  3GUO A;  1NBY C;  1LZ6 A;  1L59 A;  1LHL A;  134L A;  1LOZ A;  3L64 A;  2DKV A;  1SQ2 L;  200L A;  2Q9D A;  1TCY A;  1B0D A;  1CTW A;  4TTD A;  126L A;  1GBS A;  1L75 A;  2Y8P A;  148L E;  4WL7 A;  1L82 A;  4ZIX A;  1CNS A;  1L63 A;  1IOR A;  3DNA A;  1NF5 A;  4PHI A;  5I14 A;  3N9A A;  3M18 B;  261L A;  1LYO A;  1BWI A;  3HBE X;  4RW1 A;  1L27 A;  4ET8 A;  4GCC A;  3FE0 A;  4EKP A;  2BLY A;  4S0W A;  1LSF A;  1IOS A;  1YAP A;  1WQR A;  111L A;  3WPJ A;  6LYZ A;  3HH3 A;  4LDO A;  1D3M A;  183L A;  3C8R A;  1IP6 A;  4A7D A;  5C6J A;  4M6D A;  4NWH A;  1XGR C;  3HFM Y;  4EJ4 A;  4LGK A;  1WQM A;  4TSC A;  4B4J A;  3TMX A;  5B59 A;  5KXS A;  2W1L A;  2XJW A;  3RU5 A;  205L A;  1DYG A;  4YF2 A;  1HNL A;  2OE4 X;  4OOO A;  2W1X A;  4HPI A;  1GDW A;  1AZF A;  2B6Y A;  4HP0 A;  3ZEK A;  1J1P Y;  1QDR A;  2B6W A;  1J1O Y;  1UIC A;  5KY1 A;  1EPY A;  3CDT A;  3G3X A;  2OE9 X;  1UAC Y;  180L A;  3VWO A;  242L A;  5LIO A;  1LZG A;  1UIE A;  1CV1 A;  1CJ7 A;  2N5Z A;  1FKQ A;  4CFP A;  2BQM A;  1T8F A;  2LC9 A;  1ALC A;  3GXK A;  1Z55 A;  1JTO L;  1OP9 B;  2RBP A;  3A67 Y;  3GXR A;  2BPU A;  1L31 A;  4FJR A;  1DKK A;  4IAS A;  1KIQ C;  253L A;  2VB1 A;  144L A;  1JTT L;  1JIT A;  1LSM A;  2W1Y A;  1AM7 A;  5D5C A;  1D6P A;  1QTZ A;  1YAM A;  2ZYP A;  4NFV A;  3AGI A;  1VDP A;  2F30 A;  113L A;  115L A;  1NMM A;  4H9E A;  1GE1 A;  2LYO A;  3L2X A;  1L53 A;  1LYJ A;  1GXX A;  1QTB A;  1C45 A;  2YBH A;  1OV5 A;  1CX7 A;  249L A;  1FLW A;  3OE6 A;  1C6Q A;  3WUM A;  4ARJ A;  3HH6 A;  1JIY A;  2FYD A;  1G7I C;  1L56 A;  1L62 A;  1L57 A;  214L A;  4EMN A;  1TEW A;  1MEL L;  4N8Z A;  250L A;  4H94 A;  5LZM A;  197L A;  2XBS A;  1QS5 A;  4TSB A;  3C7W A;  1HML A;  128L A;  4WG1 A;  1VFB C;  3HH5 A;  1CKC A;  251L A;  4B4E A;  2L78 A;  1G06 A;  1QTK A;  3WUA A;  3DKE X;  2B70 A;  1DPW A;  1LLH A;  4E3U A;  1L40 A;  2PC2 A;  2F4G A;  4NGY A;  4MST A;  2F2Q A;  4LDL A;  1LZC A;  3CDO A;  3WXU A;  4ETD A;  5IHG A;  4IAT A;  2O7A A;  4GRV A;  4H92 A;  1NDM C;  3HTD A;  4G9S A;  3A34 A;  1SX2 A;  5APC A;  3WXT A;  109L A;  3HTF A;  5FEK A;  1QIO A;  3LYO A;  1GWD A;  1L05 A;  2B6X A;  4EKR A;  3IJV A;  1WVV A;  3W6F A;  2XQO A;  1GEV A;  4I8S A;  1T8A A;  4DWX A;  2DBT A;  2ZWB A;  4FDY A;  4HSF A;  3SBB C;  5A3E A;  4B0D A;  2OTZ X;  1LSP A;  4DD0 A;  4TUN A;  1C6H A;  5J7C A;  157L A;  2RH1 A;  2MEE A;  175L A;  4XJI A;  4NGK A;  3DN6 A;  5I4Y A;  3HBD A;  4LYO A;  1B5U A;  4BAD A;  1OUD A;  1P7S A;  1NHE A;  3AW7 A;  1OUH A;  3GUI A;  1SLY A;  1L38 A;  1LHI A;  2QB0 B;  4HJV A;  1L41 A;  5B05 A;  140L A;  1WVU A;  2BQH A;  1C08 C;  3AZ5 A;  4W52 A;  1C43 A;  1IWT A;  1L54 A;  2G4Q A;  1UIA A;  149L A;  1P2R A;  4DAJ A;  1GD6 A;  1IVM A;  1L32 A;  5K7O A;  2NTH A;  4ZFP A;  213L A;  4MR1 A;  1IWX A;  1CX6 A;  1D0M A;  1LHM A;  1HFZ A;  3RUN A;  1HEP A;  4HJZ A;  110L A;  5LA5 A;  2Z39 A;  4NIJ A;  4WMG A;  3WYH A;  3ATN A;  1OQM A;  2HEC A;  1FDL Y;  2B75 A;  5LYM A;  3C83 A;  2HUK A;  129L A;  3DN8 A;  1LI2 A;  1L92 A;  2HU3 A;  2D4J A;  3HH4 A;  1IP2 A;  1DZB X;  2YVB A;  4LT2 A;  1LKR A;  1GBZ A;  1B7R A;  1OV7 A;  2F4A A;  1IX0 A;  2NWD X;  1GAZ A;  2Q9E A;  1C6F A;  4L41 A;  4UWV A;  1P37 A;  5DM9 A;  5C6L A;  142L A;  1QSA A;  1GBY A;  4I7O A;  1B7P A;  5KXL A;  4YOP A;  4BS7 A;  1DQJ C;  3SB7 A;  1LYS A;  1C6L A;  4PK0 A;  1G7L C;  3GUM A;  1LYE A;  4EPF A;  1KIR C;  1GF0 A;  1L00 A;  1QSB A;  3QAK A;  156L A;  1C6K A;  2EQL A;  4ARM A;  2CWI A;  1L10 A;  176L A;  5APF A;  3W6A A;  4PGJ B;  1GAY A;  166L A;  5I53 A;  2RBO A;  1B7O A;  232L A;  1GHL A;  4OW1 A;  1PZY A;  169L A;  1UIG A;  4OWE A;  2YBN A;  2D91 A;  3GUL A;  1L29 A;  186L A;  3HBH A;  1YQV Y;  3C82 A;  1L69 A;  3CT5 A;  3DN4 A;  5KJ9 A;  1LSC A;  1L76 A;  1L39 A;  3CDR A;  7LYZ A;  2WAR A;  3SP3 A;  4J1B A;  1QUS A;  1DYA A;  1L89 A;  1T3P A;  5I4W A;  239L A;  3OE9 A;  2B6T A;  2W1M A;  3P65 A;  3NY9 A;  1L97 A;  221L A;  4N9R A;  3TXI A;  4ZPU A;  4MCK A;  153L A;  4XAD A;  2ANX A;  245L A;  1BB6 A;  1IOQ A;  4XEN A;  3CSR A;  2FBB A;  3RW8 A;  127L A;  1HEL A;  1D3F A;  2RBR A;  1L79 A;  1GB0 A;  1DXJ A;  4WLD A;  3ZVQ A;  2MEB A;  2MEF A;  1GB9 A;  4RDS A;  1L52 A;  3AJN A;  3CT0 A;  2NTG A;  3HUK A;  3DMZ A;  3AYQ A;  1G7J C;  4NG8 A;  3JR6 A;  4H9H A;  1L98 A;  1KXW A;  5IDD A;  1CV4 A;  2HED A;  1L90 A;  4GBR B;  1EQ4 A;  125L A;  4II8 A;  2ZQ3 A;  2I26 L;  1IP4 A;  3B0K A;  1V7T A;  3B72 A;  1OUE A;  1AT6 A;  4U3X B;  3G3W A;  1GF5 A;  3LHM A;  1HMK A;  1LSZ A;  1C10 A;  172L A;  2B5Z A;  1JJ0 A;  1G0J A;  1D0L A;  1BQL Y;  158L A;  1B7M A;  1UA6 Y;  1GF4 A;  210L A;  1SSW A;  4N5R A;  241L A;  1IWW A;  5B1F A;  2EPE A;  1C6E A;  1RI8 B;  3HT8 A;  1G7H C;  3DN0 A;  1B5Y A;  3ODU A;  3PBL A;  1QT4 A;  1KS3 A;  1REY A;  1WQQ A;  161L A;  3EML A;  5HLL A;  1FKV A;  1HEM A;  4RLN A;  1LYZ A;  170L A;  1P6Y A;  1LI6 A;  1CKH A;  1LWG A;  1UCO A;  1YL0 X;  2RB0 X;  1LZ8 A;  3OE8 A;  3IJU A;  5L3H A;  1LZA A;  1NDG C;  1LKS A;  1L11 A;  1LMO A;  2BQG A;  4B1A A;  3FAD A;  8LYZ A;  4ARQ B;  3WW5 A;  1LGX A;  1BHZ A;  4DKL A;  4XJH A;  1IP5 A;  4I7M A;  1P36 A;  154L A;  4H91 A;  1C63 A;  1GBO A;  1C6N A;  1LYI A;  2YBJ A;  1G1W A;  220L A;  3WU9 A;  5LXW A;  1EQE A;  1L01 A;  5KXZ A;  131L A;  2O4W A;  198L A;  4DDA A;  4XJF A;  1B9O A;  1JIS A;  4WO6 A;  1L19 A;  1CV0 A;  1GF3 A;  3HDE A;  122L A;  5ILC A;  143L A;  1XEJ A;  1F6S A;  178L A;  4W59 A;  4KXI A;  3FI5 A;  4NGL A;  4ARM B;  1L47 A;  5FEL A;  5F14 A;  159L A;  1HSW A;  2BQN A;  219L A;  259L A;  2RAZ X;  1ZVH L;  5C6I A;  1CU5 A;  1LW9 A;  1C6C A;  4XYY A;  2DQE Y;  1L21 A;  1L45 A;  4I7Q A;  5LIN A;  1QTE A;  1L34 A;  2RB2 X;  3WVX A;  4H9C A;  2B74 A;  4NHS A;  4HPE A;  1IR9 A;  1CU6 A;  3J6K A;  1ZYT A;  1C6G A;  1P3N A;  1QT5 A;  1I6S A;  1PQK A;  2RB1 X;  1C6A A;  5LVJ A;  218L A;  147L A;  1L64 A;  1L12 A;  1OWZ A;  222L A;  1G0M A;  1L55 A;  1L09 A;  1WQO A;  3RZE A;  1L83 A;  3F6Z A;  1OVJ A;  4NEB A;  2RSC A;  3G3A B;  1UID A;  4W57 A;  2B6Z A;  1LJF A;  2B72 A;  5HNC A;  1WQP A;  3ZVQ B;  2Z18 A;  1I1Z A;  2C8P A;  1B5Z A;  1JJ1 A;  3AZ7 A;  1D9U A;  130L A;  4I7R A;  1C61 A;  4TX7 A;  1GE0 A;  4CHX A;  1CUQ A;  2ZIJ A;  4G49 A;  1L72 A;  3AGH A;  2BQA A;  2YBL A;  1HEW A;  254L A;  5KKI A;  4DD9 A;  139L A;  1AT5 A;  225L A;  1UIB A;  1FBI X;  2OU0 X;  193L A;  1V7S A;  4DC4 A;  3A90 A;  1NBZ C;  3A91 A;  3RNX A;  4NG1 A;  4NHQ A;  2YSS C;  5D5F A;  209L A;  4WM3 A;  2YBI A;  2HEE A;  1BB4 A;  3D3D A;  1GFV A;  1L24 A;  2HUM A;  1XEK A;  1WTH A;  2Z38 A;  4EPI A;  3BKV A;  112L A;  1JJ3 A;  1C6D A;  1JSE A;  3QNG A;  4IAP A;  1CVK A;  262L A;  1H6M A;  1L95 A;  4ARP A;  4OOT A;  4H93 A;  1INU A;  1B2K A;  1LSA A;  1YIK A;  258L A;  1C46 A;  1LAA A;  4WLT A;  3D9A C;  1F10 A;  1G0L A;  4IJ4 A;  1D3N A;  1LMN A;  1DYB A;  4GLV A;  1JSF A;  1GFJ A;  145L A;  1LJJ A;  5LVH A;  1B5X A;  1WQN A;  3TXF A;  1LYG A;  1IO5 A;  1I56 A;  2A4T A;  2ZNW Y;  1GFH A;  1HEQ A;  1OUA A;  3C81 A;  1IR8 A;  1LZT A;  3WUL A;  1LZS A;  1GE2 A;  4K5Y A;  1YIL A;  1QUT A;  181L A;  1L07 A;  4HTQ A;  160L A;  3HU9 A;  4X3B A;  1L48 A;  1B7L A;  4GN5 C;  1BWH A;  1L13 A;  4ET9 A;  4I7S A;  1LSN A;  1D2Y A;  1QS9 A;  1L93 A;  1FN5 A;  235L A;  4Z46 A;  4WO9 A;  2IFF Y;  4PRQ A;  1HC0 A;  1XEI A;  2ZQ4 A;  2F2N A;  4B49 A;  217L A;  1IWU A;  260L A;  2OTY X;  3B6L A;  1L70 A;  1L86 A;  1LZ5 A;  1UBZ A;  4QDN A;  5LYZ A;  5ILF A;  1P5C A;  5KXR A;  1IY3 A;  3SB6 A;  6LZM A;  1L35 A;  2HU1 A;  4HJY A;  3OK0 A;  2Q0M X;  4NSI A;  4LYC A;  108L A;  1L74 A;  3C8S A;  1P64 A;  5E9R A;  1FLU A;  2RBQ A;  3TXK A;  3EO5 A;  4DD2 A;  146L A;  1XFP L;  1RFP A;  3P68 A;  4I7L A;  238L A;  1BB5 A;  226L A;  1IC4 Y;  5DL9 A;  1C60 A;  1GB5 A;  1JEF A;  1L96 A;  1CKF A;  2G4N A;  1L20 A;  1DYF A;  1KW7 A;  4PJZ A;  1KY1 A;  4AXT A;  1FLQ A;  2ZIL A;  3N9E A;  3AB6 A;  4WOA A;  3TMU A;  1WTN A;  1L14 A;  3AZ6 A;  4LT1 A;  2H9J A;  1T8G A;  1UIF A;  1LJ4 A;  2OE7 X;  120L A;  1C6B A;  118L A;  1GB6 A;  1RE2 A;  1P2C C;  4H90 A;  1RCM A;  3HUA A;  1LSY A;  1IC7 Y;  4W56 A;  3CT1 A;  114L A;  3WMK A;  190L A;  2BQC A;  1LCN A;  4BAP A;  1GF6 A;  3RT5 X;  1OUJ A;  1LPY A;  4OWC A;  4Z3M A;  1GB7 A;  4DJH A;  4DYG A;  1L77 A;  1SWZ A;  4GLA A;  1FLY A;  2LZT A;  4GCE A;  5E4P A;  1TBY A;  1KY0 A;  1OVK A;  5FDJ A;  1UC0 A;  1VED A;  1B5W A;  3P64 A;  3A93 A;  208L A;  4YM8 A;  1A2Y C;  1VAU A;  2DQH Y;  4PJ2 C;  1H87 A;  5LAG A;  5KXO A;  1IC5 Y;  4DQJ A;  1YAO A;  3T36 A;  4AGA A;  216L A;  4J0L A;  1GB8 A;  1TAY A;  4C5F A;  1IWV A;  4DT3 A;  1TLA A;  2BLX A;  4H8Y A;  2MEA A;  4WG7 A;  2Z19 A;  1B5V A;  2MEC A;  4Z41 A;  1YAN A;  3N9C A;  5II3 A;  3GUJ A;  1LZN A;  2BQL A;  3TMV A;  2B7X A;  2O79 A;  3J4G A;  2HEF A;  234L A;  104L A;  1IWY A;  3W3E A;  3CQL A;  1IOT A;  1GFR A;  4J7V A;  1L30 A;  1C65 A;  5KXP A;  1ZV5 L;  1BVK C;  4WM6 A;  4LFP A;  1GDX A;  4LYB A;  3SB9 A;  199L A;  4WM5 A;  1HF4 A;  4B4I A;  138L A;  1KXX A;  1LI3 A;  2LYZ A;  3AZ4 A;  1L03 A;  1IR7 A;  1LTM A;  1BWJ A;  1LJK A;  1QDT A;  4R6C A;  4QGZ A;  2XBR A;  4WM4 A;  2BQK A;  1G07 A;  2DQA A;  1LMT A;  4KT3 A;  4LDE A;  1D9W A;  5LAF A;  2CUU A;  1VAT A;  2DQC Y;  4YEM A;  2FBD A;  3WL2 A;  3IWR A;  1LMQ A;  5LVK A;  1LZE A;  1YKX X;  3AW6 A;  4DDC A;  4CFO A;  1VDT A;  1D3J A;  4RLM A;  1F0W A;  3WUN A;  1L22 A;  1VDS A;  3D4S A;  4H9F A;  1L73 A;  1IWZ A;  4G4B A;  252L A;  2CDS A;  1C64 A;  173L A;  3A3Q A;  3LN2 A;  1L84 A;  1L17 A;  191L A;  3WU7 A;  1L46 A;  1GFE A;  2LYM A;  1L81 A;  1KNI A;  5JEN B;  3SN6 R;  1LYH A;  3A94 A;  2BQJ A;  1L65 A;  1CUP A;  228L A;  3G3V A;  1L44 A;  1LZ4 A;  4NSG A;  4R0F A;  4LYZ A;  1QUD A;  4LZM A;  189L A;  236L A;  4DDB A;  1L91 A;  5KXM A;  4NGI A;  133L A;  207L A;  4H9B A;  2HEA A;  256L A;  1ZUR A;  2BQI A;  1JTP L;  2LHM A;  4H9I A;  132L A;  1LZB A;  4I7N A;  1D6Q A;  184L A;  1I20 A;  2HUB A;  2DQG Y;  1SSY A;  2IHL A;  1L28 A;  1AKI A;  2RBN A;  3HT9 A;  1HEO A;  5KXT A;  1LJI A;  215L A;  1QTD A;  4KL7 A;  1LWK A;  1LMP A;  1L51 A;  4HTK A;  3WPL A;  1IP1 A;  3A6B Y;  3AGG G;  3BKH A;  1RJC B;  1L68 A;  3UON A;  4H9A A;  5IEL A;  2RBS A;  1T6H A;  5DN5 A;  1P46 A;  1DI4 A;  1W6Z A;  4E97 A;  1L36 A;  1C6J A;  3WU8 A;  1JPO A;  2DQJ Y;  1XGT C;  3GUK A;  3A92 A;  5LA8 A;  3WVY A;  1DI3 A;  1LZY A;  151L A;  4NHP A;  1L15 A;  185L A;  3QY4 A;  4G4C A;  2X0A A;  3KAM A;  4XN6 A;  152L A;  3LYT A;  1QSW A;  1LSE A;  1C66 A;  1TDY A;  1L37 A;  3T6U A;  1IOC A;  1UUZ C;  3P66 A;  1N4F A;  255L A;  2CGI A;  4NSJ A;  3SB8 A;  3ATO A;  244L A;  211L A;  1LHK A;  4LT0 A;  3V2W A;  1L71 A;  2B73 A;  1L58 A;  1L16 A;  4NSH A;  4DD7 A;  1YRO A;  1C6T A;  2OU9 A;  5AMY A;  3EXD A;  5T3F A;  5DN4 A;  4DD1 A;  3LYZ A;  1REZ A;  1PQM A;  3GUP A;  3WPK A;  2YBM A;  5FHW A;  1B7N A;  3C7Y A;  5I4X A;  1QTV A;  3HUQ A;  155L A;  3A6C Y;  1HEN A;  1CU2 A;  1CV3 A;  1YAQ A;  1JQU A;  2DQI Y;  212L A;  1LZ9 A;  4WM1 A;  4HV2 A;  1L49 A;  4ARL A;  1GBW A;  4XJD A;  4DQ7 A;  2C8O A;  3C7Z A;  229L A;  3V2Y A;  1LZD A;  1XEP A;  1L04 A;  1KXY A;  3QE8 A;  5HNL A;  2HUL A;  1KW5 A;  4I7K A;  1PQI A;  1CKD A;  1L50 A;  4HTN A;  4LFX A;  1L18 A;  2DQD Y;  5HMJ A;  4P2E A;  3W6B A;  192L A;  2MED A;  1LJH A;  3LZM A;  4NWE A;  1ZWN A;  2MEH A;  1GB2 A;  1K28 A;  4C3W A;  1LYD A;  2XTH A;  1LZR A;  187L A;  1MLC E;  5F9U A;  237L A;  1EQ5 A;  247L A;  2EKS C;  2BQO A;  119L A;  1LPI A;  1LYF A;  3HDF A;  3HTB A;  2I6Z A;  1L0J A;  1QT3 A;  3A8Z A;  2ANV A;  4OWH A;  1GFK A;  3A96 A;  1HFY A;  1JTN A;  201L A;  4DD3 A;  1QUO A;  3LYM A;  3CSZ A;  9LYZ A;  1OVH A;  248L A;  1L02 A;  4LYM A;  135L A;  1W08 A;  2EIZ C;  1D0K A;  1LGU A;  4GCD A;  5FST A;  3RZ4 A;  1XGU C;  1OUB A;  4W94 A;  5KXY A;  1NWG A;  4GCB A;  1GFG A;  4EKS A;  5B06 A;  171L A;  4M4O A;  2DQF C;  1GBX A;  3B0I A;  3K3T A;  1L67 A;  3TXE A;  1LMC A;  1NHB A;  1CV5 A;  5KKJ A;  1IEE A;  137L A;  3TXD A;  1L06 A;  5KXX A;  4W54 A;  2BQB A;  1JUG A;  4WL6 A;  1YKY X;  3M3U A;  1C62 A;  233L A;  2A7F A;  4GN3 A;  3W6D A;  4YEO A;  4ANR A;  1DYE A;  3DMX A;  1C69 A;  4LYT A;  1LSG A;  230L A;  195L A;  2FYC A;  5LVI A;  3HWL A;  1JKD A;  2HEB A;  3LZ2 A;  1GFA A;  223L A;  194L A;  1J1X Y;  5LVG A;  231L A;  188L A;  1UIH A;  3HT7 A;  3A95 A;  5B07 A;  3W6E A;  2ZYC A;  1P56 A;  3W6C A;  4H8Z A;  1L42 A;  2RAY X;  3SB5 A;  4WM2 A;  1JKA A;  2Z12 A;  4QY9 A;  1XGQ C;  4I7P A;  1ZVY B;  1QUH A;  3G3B B;  102L A;  4NGW A;  6LYT A;  4EOF A;  1NKH A;  1CU0 A;  168L A;  1PQJ A;  4YX7 C;  3F9L A;  4RW2 A;  1CU3 A;  1SWY A;  4YEN A;  4OWA A;  1LMA A;  1GFU A;  4PPO A;  5KXW A;  3CDV A;  162L A;  3C8Q A;  1EL1 A;  4DQ5 A;  3EMS A;  1OUC A;  1QT7 A;  1L99 A;  4KPM A;  4NGO A;  1L26 A;  1NQI A;  4I7J A;  1QT6 A;  2Z2F A;  4H8X A;  1E8L A;  1CKG A;  3HT6 A;  3HU8 A;  2ZNX Y;  2Z37 A;  1DYD A;  2CJL A;  2F47 A;  4ETB A;  3C80 A;  1QQY A;  2H9K A;  3LZT A;  1G0Q A;  3MGW A;  227L A;  4UWU A;  3TXH A;  5F16 A;  1D2W A;  1XJU A;  3CSQ A;  1L80 A;  2MEG A;  3ULR A;  1B7S A;  3FA0 A;  5F81 A;  4ETC A;  5EBH A;  1GF8 A;  1C67 A;  1C6I A;  5HMV A;  2LCB A;  2OU8 A;  1BB7 A;  3DMV A;  4ML7 A;  2G4P A;  1IP3 A;  1QTH A;  1C6P A;  1LYY A;  224L A;  1YKZ X;  4GCF A;  4ARQ A;  5F9X A;  1G0G A;  1L88 A;  1L94 A;  1BVX A;  1HSX A;  2HTX A;  1L61 A;  5KXN A;  5L9J A;  1VDQ A;  1C7P A;  1LJG A;  3VW7 A;  4QEQ A;  5APE A;  3OE0 A;  2AUB A;  1XJT A;  1REM A;  4I0C A;  4OO9 A;  5DLA A;  1QUG A;  1BGI A;  1LJE A;  4YXA C;  3NYA A;  243L A;  177L A;  123L A;  4NGZ A;  1F6R A;  1LSD A;  1REX A;  2A7D A;  1XGP C;  4G4H A;  2YDG A;  4D9Z A;  1HHL A;  1DYC A;  1SX7 A;  1GF7 A;  5M1Y A;  4N1E I;  3DN3 A;  1LGW A;  1JWR A;  3TXG A;  1DPX A;  4ETA A;  4I7T A;  4NHI A;  1PQD A;  4W96 A;  2D4K A;  1C6M A;  103L A;  7LZM A;  4GN4 A;  4YXC A;  1QSQ A;  1LZ1 A;  2H5Z A;  1JKC A;  2BAA A;  5FCP A;  4TWS A;  4W53 A;  2ZIK A;  2D4I A;  5L3I A;  2Z2E A;  1CJ6 A;  3PDS A;  1LHJ A;  206L A;  1HFX A;  1LSB A;  4WLX A;  5I5Q A;  3B0O A;  1G7M C;  4CGE A;  167L A;  3K2R A;  3CDQ A;  1GE3 A;  1GB3 A;  1L66 A;  4LT3 A;  1L33 A;  1T6V L;  1XSF A;  4H1P A;  1L87 A;  2GV0 A;  4LZT A;  163L A;  4O34 A;  4W51 A;  3TXB A;  257L A;  4BAF A;  1L43 A;  2LZ2 A;  2OEA X;  1L08 A;  174L A;  3FI7 A;  2LZM A;  4EXM A;  1A4V A;  4HV1 A;  4N0J A;  5APD A;  1PQO A;  2BQD A;  3OJP A;  1OYU A;  1P2L A;  3SBA A;  1B6I A;  1OWY A;  141L A;  240L A;  150L A;  1QT8 A;  1GEZ A;  1JKB A;  3WW6 A;  1GE4 A;  1L0K A;  1IY4 A;  4Z98 A;  3GUN A;  5A3Z A;  4W58 A;  4W55 A;  1KIP C;  4XJB A;  2I25 L;  1PS5 A;  1BB3 A;  3CB7 A;  3EBA B;  1IIZ A;  2BQF A;  2MEI A;  1IP7 A;  3A3R X;  4XJG A;  3P4Z A;  4OWB A;  2Z6B A;  2QAR C;  4PRU A;  1JTM A;  2IGC A;  5KXK A;  1T97 A;  3E3D A;  1B7Q A;  4WLY A;  1G1V A;  1DKJ A;  4NGV A;  2D6B A;  5I54 A;  165L A;  1ZMY L;  5B1G A;  196L A;  1G0K A;  1DI5 A;  4J1A A; 
#chains in the Genus database with same CATH homology
 3TMW A;  164L A;  1CJ8 A;  2F32 A;  1JHL A;  4N1C C;  4NY5 A;  1C68 A;  3F8V A;  4EKQ A;  107L A;  5LYT A;  1LHH A;  1QTC A;  1L25 A;  1L60 A;  1GXV 2;  182L A;  1L23 A;  4NGJ A;  1L85 A;  3NY8 A;  1OUG A;  2BQE A;  4UWN A;  4AQN A;  3TXJ A;  1OUI A;  1LJ3 A;  1CV6 A;  5HQ1 A;  3DN2 A;  1G0P A;  1HER A;  4NHT A;  4ETE A;  246L A;  4ZEE A;  4CJ2 A;  1GF9 A;  3DN1 A;  1YL1 X;  1O23 A;  1WTM A;  3HTG A;  1GFT A;  1LJN A;  3WH1 A;  1OUF A;  1CJ9 A;  1GPQ C;  3GUO A;  1NBY C;  1LZ6 A;  1L59 A;  1LHL A;  134L A;  1LOZ A;  3L64 A;  2DKV A;  1SQ2 L;  200L A;  2Q9D A;  1TCY A;  1B0D A;  1CTW A;  4TTD A;  126L A;  1GBS A;  1L75 A;  2Y8P A;  148L E;  4WL7 A;  1L82 A;  4ZIX A;  1CNS A;  1L63 A;  1IOR A;  3DNA A;  1NF5 A;  4PHI A;  5I14 A;  3N9A A;  3M18 B;  261L A;  1LYO A;  1BWI A;  3HBE X;  4RW1 A;  1L27 A;  4ET8 A;  4GCC A;  3FE0 A;  4EKP A;  2BLY A;  4S0W A;  1LSF A;  1IOS A;  1YAP A;  1WQR A;  111L A;  3WPJ A;  6LYZ A;  3HH3 A;  4LDO A;  1D3M A;  183L A;  3C8R A;  1IP6 A;  4A7D A;  5C6J A;  4M6D A;  4NWH A;  1XGR C;  3HFM Y;  4EJ4 A;  4LGK A;  1WQM A;  4TSC A;  4B4J A;  3TMX A;  5B59 A;  5KXS A;  2W1L A;  2XJW A;  3RU5 A;  205L A;  1DYG A;  4YF2 A;  1HNL A;  2OE4 X;  4OOO A;  2W1X A;  4HPI A;  1GDW A;  1AZF A;  2B6Y A;  4HP0 A;  3ZEK A;  1J1P Y;  1QDR A;  2B6W A;  1J1O Y;  1UIC A;  5KY1 A;  1EPY A;  3CDT A;  3G3X A;  2OE9 X;  1UAC Y;  180L A;  3VWO A;  242L A;  5LIO A;  1LZG A;  1UIE A;  1CV1 A;  1CJ7 A;  2N5Z A;  1FKQ A;  4CFP A;  2BQM A;  1T8F A;  2LC9 A;  1ALC A;  3GXK A;  1Z55 A;  1JTO L;  1OP9 B;  2RBP A;  3A67 Y;  3GXR A;  2BPU A;  1L31 A;  4FJR A;  1DKK A;  4IAS A;  1KIQ C;  253L A;  2VB1 A;  144L A;  1JTT L;  1JIT A;  1LSM A;  2W1Y A;  1AM7 A;  5D5C A;  1D6P A;  1QTZ A;  1YAM A;  2ZYP A;  4NFV A;  3AGI A;  1VDP A;  2F30 A;  113L A;  115L A;  1NMM A;  4H9E A;  1GE1 A;  2LYO A;  3L2X A;  1L53 A;  1LYJ A;  1GXX A;  1QTB A;  1C45 A;  2YBH A;  1OV5 A;  1CX7 A;  249L A;  1FLW A;  3OE6 A;  1C6Q A;  3WUM A;  4ARJ A;  3HH6 A;  1JIY A;  2FYD A;  1G7I C;  1L56 A;  1L62 A;  1L57 A;  214L A;  4EMN A;  1TEW A;  1MEL L;  4N8Z A;  250L A;  4H94 A;  5LZM A;  197L A;  2XBS A;  1QS5 A;  4TSB A;  3C7W A;  1HML A;  128L A;  4WG1 A;  1VFB C;  3HH5 A;  1CKC A;  251L A;  4B4E A;  2L78 A;  1G06 A;  1QTK A;  3WUA A;  3DKE X;  2B70 A;  1DPW A;  1LLH A;  4E3U A;  1L40 A;  2PC2 A;  2F4G A;  4NGY A;  4MST A;  2F2Q A;  4LDL A;  1LZC A;  3CDO A;  3WXU A;  4ETD A;  5IHG A;  4IAT A;  2O7A A;  4GRV A;  4H92 A;  1NDM C;  3HTD A;  4G9S A;  3A34 A;  1SX2 A;  5APC A;  3WXT A;  109L A;  3HTF A;  5FEK A;  1QIO A;  3LYO A;  1GWD A;  1L05 A;  2B6X A;  4EKR A;  3IJV A;  1WVV A;  3W6F A;  2XQO A;  1GEV A;  4I8S A;  1T8A A;  4DWX A;  2DBT A;  2ZWB A;  4FDY A;  4HSF A;  3SBB C;  5A3E A;  4B0D A;  2OTZ X;  1LSP A;  4DD0 A;  4TUN A;  1C6H A;  5J7C A;  157L A;  2RH1 A;  2MEE A;  175L A;  4XJI A;  4NGK A;  3DN6 A;  5I4Y A;  3HBD A;  4LYO A;  1B5U A;  4BAD A;  1OUD A;  1P7S A;  1NHE A;  3AW7 A;  1OUH A;  3GUI A;  1SLY A;  1L38 A;  1LHI A;  2QB0 B;  4HJV A;  1L41 A;  5B05 A;  140L A;  1WVU A;  2BQH A;  1C08 C;  3AZ5 A;  4W52 A;  1C43 A;  1IWT A;  1L54 A;  2G4Q A;  1UIA A;  149L A;  1P2R A;  4DAJ A;  1GD6 A;  1IVM A;  1L32 A;  5K7O A;  2NTH A;  4ZFP A;  213L A;  4MR1 A;  1IWX A;  1CX6 A;  1D0M A;  1LHM A;  1HFZ A;  3RUN A;  1HEP A;  4HJZ A;  110L A;  5LA5 A;  2Z39 A;  4NIJ A;  4WMG A;  3WYH A;  3ATN A;  1OQM A;  2HEC A;  1FDL Y;  2B75 A;  5LYM A;  3C83 A;  2HUK A;  129L A;  3DN8 A;  1LI2 A;  1L92 A;  2HU3 A;  2D4J A;  3HH4 A;  1IP2 A;  1DZB X;  2YVB A;  4LT2 A;  1LKR A;  1GBZ A;  1B7R A;  1OV7 A;  2F4A A;  1IX0 A;  2NWD X;  1GAZ A;  2Q9E A;  1C6F A;  4L41 A;  4UWV A;  1P37 A;  5DM9 A;  5C6L A;  142L A;  1QSA A;  1GBY A;  4I7O A;  1B7P A;  5KXL A;  4YOP A;  4BS7 A;  1DQJ C;  3SB7 A;  1LYS A;  1C6L A;  4PK0 A;  1G7L C;  3GUM A;  1LYE A;  4EPF A;  1KIR C;  1GF0 A;  1L00 A;  1QSB A;  3QAK A;  156L A;  1C6K A;  2EQL A;  4ARM A;  2CWI A;  1L10 A;  176L A;  5APF A;  3W6A A;  4PGJ B;  1GAY A;  166L A;  5I53 A;  2RBO A;  1B7O A;  232L A;  1GHL A;  4OW1 A;  1PZY A;  169L A;  1UIG A;  4OWE A;  2YBN A;  2D91 A;  3GUL A;  1L29 A;  186L A;  3HBH A;  1YQV Y;  3C82 A;  1L69 A;  3CT5 A;  3DN4 A;  5KJ9 A;  1LSC A;  1L76 A;  1L39 A;  3CDR A;  7LYZ A;  2WAR A;  3SP3 A;  4J1B A;  1QUS A;  1DYA A;  1L89 A;  1T3P A;  5I4W A;  239L A;  3OE9 A;  2B6T A;  2W1M A;  3P65 A;  3NY9 A;  1L97 A;  221L A;  4N9R A;  3TXI A;  4ZPU A;  4MCK A;  153L A;  4XAD A;  2ANX A;  245L A;  1BB6 A;  1IOQ A;  4XEN A;  3CSR A;  2FBB A;  3RW8 A;  127L A;  1HEL A;  1D3F A;  2RBR A;  1L79 A;  1GB0 A;  1DXJ A;  4WLD A;  3ZVQ A;  2MEB A;  2MEF A;  1GB9 A;  4RDS A;  1L52 A;  3AJN A;  3CT0 A;  2NTG A;  3HUK A;  3DMZ A;  3AYQ A;  1G7J C;  4NG8 A;  3JR6 A;  4H9H A;  1L98 A;  1KXW A;  5IDD A;  1CV4 A;  2HED A;  1L90 A;  4GBR B;  1EQ4 A;  125L A;  4II8 A;  2ZQ3 A;  2I26 L;  1IP4 A;  3B0K A;  1V7T A;  3B72 A;  1OUE A;  1AT6 A;  4U3X B;  3G3W A;  1GF5 A;  3LHM A;  1HMK A;  1LSZ A;  1C10 A;  172L A;  2B5Z A;  1JJ0 A;  1G0J A;  1D0L A;  1BQL Y;  158L A;  1B7M A;  1UA6 Y;  1GF4 A;  210L A;  1SSW A;  4N5R A;  241L A;  1IWW A;  5B1F A;  2EPE A;  1C6E A;  1RI8 B;  3HT8 A;  1G7H C;  3DN0 A;  1B5Y A;  3ODU A;  3PBL A;  1QT4 A;  1KS3 A;  1REY A;  1WQQ A;  161L A;  3EML A;  5HLL A;  1FKV A;  1HEM A;  4RLN A;  1LYZ A;  170L A;  1P6Y A;  1LI6 A;  1CKH A;  1LWG A;  1UCO A;  1YL0 X;  2RB0 X;  1LZ8 A;  3OE8 A;  3IJU A;  5L3H A;  1LZA A;  1NDG C;  1LKS A;  1L11 A;  1LMO A;  2BQG A;  4B1A A;  3FAD A;  8LYZ A;  4ARQ B;  3WW5 A;  1LGX A;  1BHZ A;  4DKL A;  4XJH A;  1IP5 A;  4I7M A;  1P36 A;  154L A;  4H91 A;  1C63 A;  1GBO A;  1C6N A;  1LYI A;  2YBJ A;  1G1W A;  220L A;  3WU9 A;  5LXW A;  1EQE A;  1L01 A;  5KXZ A;  131L A;  2O4W A;  198L A;  4DDA A;  4XJF A;  1B9O A;  1JIS A;  4WO6 A;  1L19 A;  1CV0 A;  1GF3 A;  3HDE A;  122L A;  5ILC A;  143L A;  1XEJ A;  1F6S A;  178L A;  4W59 A;  4KXI A;  3FI5 A;  4NGL A;  4ARM B;  1L47 A;  5FEL A;  5F14 A;  159L A;  1HSW A;  2BQN A;  219L A;  259L A;  2RAZ X;  1ZVH L;  5C6I A;  1CU5 A;  1LW9 A;  1C6C A;  4XYY A;  2DQE Y;  1L21 A;  1L45 A;  4I7Q A;  5LIN A;  1QTE A;  1L34 A;  2RB2 X;  3WVX A;  4H9C A;  2B74 A;  4NHS A;  4HPE A;  1IR9 A;  1CU6 A;  3J6K A;  1ZYT A;  1C6G A;  1P3N A;  1QT5 A;  1I6S A;  1PQK A;  2RB1 X;  1C6A A;  5LVJ A;  218L A;  147L A;  1L64 A;  1L12 A;  1OWZ A;  222L A;  1G0M A;  1L55 A;  1L09 A;  1WQO A;  3RZE A;  1L83 A;  3F6Z A;  1OVJ A;  4NEB A;  2RSC A;  3G3A B;  1UID A;  4W57 A;  2B6Z A;  1LJF A;  2B72 A;  5HNC A;  1WQP A;  3ZVQ B;  2Z18 A;  1I1Z A;  2C8P A;  1B5Z A;  1JJ1 A;  3AZ7 A;  1D9U A;  130L A;  4I7R A;  1C61 A;  4TX7 A;  1GE0 A;  4CHX A;  1CUQ A;  2ZIJ A;  4G49 A;  1L72 A;  3AGH A;  2BQA A;  2YBL A;  1HEW A;  254L A;  5KKI A;  4DD9 A;  139L A;  1AT5 A;  225L A;  1UIB A;  1FBI X;  2OU0 X;  193L A;  1V7S A;  4DC4 A;  3A90 A;  1NBZ C;  3A91 A;  3RNX A;  4NG1 A;  4NHQ A;  2YSS C;  5D5F A;  209L A;  4WM3 A;  2YBI A;  2HEE A;  1BB4 A;  3D3D A;  1GFV A;  1L24 A;  2HUM A;  1XEK A;  1WTH A;  2Z38 A;  4EPI A;  3BKV A;  112L A;  1JJ3 A;  1C6D A;  1JSE A;  3QNG A;  4IAP A;  1CVK A;  262L A;  1H6M A;  1L95 A;  4ARP A;  4OOT A;  4H93 A;  1INU A;  1B2K A;  1LSA A;  1YIK A;  258L A;  1C46 A;  1LAA A;  4WLT A;  3D9A C;  1F10 A;  1G0L A;  4IJ4 A;  1D3N A;  1LMN A;  1DYB A;  4GLV A;  1JSF A;  1GFJ A;  145L A;  1LJJ A;  5LVH A;  1B5X A;  1WQN A;  3TXF A;  1LYG A;  1IO5 A;  1I56 A;  2A4T A;  2ZNW Y;  1GFH A;  1HEQ A;  1OUA A;  3C81 A;  1IR8 A;  1LZT A;  3WUL A;  1LZS A;  1GE2 A;  4K5Y A;  1YIL A;  1QUT A;  181L A;  1L07 A;  4HTQ A;  160L A;  3HU9 A;  4X3B A;  1L48 A;  1B7L A;  4GN5 C;  1BWH A;  1L13 A;  4ET9 A;  4I7S A;  1LSN A;  1D2Y A;  1QS9 A;  1L93 A;  1FN5 A;  235L A;  4Z46 A;  4WO9 A;  2IFF Y;  4PRQ A;  1HC0 A;  1XEI A;  2ZQ4 A;  2F2N A;  4B49 A;  217L A;  1IWU A;  260L A;  2OTY X;  3B6L A;  1L70 A;  1L86 A;  1LZ5 A;  1UBZ A;  4QDN A;  5LYZ A;  5ILF A;  1P5C A;  5KXR A;  1IY3 A;  3SB6 A;  6LZM A;  1L35 A;  2HU1 A;  4HJY A;  3OK0 A;  2Q0M X;  4NSI A;  4LYC A;  108L A;  1L74 A;  3C8S A;  1P64 A;  5E9R A;  1FLU A;  2RBQ A;  3TXK A;  3EO5 A;  4DD2 A;  146L A;  1XFP L;  1RFP A;  3P68 A;  4I7L A;  238L A;  1BB5 A;  226L A;  1IC4 Y;  5DL9 A;  1C60 A;  1GB5 A;  1JEF A;  1L96 A;  1CKF A;  2G4N A;  1L20 A;  1DYF A;  1KW7 A;  4PJZ A;  1KY1 A;  4AXT A;  1FLQ A;  2ZIL A;  3N9E A;  3AB6 A;  4WOA A;  3TMU A;  1WTN A;  1L14 A;  3AZ6 A;  4LT1 A;  2H9J A;  1T8G A;  1UIF A;  1LJ4 A;  2OE7 X;  120L A;  1C6B A;  118L A;  1GB6 A;  1RE2 A;  1P2C C;  4H90 A;  1RCM A;  3HUA A;  1LSY A;  1IC7 Y;  4W56 A;  3CT1 A;  114L A;  3WMK A;  190L A;  2BQC A;  1LCN A;  4BAP A;  1GF6 A;  3RT5 X;  1OUJ A;  1LPY A;  4OWC A;  4Z3M A;  1GB7 A;  4DJH A;  4DYG A;  1L77 A;  1SWZ A;  4GLA A;  1FLY A;  2LZT A;  4GCE A;  5E4P A;  1TBY A;  1KY0 A;  1OVK A;  5FDJ A;  1UC0 A;  1VED A;  1B5W A;  3P64 A;  3A93 A;  208L A;  4YM8 A;  1A2Y C;  1VAU A;  2DQH Y;  4PJ2 C;  1H87 A;  5LAG A;  5KXO A;  1IC5 Y;  4DQJ A;  1YAO A;  3T36 A;  4AGA A;  216L A;  4J0L A;  1GB8 A;  1TAY A;  4C5F A;  1IWV A;  4DT3 A;  1TLA A;  2BLX A;  4H8Y A;  2MEA A;  4WG7 A;  2Z19 A;  1B5V A;  2MEC A;  4Z41 A;  1YAN A;  3N9C A;  5II3 A;  3GUJ A;  1LZN A;  2BQL A;  3TMV A;  2B7X A;  2O79 A;  3J4G A;  2HEF A;  234L A;  104L A;  1IWY A;  3W3E A;  3CQL A;  1IOT A;  1GFR A;  4J7V A;  1L30 A;  1C65 A;  5KXP A;  1ZV5 L;  1BVK C;  4WM6 A;  4LFP A;  1GDX A;  4LYB A;  3SB9 A;  199L A;  4WM5 A;  1HF4 A;  4B4I A;  138L A;  1KXX A;  1LI3 A;  2LYZ A;  3AZ4 A;  1L03 A;  1IR7 A;  1LTM A;  1BWJ A;  1LJK A;  1QDT A;  4R6C A;  4QGZ A;  2XBR A;  4WM4 A;  2BQK A;  1G07 A;  2DQA A;  1LMT A;  4KT3 A;  4LDE A;  1D9W A;  5LAF A;  2CUU A;  1VAT A;  2DQC Y;  4YEM A;  2FBD A;  3WL2 A;  3IWR A;  1LMQ A;  5LVK A;  1LZE A;  1YKX X;  3AW6 A;  4DDC A;  4CFO A;  1VDT A;  1D3J A;  4RLM A;  1F0W A;  3WUN A;  1L22 A;  1VDS A;  3D4S A;  4H9F A;  1L73 A;  1IWZ A;  4G4B A;  252L A;  2CDS A;  1C64 A;  173L A;  3A3Q A;  3LN2 A;  1L84 A;  1L17 A;  191L A;  3WU7 A;  1L46 A;  1GFE A;  2LYM A;  1L81 A;  1KNI A;  5JEN B;  3SN6 R;  1LYH A;  3A94 A;  2BQJ A;  1L65 A;  1CUP A;  228L A;  3G3V A;  1L44 A;  1LZ4 A;  4NSG A;  4R0F A;  4LYZ A;  1QUD A;  4LZM A;  189L A;  236L A;  4DDB A;  1L91 A;  5KXM A;  4NGI A;  133L A;  207L A;  4H9B A;  2HEA A;  256L A;  1ZUR A;  2BQI A;  1JTP L;  2LHM A;  4H9I A;  132L A;  1LZB A;  4I7N A;  1D6Q A;  184L A;  1I20 A;  2HUB A;  2DQG Y;  1SSY A;  2IHL A;  1L28 A;  1AKI A;  2RBN A;  3HT9 A;  1HEO A;  5KXT A;  1LJI A;  215L A;  1QTD A;  4KL7 A;  1LWK A;  1LMP A;  1L51 A;  4HTK A;  3WPL A;  1IP1 A;  3A6B Y;  3AGG G;  3BKH A;  1RJC B;  1L68 A;  3UON A;  4H9A A;  5IEL A;  2RBS A;  1T6H A;  5DN5 A;  1P46 A;  1DI4 A;  1W6Z A;  4E97 A;  1L36 A;  1C6J A;  3WU8 A;  1JPO A;  2DQJ Y;  1XGT C;  3GUK A;  3A92 A;  5LA8 A;  3WVY A;  1DI3 A;  1LZY A;  151L A;  4NHP A;  1L15 A;  185L A;  3QY4 A;  4G4C A;  2X0A A;  3KAM A;  4XN6 A;  152L A;  3LYT A;  1QSW A;  1LSE A;  1C66 A;  1TDY A;  1L37 A;  3T6U A;  1IOC A;  1UUZ C;  3P66 A;  1N4F A;  255L A;  2CGI A;  4NSJ A;  3SB8 A;  3ATO A;  244L A;  211L A;  1LHK A;  4LT0 A;  3V2W A;  1L71 A;  2B73 A;  1L58 A;  1L16 A;  4NSH A;  4DD7 A;  1YRO A;  1C6T A;  2OU9 A;  5AMY A;  3EXD A;  5T3F A;  5DN4 A;  4DD1 A;  3LYZ A;  1REZ A;  1PQM A;  3GUP A;  3WPK A;  2YBM A;  5FHW A;  1B7N A;  3C7Y A;  5I4X A;  1QTV A;  3HUQ A;  155L A;  3A6C Y;  1HEN A;  1CU2 A;  1CV3 A;  1YAQ A;  1JQU A;  2DQI Y;  212L A;  1LZ9 A;  4WM1 A;  4HV2 A;  1L49 A;  4ARL A;  1GBW A;  4XJD A;  4DQ7 A;  2C8O A;  3C7Z A;  229L A;  3V2Y A;  1LZD A;  1XEP A;  1L04 A;  1KXY A;  3QE8 A;  5HNL A;  2HUL A;  1KW5 A;  4I7K A;  1PQI A;  1CKD A;  1L50 A;  4HTN A;  4LFX A;  1L18 A;  2DQD Y;  5HMJ A;  4P2E A;  3W6B A;  192L A;  2MED A;  1LJH A;  3LZM A;  4NWE A;  1ZWN A;  2MEH A;  1GB2 A;  1K28 A;  4C3W A;  1LYD A;  2XTH A;  1LZR A;  187L A;  1MLC E;  5F9U A;  237L A;  1EQ5 A;  247L A;  2EKS C;  2BQO A;  119L A;  1LPI A;  1LYF A;  3HDF A;  3HTB A;  2I6Z A;  1L0J A;  1QT3 A;  3A8Z A;  2ANV A;  4OWH A;  1GFK A;  3A96 A;  1HFY A;  1JTN A;  201L A;  4DD3 A;  1QUO A;  3LYM A;  3CSZ A;  9LYZ A;  1OVH A;  248L A;  1L02 A;  4LYM A;  135L A;  1W08 A;  2EIZ C;  1D0K A;  1LGU A;  4GCD A;  5FST A;  3RZ4 A;  1XGU C;  1OUB A;  4W94 A;  5KXY A;  1NWG A;  4GCB A;  1GFG A;  4EKS A;  5B06 A;  171L A;  4M4O A;  2DQF C;  1GBX A;  3B0I A;  3K3T A;  1L67 A;  3TXE A;  1LMC A;  1NHB A;  1CV5 A;  5KKJ A;  1IEE A;  137L A;  3TXD A;  1L06 A;  5KXX A;  4W54 A;  2BQB A;  1JUG A;  4WL6 A;  1YKY X;  3M3U A;  1C62 A;  233L A;  2A7F A;  4GN3 A;  3W6D A;  4YEO A;  4ANR A;  1DYE A;  3DMX A;  1C69 A;  4LYT A;  1LSG A;  230L A;  195L A;  2FYC A;  5LVI A;  3HWL A;  1JKD A;  2HEB A;  3LZ2 A;  1GFA A;  223L A;  194L A;  1J1X Y;  5LVG A;  231L A;  188L A;  1UIH A;  3HT7 A;  3A95 A;  5B07 A;  3W6E A;  2ZYC A;  1P56 A;  3W6C A;  4H8Z A;  1L42 A;  2RAY X;  3SB5 A;  4WM2 A;  1JKA A;  2Z12 A;  4QY9 A;  1XGQ C;  4I7P A;  1ZVY B;  1QUH A;  3G3B B;  102L A;  4NGW A;  6LYT A;  4EOF A;  1NKH A;  1CU0 A;  168L A;  1PQJ A;  4YX7 C;  3F9L A;  4RW2 A;  1CU3 A;  1SWY A;  4YEN A;  4OWA A;  1LMA A;  1GFU A;  4PPO A;  5KXW A;  3CDV A;  162L A;  3C8Q A;  1EL1 A;  4DQ5 A;  3EMS A;  1OUC A;  1QT7 A;  1L99 A;  4KPM A;  4NGO A;  1L26 A;  1NQI A;  4I7J A;  1QT6 A;  2Z2F A;  4H8X A;  1E8L A;  1CKG A;  3HT6 A;  3HU8 A;  2ZNX Y;  2Z37 A;  1DYD A;  2CJL A;  2F47 A;  4ETB A;  3C80 A;  1QQY A;  2H9K A;  3LZT A;  1G0Q A;  3MGW A;  227L A;  4UWU A;  3TXH A;  5F16 A;  1D2W A;  1XJU A;  3CSQ A;  1L80 A;  2MEG A;  3ULR A;  1B7S A;  3FA0 A;  5F81 A;  4ETC A;  5EBH A;  1GF8 A;  1C67 A;  1C6I A;  5HMV A;  2LCB A;  2OU8 A;  1BB7 A;  3DMV A;  4ML7 A;  2G4P A;  1IP3 A;  1QTH A;  1C6P A;  1LYY A;  224L A;  1YKZ X;  4GCF A;  4ARQ A;  5F9X A;  1G0G A;  1L88 A;  1L94 A;  1BVX A;  1HSX A;  2HTX A;  1L61 A;  5KXN A;  5L9J A;  1VDQ A;  1C7P A;  1LJG A;  3VW7 A;  4QEQ A;  5APE A;  3OE0 A;  2AUB A;  1XJT A;  1REM A;  4I0C A;  4OO9 A;  5DLA A;  1QUG A;  1BGI A;  1LJE A;  4YXA C;  3NYA A;  243L A;  177L A;  123L A;  4NGZ A;  1F6R A;  1LSD A;  1REX A;  2A7D A;  1XGP C;  4G4H A;  2YDG A;  4D9Z A;  1HHL A;  1DYC A;  1SX7 A;  1GF7 A;  5M1Y A;  4N1E I;  3DN3 A;  1LGW A;  1JWR A;  3TXG A;  1DPX A;  4ETA A;  4I7T A;  4NHI A;  1PQD A;  4W96 A;  2D4K A;  1C6M A;  103L A;  7LZM A;  4GN4 A;  4YXC A;  1QSQ A;  1LZ1 A;  2H5Z A;  1JKC A;  2BAA A;  5FCP A;  4TWS A;  4W53 A;  2ZIK A;  2D4I A;  5L3I A;  2Z2E A;  1CJ6 A;  3PDS A;  1LHJ A;  206L A;  1HFX A;  1LSB A;  4WLX A;  5I5Q A;  3B0O A;  1G7M C;  4CGE A;  167L A;  3K2R A;  3CDQ A;  1GE3 A;  1GB3 A;  1L66 A;  4LT3 A;  1L33 A;  1T6V L;  1XSF A;  4H1P A;  1L87 A;  2GV0 A;  4LZT A;  163L A;  4O34 A;  4W51 A;  3TXB A;  257L A;  4BAF A;  1L43 A;  2LZ2 A;  2OEA X;  1L08 A;  174L A;  3FI7 A;  2LZM A;  4EXM A;  1A4V A;  4HV1 A;  4N0J A;  5APD A;  1PQO A;  2BQD A;  3OJP A;  1OYU A;  1P2L A;  3SBA A;  1B6I A;  1OWY A;  141L A;  240L A;  150L A;  1QT8 A;  1GEZ A;  1JKB A;  3WW6 A;  1GE4 A;  1L0K A;  1IY4 A;  4Z98 A;  3GUN A;  5A3Z A;  4W58 A;  4W55 A;  1KIP C;  4XJB A;  2I25 L;  1PS5 A;  1BB3 A;  3CB7 A;  3EBA B;  1IIZ A;  2BQF A;  2MEI A;  1IP7 A;  3A3R X;  4XJG A;  3P4Z A;  4OWB A;  2Z6B A;  2QAR C;  4PRU A;  1JTM A;  2IGC A;  5KXK A;  1T97 A;  3E3D A;  1B7Q A;  4WLY A;  1G1V A;  1DKJ A;  4NGV A;  2D6B A;  5I54 A;  165L A;  1ZMY L;  5B1G A;  196L A;  1G0K A;  1DI5 A;  4J1A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...